F349072

General Info

Members Datasets Scaffolds Average Seq Length
236 161 472 151

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_12067967|Ga0105239_120679671
Length 173
Sequence VNDQQVQILLVEDNPNDIKLALHAFKMHHLANEVRVVRDGAEALEFIFATGRYADRDLASGPKLILLDLKLPLVDGIEVLRQIKAGERTCLTPVVVMTSSNEERDMVESYKLGVNSYIRKPVDFNQFTEAVRQLGYYWLLLNEVPPCQQLAADGSLSSTSSHATRPLNQMAIC

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
111 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
112 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
113 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
123 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
161 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 0
Rhizosphere 88.98
Stem 0
Stem Tuber 0
Unclassified 9.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_12067967 3300010375 Bacteria 661
2 Ga0070658_10128329 3300005327 Bacteria 2112
3 Ga0070683_100528088 3300005329 Bacteria 1128
4 Ga0070670_100386377 3300005331 Bacteria 1234
5 Ga0070660_100035019 3300005339 Bacteria 3798
6 Ga0070689_100089672 3300005340 Bacteria 2422
7 Ga0070689_100424007 3300005340 Bacteria 1128
8 Ga0070691_10015439 3300005341 Bacteria 3510
9 Ga0070687_100269727 3300005343 Bacteria 1066
10 Ga0070692_10125384 3300005345 Unclassified 1437
11 Ga0070674_100250083 3300005356 Bacteria 1392
12 Ga0070688_100456726 3300005365 Bacteria 956
13 Ga0070667_101049077 3300005367 Unclassified 761
14 Ga0070714_100849332 3300005435 Bacteria 885
15 Ga0070714_101321851 3300005435 Bacteria 704
16 Ga0070700_100002581 3300005441 Bacteria 9260
17 Ga0070700_100735516 3300005441 Unclassified 788
18 Ga0070694_100519562 3300005444 Bacteria 950
19 Ga0070694_101362167 3300005444 Bacteria 598
20 Ga0070708_100001106 3300005445 Bacteria 20572
21 Ga0070708_100012012 3300005445 Bacteria 7058
22 Ga0070708_100104118 3300005445 Bacteria 2602
23 Ga0070678_100394845 3300005456 Bacteria 1200
24 Ga0070681_11167337 3300005458 Bacteria 692
25 Ga0070706_100000038 3300005467 Bacteria 150665
26 Ga0070706_100012761 3300005467 Bacteria 7775
27 Ga0070706_100071628 3300005467 Bacteria 3206
28 Ga0070706_100639951 3300005467 Bacteria 987
29 Ga0070706_101799550 3300005467 Bacteria 557
30 Ga0070707_100133123 3300005468 Bacteria 2418
31 Ga0070707_100142542 3300005468 Bacteria 2332
32 Ga0070707_100166067 3300005468 Bacteria 2151
33 Ga0070707_100633734 3300005468 Bacteria 1032
34 Ga0070707_101240849 3300005468 Unclassified 712
35 Ga0070698_100000014 3300005471 Bacteria 112657
36 Ga0070698_100000730 3300005471 Bacteria 35317
37 Ga0070698_100039776 3300005471 Bacteria 4837
38 Ga0070698_100060562 3300005471 Bacteria 3820
39 Ga0070698_100319576 3300005471 Bacteria 1483
40 Ga0070698_100705891 3300005471 Bacteria 951
41 Ga0070699_100000445 3300005518 Bacteria 39754
42 Ga0070699_100025953 3300005518 Bacteria 5052
43 Ga0070699_100225675 3300005518 Bacteria 1670
44 Ga0070699_101746804 3300005518 Bacteria 570
45 Ga0070697_100001664 3300005536 Bacteria 16959
46 Ga0070697_100031456 3300005536 Bacteria 4269
47 Ga0070697_100082869 3300005536 Bacteria 2644
48 Ga0068853_100115069 3300005539 Bacteria 2393
49 Ga0070686_100596180 3300005544 Bacteria 870
