F348940

General Info

Members Datasets Scaffolds Average Seq Length
236 138 472 140

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100443891|Ga0068860_1004438912
Length 156
Sequence VPTGRLTGSDRILDGVEPRVSLITLGVRDVARARTFYEALGWRSSSKPEDGVVFFQSGGMVLALWSREELAADSGVTDSGGWGGVTPAWNVGAPAEVDAIIAAAAGAGATIARPGAATFWGGYSGVFIDPDGHPWEVAHNPFWTLGDDGSVRLPDA

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
51 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
52 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
53 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
54 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
55 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
56 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
64 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
65 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
69 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
70 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
71 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
72 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
73 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
74 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
75 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
78 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
79 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
135 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 8.47
Rhizosphere 90.25
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100443891 3300005843 Bacteria 1289
2 Ga0070683_101022286 3300005329 Bacteria 794
3 Ga0070680_101817582 3300005336 Bacteria 528
4 Ga0070671_100083456 3300005355 Bacteria 2672
5 Ga0070667_100110114 3300005367 Bacteria 2387
6 Ga0070714_100776762 3300005435 Bacteria 927
7 Ga0070705_100034591 3300005440 Bacteria 2826
8 Ga0070700_100655891 3300005441 Bacteria 829
9 Ga0070708_100007474 3300005445 Bacteria 8749
10 Ga0070663_101194742 3300005455 Bacteria 668
11 Ga0070681_10241756 3300005458 Bacteria 1719
12 Ga0070681_10850116 3300005458 Unclassified 830
13 Ga0070706_100266873 3300005467 Bacteria 1597
14 Ga0070707_100014779 3300005468 Bacteria 7318
15 Ga0070698_100858991 3300005471 Unclassified 852
16 Ga0070679_100372474 3300005530 Bacteria 1375
17 Ga0070679_101343027 3300005530 Bacteria 661
18 Ga0070697_100022712 3300005536 Bacteria 4984
19 Ga0070697_102006958 3300005536 Bacteria 518
20 Ga0070686_100317548 3300005544 Bacteria 1160
21 Ga0068856_100451591 3300005614 Bacteria 1306
22 Ga0068864_100835420 3300005618 Bacteria 907
23 Ga0068858_100180665 3300005842 Bacteria 1992
24 Ga0070717_10589826 3300006028 Bacteria 1008
25 Ga0075433_10488903 3300006852 Bacteria 1084
26 Ga0105240_11373794 3300009093 Bacteria 743
27 Ga0114129_10640834 3300009147 Bacteria 1372
28 Ga0105242_10365153 3300009176 Bacteria 1337
29 Ga0105030_119715 3300009987 Bacteria 609
30 Ga0163163_10212968 3300014325 Bacteria 1981
31 Ga0157379_10999879 3300014968 Bacteria 797
32 Ga0207684_10024273 3300025910 Bacteria 5170
33 Ga0207707_10215440 3300025912 Bacteria 1672
34 Ga0207707_10494205 3300025912 Unclassified 1044
35 Ga0207660_10953954 3300025917 Unclassified 700
36 Ga0207652_10607014 3300025921 Bacteria 981