50 Ga0070696_100097410 3300005546 Bacteria 2103
51 Ga0070693_100121190 3300005547 Bacteria 1622
52 Ga0070693_101236619 3300005547 Bacteria 575
53 Ga0070665_100077218 3300005548 Bacteria 3337
54 Ga0070704_100321996 3300005549 Bacteria 1296
55 Ga0068855_100036498 3300005563 Bacteria 5849
56 Ga0068855_100045133 3300005563 Bacteria 5213
57 Ga0070664_101377062 3300005564 Bacteria 667
58 Ga0068856_100017219 3300005614 Bacteria 7003
59 Ga0068856_101416954 3300005614 Bacteria 709
60 Ga0070702_100118513 3300005615 Bacteria 1653
61 Ga0068852_100246377 3300005616 Unclassified 1710
62 Ga0068859_101282147 3300005617 Bacteria 807
63 Ga0068859_101500483 3300005617 Bacteria 744
64 Ga0068859_102316620 3300005617 Bacteria 592
65 Ga0068864_100196062 3300005618 Bacteria 1853
66 Ga0068861_102135154 3300005719 Unclassified 560
67 Ga0068870_10066230 3300005840 Bacteria 1956
68 Ga0068863_101399339 3300005841 Bacteria 707
69 Ga0068860_100007530 3300005843 Bacteria 10894
70 Ga0068862_100572245 3300005844 Bacteria 1081
71 Ga0081539_10097352 3300005985 Bacteria 1507
72 Ga0070717_10040380 3300006028 Bacteria 3800
73 Ga0068871_100131779 3300006358 Bacteria 2120
74 Ga0068871_100285037 3300006358 Bacteria 1446
75 Ga0075428_100002738 3300006844 Bacteria 19190
76 Ga0075428_100034161 3300006844 Bacteria 5610
77 Ga0075428_100217039 3300006844 Bacteria 2066
78 Ga0075428_101296528 3300006844 Bacteria 766
79 Ga0075431_101278851 3300006847 Bacteria 695
80 Ga0075433_10341335 3300006852 Unclassified 1324
81 Ga0075434_100099606 3300006871 Bacteria 2912
82 Ga0075434_100868421 3300006871 Bacteria 917
83 Ga0075434_101542768 3300006871 Bacteria 673
84 Ga0075434_101859633 3300006871 Unclassified 608
85 Ga0097620_101281654 3300006931 Bacteria 807
86 Ga0097620_101500893 3300006931 Bacteria 744
87 Ga0097620_102317115 3300006931 Bacteria 592
88 Ga0099794_10271314 3300007265 Bacteria 876
89 Ga0099794_10341597 3300007265 Bacteria 778
90 Ga0105240_10020274 3300009093 Bacteria 8874
91 Ga0105240_10108396 3300009093 Bacteria 3365
92 Ga0111539_10731738 3300009094 Bacteria 1152
93 Ga0111539_10767594 3300009094 Bacteria 1122
94 Ga0105245_10160507 3300009098 Bacteria 2133
95 Ga0114129_10086070 3300009147 Bacteria 4360
96 Ga0114129_10110647 3300009147 Bacteria 3791
97 Ga0114129_10235418 3300009147 Bacteria 2464
98 Ga0105243_10195236 3300009148 Bacteria 1771
99 Ga0105241_10291971 3300009174 Bacteria 1396
100 Ga0105248_11861609 3300009177 Bacteria 683
101 Ga0105237_10614650 3300009545 Bacteria 1094
102 Ga0105238_10052351 3300009551 Bacteria 4103
103 Ga0105249_10385577 3300009553 Bacteria 1428
104 Ga0105246_10316991 3300011119 Bacteria 1265
105 Ga0157374_10500916 3300013296 Bacteria 1219
106 Ga0157374_11631998 3300013296 Bacteria 669
107 Ga0157378_10196396 3300013297 Bacteria 1906
108 Ga0157372_10161389 3300013307 Bacteria 2590
109 Ga0157372_10391501 3300013307 Bacteria 1619
110 Ga0157372_11778651 3300013307 Bacteria 709
111 Ga0157375_10090010 3300013308 Bacteria 3126
112 Ga0157375_10669102 3300013308 Bacteria 1193
113 Ga0163163_11553919 3300014325 Bacteria 723
114 Ga0157380_10337512 3300014326 Bacteria 1404
115 Ga0207643_10110637 3300025908 Bacteria 1618
116 Ga0207684_10000008 3300025910 Bacteria 601602