37 Ga0207646_10022635 3300025922 Bacteria 5786
38 Ga0207681_11104921 3300025923 Unclassified 666
39 Ga0207687_11548435 3300025927 Bacteria 569
40 Ga0207664_10026607 3300025929 Bacteria 4375
41 Ga0207644_10008567 3300025931 Bacteria 6691
42 Ga0207661_10385079 3300025944 Bacteria 1270
43 Ga0207712_10428668 3300025961 Bacteria 1117
44 Ga0207678_10789951 3300026067 Bacteria 838
45 Ga0207702_10352730 3300026078 Unclassified 1408
46 Ga0207702_10500144 3300026078 Bacteria 1185
47 Ga0207702_11299004 3300026078 Bacteria 722
48 Ga0209974_10052558 3300027876 Bacteria 1371
49 Ga0268266_10388919 3300028379 Bacteria 1317
50 Ga0316579_10525786 3300031691 Bacteria 572
51 Ga0307412_10436755 3300031911 Bacteria 1075
52 Ga0307409_101629922 3300031995 Bacteria 674
53 Ga0307416_100214731 3300032002 Bacteria 1839
54 Ga0307416_100423545 3300032002 Bacteria 1376
55 Ga0307415_100006708 3300032126 Bacteria 6234
56 Ga0307415_100075796 3300032126 Bacteria 2382
57 Ga0307415_101764073 3300032126 Bacteria 598
58 Ga0316582_0568429 3300036647 Bacteria 781
59 Ga0439454_009730 3300042011 Bacteria 1254
60 Ga0439456_060691 3300042013 Bacteria 831
61 Ga0450911_017588 3300042115 Bacteria 941
62 Ga0450920_020698 3300042122 Bacteria 1268
63 Ga0450910_001180 3300042147 Bacteria 3244
64 Ga0439458_0151318 3300042157 Bacteria 622
65 Ga0450918_015386 3300042531 Bacteria 1330
66 Ga0453683_0030825 3300044673 Bacteria 3389
67 Ga0466965_0575415 3300044683 Bacteria 638
68 Ga0466966_0004033 3300044684 Bacteria 9698
69 Ga0466964_0100940 3300044706 Bacteria 1272
70 Ga0466959_0006828 3300045049 Bacteria 7955
71 Ga0466967_0043393 3300045976 Bacteria 3893
72 Ga0466967_1054094 3300045976 Bacteria 810
73 Ga0495603_0003150 3300046455 Bacteria 9808
74 Ga0495591_065386 3300046458 Bacteria 956
75 Ga0495664_0667790 3300046477 Bacteria 615
76 Ga0495585_0064861 3300046492 Bacteria 2002
77 Ga0495585_0121579 3300046492 Bacteria 1381
78 Ga0495596_0041942 3300046500 Bacteria 1804
79 Ga0495644_0063817 3300046523 Bacteria 1384
80 Ga0495663_0010804 3300046525 Bacteria 2541
81 Ga0495663_0041350 3300046525 Bacteria 1402
82 Ga0495642_0429910 3300046528 Bacteria 583
83 Ga0495598_0292026 3300046537 Bacteria 615
84 Ga0495609_0036469 3300046538 Bacteria 2220
85 Ga0495656_0016704 3300046615 Bacteria 2788
86 Ga0495659_0412927 3300046664 Bacteria 584
87 Ga0495661_0044273 3300046665 Bacteria 2730
88 Ga0495661_0083241 3300046665 Bacteria 1840
89 Ga0495613_0252134 3300046689 Bacteria 1231
90 Ga0495589_0138674 3300046794 Bacteria 1166
91 Ga0495636_0024773 3300047318 Bacteria 2435
92 Ga0495677_0087980 3300047445 Bacteria 1169
93 Ga0496100_0051532 3300048903 Bacteria 2672
94 Ga0496101_0312842 3300048904 Bacteria 1231
95 Ga0496101_0827069 3300048904 Bacteria 730
96 Ga0496102_0000021 3300048905 Bacteria 246920
97 Ga0496102_0111367 3300048905 Bacteria 2552
98 Ga0496103_0000001 3300048906 Bacteria 643471
99 Ga0496104_0135691 3300048907 Bacteria 2364
100 Ga0496105_0219828 3300048908 Unclassified 1547
101 Ga0496106_0022096 3300048909 Bacteria 4726
102 Ga0496108_0003377 3300048911 Bacteria 12817
103 Ga0496109_0014379 3300048912 Bacteria 6886
104 Ga0496109_0075480 3300048912 Bacteria 3099
105 Ga0496110_0007915 3300048913 Bacteria 8515