117 Ga0207684_10001222 3300025910 Bacteria 28585
118 Ga0207684_10003118 3300025910 Bacteria 16345
119 Ga0207684_10998601 3300025910 Bacteria 700
120 Ga0207707_10054499 3300025912 Bacteria 3481
121 Ga0207707_10369841 3300025912 Bacteria 1234
122 Ga0207695_10040087 3300025913 Bacteria 5027
123 Ga0207657_10170686 3300025919 Bacteria 1762
124 Ga0207652_10092547 3300025921 Bacteria 2660
125 Ga0207646_10003170 3300025922 Bacteria 18821
126 Ga0207646_10003967 3300025922 Bacteria 16407
127 Ga0207646_10102631 3300025922 Bacteria 2564
128 Ga0207650_10618031 3300025925 Bacteria 912
129 Ga0207687_10574844 3300025927 Bacteria 947
130 Ga0207664_11781050 3300025929 Bacteria 538
131 Ga0207670_10181972 3300025936 Bacteria 1584
132 Ga0207670_10283632 3300025936 Bacteria 1292
133 Ga0207669_10364147 3300025937 Bacteria 1121
134 Ga0207665_10077354 3300025939 Bacteria 2284
135 Ga0207665_10473144 3300025939 Bacteria 964
136 Ga0207665_10527046 3300025939 Bacteria 915
137 Ga0207661_10077310 3300025944 Bacteria 2737
138 Ga0207679_10793634 3300025945 Bacteria 863
139 Ga0207667_10028593 3300025949 Bacteria 6054
140 Ga0207667_10286336 3300025949 Bacteria 1684
141 Ga0207712_10704420 3300025961 Bacteria 881
142 Ga0207677_10707405 3300026023 Bacteria 894
143 Ga0207639_10299076 3300026041 Bacteria 1422
144 Ga0207708_10005754 3300026075 Bacteria 9159
145 Ga0207708_10803943 3300026075 Unclassified 810
146 Ga0207702_10070459 3300026078 Bacteria 3007
147 Ga0207702_11519421 3300026078 Bacteria 663
148 Ga0207683_10459292 3300026121 Bacteria 1174
149 Ga0207698_10198837 3300026142 Unclassified 1793
150 Ga0209588_1216521 3300027671 Bacteria 593
151 Ga0268266_10291432 3300028379 Bacteria 1520
152 Ga0268264_10001903 3300028381 Bacteria 18918
153 Ga0265337_1013374 3300028556 Bacteria 2755
154 Ga0265334_10049251 3300028573 Bacteria 1621
155 Ga0265318_10180125 3300028577 Bacteria 774
156 Ga0265336_10086791 3300028666 Bacteria 933
157 Ga0265338_10006498 3300028800 Bacteria 14865
158 Ga0265338_10454241 3300028800 Bacteria 907
159 Ga0265324_10000644 3300029957 Bacteria 23701
160 Ga0265328_10027094 3300031239 Bacteria 2150
161 Ga0265325_10134542 3300031241 Bacteria 1181
162 Ga0307516_10374619 3300031730 Bacteria 1086
163 Ga0307412_11315169 3300031911 Unclassified 651
164 Ga0307415_101145445 3300032126 Unclassified 730
165 Ga0373956_0185915 3300035119 Bacteria 983
166 Ga0373933_0449967 3300035724 Bacteria 842
167 Ga0373947_0295178 3300035725 Bacteria 1080
168 Ga0373937_0058175 3300036401 Bacteria 3551
169 Ga0436364_0092027 3300037853 Bacteria 938
170 Ga0436364_0309955 3300037853 Unclassified 2036
171 Ga0436364_1217007 3300037853 Bacteria 966
172 Ga0400484_44947 3300038725 Bacteria 1501
173 Ga0400490_21960 3300038726 Bacteria 1495
174 Ga0400483_028202 3300039062 Bacteria 1137
175 Ga0400483_060291 3300039062 Unclassified 2731
176 Ga0400483_132557 3300039062 Bacteria 7378
177 Ga0400483_147135 3300039062 Bacteria 2520
178 Ga0400483_154556 3300039062 Bacteria 2995
179 Ga0400483_208769 3300039062 Bacteria 7467
180 Ga0400487_59856 3300039110 Bacteria 3466
181 Ga0436365_0455638 3300039437 Bacteria 1608
182 Ga0436363_1450566 3300039450 Bacteria 723
183 Ga0436363_1598223 3300039450 Bacteria 671
184 Ga0451833_1147249 3300041491 Unclassified 662
185 Ga0451841_0883687 3300041498 Bacteria 3223
186 Ga0451849_0659877 3300041505 Bacteria 1853
187 Ga0451853_0944463 3300041512 Bacteria 3253
188 Ga0439441_003414 3300042001 Bacteria 2343
189 Ga0439449_0011084 3300042007 Bacteria 3398
190 Ga0450898_031007 3300042134 Bacteria 981
191 Ga0439434_0017694 3300042435 Bacteria 2133
192 Ga0451577_0001804 3300042876 Bacteria 27397
193 Ga0453683_0013335 3300044673 Bacteria 5370
194 Ga0453684_0168812 3300044712 Unclassified 2581
195 Ga0453684_0870529 3300044712 Bacteria 967
196 Ga0453684_0957967 3300044712 Bacteria 913
197 Ga0453684_1067111 3300044712 Bacteria 855
198 Ga0453684_1190549 3300044712 Unclassified 800
199 Ga0451576_0064295 3300045051 Bacteria 3822
200 Ga0451576_0320365 3300045051 Bacteria 1622
201 Ga0495590_0001386 3300046457 Bacteria 10512
202 Ga0495594_0204723 3300046499 Bacteria 1125
203 Ga0495583_0039263 3300046506 Bacteria 2231
204 Ga0495628_0170099 3300046516 Bacteria 1653
205 Ga0495667_0332618 3300046559 Bacteria 961
206 Ga0495657_0564218 3300046675 Unclassified 660
207 Ga0495599_0499931 3300046678 Bacteria 716
208 Ga0495669_0101145 3300046684 Bacteria 1339
209 Ga0495660_0067126 3300046810 Bacteria 1911
210 Ga0495675_0415151 3300047444 Unclassified 783
211 Ga0495673_0180388 3300047469 Bacteria 800
212 Ga0501298_059583 3300049521 Unclassified 806
213 Ga0501036_0852661 3300049572 Unclassified 749
214 Ga0501037_0018078 3300049573 Bacteria 5193
215 Ga0501040_0393203 3300049576 Bacteria 995
216 Ga0501043_0038421 3300049579 Bacteria 3764
217 Ga0501047_0160715 3300049581 Bacteria 2118
218 Ga0501071_0329283 3300049587 Bacteria 1161
219 Ga0501073_0297194 3300049589 Bacteria 1114
220 Ga0501249_015022 3300049679 Bacteria 1654
221 Ga0501079_0081469 3300049741 Bacteria 2503
222 Ga0501081_0411434 3300049743 Bacteria 1002
223 Ga0501035_0024287 3300049822 Bacteria 5559
224 nmdc:mga0k408_155665_c1 3300050493 Bacteria 1361
225 nmdc:mga05p37_112909_c1 3300050507 Bacteria 3341
226 nmdc:mga05p37_73272_c1 3300050507 Bacteria 4214
227 nmdc:mga08y16_610262_c1 3300050511 Bacteria 1099
228 nmdc:mga0n895_1485700_c1 3300050512 Bacteria 644
229 nmdc:mga0n895_205682_c1 3300050512 Bacteria 1999
230 nmdc:mga0rr50_1487062_c1 3300050513 Unclassified 573
231 nmdc:mga0a205_297181_c1 3300050515 Bacteria 1488
232 Ga0500651_0161646 3300053093 Bacteria 1339
233 Ga0500555_000049 3300053103 Bacteria 61213
234 Ga0500616_0000306 3300053153 Bacteria 70571
235 Ga0500645_002516 3300053730 Bacteria 8099
236 Ga0500599_010582 3300053736 Bacteria 1220
237 Ga0105239_12067967
238 Ga0070658_10128329
239 Ga0070683_100528088
240 Ga0070670_100386377
241 Ga0070660_100035019
242 Ga0070689_100089672
243 Ga0070689_100424007
244 Ga0070691_10015439
245 Ga0070687_100269727
246 Ga0070692_10125384
247 Ga0070674_100250083
248 Ga0070688_100456726
249 Ga0070667_101049077
250 Ga0070714_100849332
251 Ga0070714_101321851
252 Ga0070700_100002581
253 Ga0070700_100735516
254 Ga0070694_100519562
255 Ga0070694_101362167
256 Ga0070708_100001106
257 Ga0070708_100012012
258 Ga0070708_100104118
259 Ga0070678_100394845
260 Ga0070681_11167337
261 Ga0070706_100000038