106 Ga0496110_0049897 3300048913 Bacteria 3673
107 Ga0496111_0069020 3300048914 Unclassified 2570
108 Ga0496111_0075296 3300048914 Bacteria 2459
109 Ga0496111_0170063 3300048914 Bacteria 1619
110 Ga0496112_0086910 3300048915 Bacteria 3093
111 Ga0496114_0255519 3300048917 Bacteria 1542
112 Ga0496115_1170738 3300048918 Bacteria 579
113 Ga0496125_0000097 3300048928 Bacteria 204607
114 Ga0496126_0650012 3300048929 Bacteria 825
115 Ga0501031_0002608 3300049568 Bacteria 11480
116 Ga0501031_0063960 3300049568 Bacteria 2396
117 Ga0501031_0121253 3300049568 Bacteria 1708
118 Ga0501031_0149243 3300049568 Bacteria 1527
119 Ga0501032_0001008 3300049569 Bacteria 22721
120 Ga0501032_0468779 3300049569 Bacteria 806
121 Ga0501033_0002030 3300049570 Bacteria 17598
122 Ga0501033_0263235 3300049570 Bacteria 1220
123 Ga0501034_0090154 3300049571 Bacteria 3064
124 Ga0501034_0486604 3300049571 Bacteria 1149
125 Ga0501036_0024636 3300049572 Bacteria 5074
126 Ga0501036_0034174 3300049572 Bacteria 4300
127 Ga0501036_0148065 3300049572 Bacteria 1980
128 Ga0501036_0354056 3300049572 Bacteria 1226
129 Ga0501037_0004914 3300049573 Bacteria 9729
130 Ga0501038_0000771 3300049574 Bacteria 28416
131 Ga0501038_0025326 3300049574 Bacteria 5290
132 Ga0501039_0002686 3300049575 Bacteria 13273
133 Ga0501039_0003713 3300049575 Bacteria 11461
134 Ga0501039_0019114 3300049575 Bacteria 5257
135 Ga0501039_0330686 3300049575 Bacteria 1197
136 Ga0501039_1055180 3300049575 Bacteria 630
137 Ga0501040_0027090 3300049576 Bacteria 3857
138 Ga0501040_0674808 3300049576 Bacteria 747
139 Ga0501041_0000092 3300049577 Bacteria 36084
140 Ga0501041_0018746 3300049577 Bacteria 4122
141 Ga0501041_0101461 3300049577 Bacteria 1781
142 Ga0501041_0195102 3300049577 Bacteria 1269
143 Ga0501041_0754837 3300049577 Bacteria 623
144 Ga0501042_0020912 3300049578 Bacteria 4556
145 Ga0501042_0021830 3300049578 Bacteria 4467
146 Ga0501042_0141602 3300049578 Bacteria 1734
147 Ga0501042_0392078 3300049578 Bacteria 1006
148 Ga0501042_0546732 3300049578 Bacteria 842
149 Ga0501043_0012077 3300049579 Bacteria 6755
150 Ga0501043_0379086 3300049579 Bacteria 1071
151 Ga0501046_0001786 3300049580 Bacteria 20504
152 Ga0501046_0023511 3300049580 Bacteria 5069
153 Ga0501046_0099759 3300049580 Bacteria 2229
154 Ga0501046_0664632 3300049580 Bacteria 736
155 Ga0501046_0712047 3300049580 Bacteria 707
156 Ga0501047_0001439 3300049581 Bacteria 23306
157 Ga0501048_0004668 3300049582 Bacteria 10427
158 Ga0501048_0032820 3300049582 Bacteria 3751
159 Ga0501048_0072357 3300049582 Bacteria 2434
160 Ga0501048_0405908 3300049582 Bacteria 974
161 Ga0501067_0009604 3300049583 Bacteria 5360
162 Ga0501068_0001053 3300049584 Bacteria 14624
163 Ga0501068_0002584 3300049584 Bacteria 9599
164 Ga0501068_0013640 3300049584 Bacteria 4627
165 Ga0501069_0002818 3300049585 Bacteria 8895
166 Ga0501069_0145871 3300049585 Bacteria 1359
167 Ga0501069_0526428 3300049585 Bacteria 706
168 Ga0501070_0019665 3300049586 Bacteria 5662
169 Ga0501070_0076907 3300049586 Bacteria 2763
170 Ga0501071_0000097 3300049587 Bacteria 33417
171 Ga0501071_0002261 3300049587 Bacteria 11600
172 Ga0501071_0057746 3300049587 Bacteria 2805