262 Ga0070706_100012761
263 Ga0070706_100071628
264 Ga0070706_100639951
265 Ga0070706_101799550
266 Ga0070707_100133123
267 Ga0070707_100142542
268 Ga0070707_100166067
269 Ga0070707_100633734
270 Ga0070707_101240849
271 Ga0070698_100000014
272 Ga0070698_100000730
273 Ga0070698_100039776
274 Ga0070698_100060562
275 Ga0070698_100319576
276 Ga0070698_100705891
277 Ga0070699_100000445
278 Ga0070699_100025953
279 Ga0070699_100225675
280 Ga0070699_101746804
281 Ga0070697_100001664
282 Ga0070697_100031456
283 Ga0070697_100082869
284 Ga0068853_100115069
285 Ga0070686_100596180
286 Ga0070696_100097410
287 Ga0070693_100121190
288 Ga0070693_101236619
289 Ga0070665_100077218
290 Ga0070704_100321996
291 Ga0068855_100036498
292 Ga0068855_100045133
293 Ga0070664_101377062
294 Ga0068856_100017219
295 Ga0068856_101416954
296 Ga0070702_100118513
297 Ga0068852_100246377
298 Ga0068859_101282147
299 Ga0068859_101500483
300 Ga0068859_102316620
301 Ga0068864_100196062
302 Ga0068861_102135154
303 Ga0068870_10066230
304 Ga0068863_101399339
305 Ga0068860_100007530
306 Ga0068862_100572245
307 Ga0081539_10097352
308 Ga0070717_10040380
309 Ga0068871_100131779
310 Ga0068871_100285037
311 Ga0075428_100002738
312 Ga0075428_100034161
313 Ga0075428_100217039
314 Ga0075428_101296528
315 Ga0075431_101278851
316 Ga0075433_10341335
317 Ga0075434_100099606
318 Ga0075434_100868421
319 Ga0075434_101542768
320 Ga0075434_101859633
321 Ga0097620_101281654
322 Ga0097620_101500893
323 Ga0097620_102317115
324 Ga0099794_10271314
325 Ga0099794_10341597
326 Ga0105240_10020274
327 Ga0105240_10108396
328 Ga0111539_10731738
329 Ga0111539_10767594
330 Ga0105245_10160507
331 Ga0114129_10086070
332 Ga0114129_10110647
333 Ga0114129_10235418
334 Ga0105243_10195236
335 Ga0105241_10291971
336 Ga0105248_11861609
337 Ga0105237_10614650
338 Ga0105238_10052351
339 Ga0105249_10385577
340 Ga0105246_10316991
341 Ga0157374_10500916
342 Ga0157374_11631998
343 Ga0157378_10196396
344 Ga0157372_10161389
345 Ga0157372_10391501
346 Ga0157372_11778651
347 Ga0157375_10090010
348 Ga0157375_10669102
349 Ga0163163_11553919
350 Ga0157380_10337512
351 Ga0207643_10110637
352 Ga0207684_10000008
353 Ga0207684_10001222
354 Ga0207684_10003118
355 Ga0207684_10998601
356 Ga0207707_10054499
357 Ga0207707_10369841
358 Ga0207695_10040087
359 Ga0207657_10170686
360 Ga0207652_10092547
361 Ga0207646_10003170
362 Ga0207646_10003967
363 Ga0207646_10102631
364 Ga0207650_10618031
365 Ga0207687_10574844
366 Ga0207664_11781050
367 Ga0207670_10181972
368 Ga0207670_10283632
369 Ga0207669_10364147
370 Ga0207665_10077354
371 Ga0207665_10473144
372 Ga0207665_10527046
373 Ga0207661_10077310
374 Ga0207679_10793634
375 Ga0207667_10028593
376 Ga0207667_10286336
377 Ga0207712_10704420
378 Ga0207677_10707405
379 Ga0207639_10299076
380 Ga0207708_10005754
381 Ga0207708_10803943
382 Ga0207702_10070459
383 Ga0207702_11519421
384 Ga0207683_10459292
385 Ga0207698_10198837
386 Ga0209588_1216521
387 Ga0268266_10291432
388 Ga0268264_10001903
389 Ga0265337_1013374
390 Ga0265334_10049251
391 Ga0265318_10180125
392 Ga0265336_10086791
393 Ga0265338_10006498
394 Ga0265338_10454241
395 Ga0265324_10000644
396 Ga0265328_10027094
397 Ga0265325_10134542
398 Ga0307516_10374619
399 Ga0307412_11315169
400 Ga0307415_101145445
401 Ga0373956_0185915
402 Ga0373933_0449967
403 Ga0373947_0295178
404 Ga0373937_0058175
405 Ga0436364_0092027
406 Ga0436364_0309955
407 Ga0436364_1217007
408 Ga0400484_44947
409 Ga0400490_21960
410 Ga0400483_028202
411 Ga0400483_060291
412 Ga0400483_132557
413 Ga0400483_147135
414 Ga0400483_154556
415 Ga0400483_208769
416 Ga0400487_59856
417 Ga0436365_0455638
418 Ga0436363_1450566
419 Ga0436363_1598223
420 Ga0451833_1147249
421 Ga0451841_0883687
422 Ga0451849_0659877
423 Ga0451853_0944463
424 Ga0439441_003414
425 Ga0439449_0011084
426 Ga0450898_031007
427 Ga0439434_0017694
428 Ga0451577_0001804
429 Ga0453683_0013335
430 Ga0453684_0168812
431 Ga0453684_0870529
432 Ga0453684_0957967
433 Ga0453684_1067111
434 Ga0453684_1190549
435 Ga0451576_0064295
436 Ga0451576_0320365
437 Ga0495590_0001386
438 Ga0495594_0204723
439 Ga0495583_0039263
440 Ga0495628_0170099
441 Ga0495667_0332618
442 Ga0495657_0564218
443 Ga0495599_0499931
444 Ga0495669_0101145
445 Ga0495660_0067126
446 Ga0495675_0415151
447 Ga0495673_0180388
448 Ga0501298_059583
449 Ga0501036_0852661
450 Ga0501037_0018078
451 Ga0501040_0393203
452 Ga0501043_0038421
453 Ga0501047_0160715
454 Ga0501071_0329283
455 Ga0501073_0297194
456 Ga0501249_015022
457 Ga0501079_0081469
458 Ga0501081_0411434
459 Ga0501035_0024287
460 nmdc:mga0k408_155665_c1
461 nmdc:mga05p37_112909_c1
462 nmdc:mga05p37_73272_c1
463 nmdc:mga08y16_610262_c1
464 nmdc:mga0n895_1485700_c1
465 nmdc:mga0n895_205682_c1
466 nmdc:mga0rr50_1487062_c1
467 nmdc:mga0a205_297181_c1
468 Ga0500651_0161646
469 Ga0500555_000049
470 Ga0500616_0000306
471 Ga0500645_002516
472 Ga0500599_010582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

132

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jav-assembly1.cif.gz_D structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) 0.9575 5 132
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9529 5 132
6rfv-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 0.9503 5 133
3t6k-assembly2.cif.gz_B crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution 0.9349 4 134
4uhj-assembly1.cif.gz_A crystal structure of the receiver domain of cpxr from e. coli (orthorhombic form) 0.9328 6 141
ID Description Score Start End Superfamily
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9346 5 134 3.40.50.2300
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9289 5 132 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9257 2 140 3.40.50.2300
4qpjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9244 4 134 3.40.50.2300
4nicD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9225 6 133 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537VAE7-F1-model_v4 Response regulator 0.9565 1 141 GO:0000160
GO:0016791
AF-A0A353B3V5-F1-model_v4 Response regulatory domain-containing protein 0.9529 4 142 GO:0000160
AF-A0A2W4I983-F1-model_v4 Response regulator 0.9523 1 133 GO:0000160
AF-A0A3M1G9X8-F1-model_v4 Response regulator 0.951 6 141 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3M2F954-F1-model_v4 Fused response regulator/phosphatase 0.9465 4 141 GO:0000160
GO:0016791

Map