173 Ga0501071_0149053 3300049587 Bacteria 1744
174 Ga0501071_0223439 3300049587 Bacteria 1418
175 Ga0501071_0263687 3300049587 Bacteria 1301
176 Ga0501071_0462679 3300049587 Bacteria 971
177 Ga0501072_0008932 3300049588 Bacteria 7617
178 Ga0501072_0011548 3300049588 Bacteria 6749
179 Ga0501072_0011660 3300049588 Bacteria 6715
180 Ga0501072_0023069 3300049588 Bacteria 4832
181 Ga0501072_0068906 3300049588 Bacteria 2793
182 Ga0501072_0275345 3300049588 Bacteria 1339
183 Ga0501072_0475056 3300049588 Bacteria 989
184 Ga0501072_1479369 3300049588 Bacteria 524
185 Ga0501073_0006420 3300049589 Bacteria 8753
186 Ga0501074_0010607 3300049590 Bacteria 6688
187 Ga0501074_0065459 3300049590 Bacteria 2616
188 Ga0501075_0010907 3300049591 Bacteria 6408
189 Ga0501075_0038367 3300049591 Bacteria 3581
190 Ga0501075_0095613 3300049591 Bacteria 2254
191 Ga0501075_0133586 3300049591 Bacteria 1890
192 Ga0501076_0000734 3300049592 Bacteria 21188
193 Ga0501076_0008749 3300049592 Bacteria 7436
194 Ga0501076_0021081 3300049592 Bacteria 4994
195 Ga0501076_0034420 3300049592 Bacteria 3959
196 Ga0501076_0225715 3300049592 Bacteria 1531
197 Ga0501076_0323223 3300049592 Bacteria 1265
198 Ga0501076_0389745 3300049592 Bacteria 1145
199 Ga0501077_0019299 3300049593 Bacteria 4311
200 Ga0501077_0047536 3300049593 Bacteria 2726
201 Ga0501077_0053822 3300049593 Bacteria 2555
202 Ga0501077_0097501 3300049593 Bacteria 1863
203 Ga0501079_0004733 3300049741 Bacteria 10078
204 Ga0501079_0019144 3300049741 Bacteria 5230
205 Ga0501079_0912996 3300049741 Bacteria 691
206 Ga0501080_0055444 3300049742 Bacteria 3692
207 Ga0501080_0111566 3300049742 Bacteria 2535
208 Ga0501080_0240116 3300049742 Bacteria 1654
209 Ga0501081_0000837 3300049743 Bacteria 18200
210 Ga0501081_0366849 3300049743 Bacteria 1063
211 Ga0501083_0000086 3300049744 Bacteria 63536
212 Ga0501083_0184238 3300049744 Bacteria 1363
213 Ga0501035_0405628 3300049822 Bacteria 1133
214 Ga0501044_0001726 3300049823 Bacteria 25582
215 Ga0501044_0648557 3300049823 Bacteria 945
216 Ga0501044_0950885 3300049823 Bacteria 732
217 Ga0501045_0006566 3300049824 Bacteria 8060
218 Ga0501045_0042071 3300049824 Bacteria 3326
219 Ga0501045_0062849 3300049824 Bacteria 2724
220 Ga0501045_0398711 3300049824 Bacteria 1024
221 nmdc:mga05p37_809037_c1 3300050507 Bacteria 1024
222 nmdc:mga09592_303543_c1 3300050508 Bacteria 1384
223 nmdc:mga06r32_834653_c1 3300050510 Bacteria 881
224 nmdc:mga0a205_81569_c1 3300050515 Unclassified 3124
225 Ga0495601_0311530 3300053077 Bacteria 1025
226 Ga0495655_0000008 3300053083 Bacteria 153535
227 Ga0500628_000043 3300053129 Bacteria 45301
228 Ga0501084_0017756 3300054114 Bacteria 5921
229 Ga0501084_0027097 3300054114 Bacteria 4788
230 Ga0501084_0036897 3300054114 Bacteria 4083
231 Ga0501084_0101439 3300054114 Bacteria 2417
232 Ga0501084_0251978 3300054114 Bacteria 1490
233 Ga0501084_0276833 3300054114 Bacteria 1417
234 Ga0501082_0014647 3300060353 Bacteria 6755
235 Ga0530510_0011525 3300061734 Bacteria 6203
236 Ga0530510_0941868 3300061734 Unclassified 660
237 Ga0068860_100443891
238 Ga0070683_101022286
239 Ga0070680_101817582
240 Ga0070671_100083456
241 Ga0070667_100110114
242 Ga0070714_100776762
243 Ga0070705_100034591
244 Ga0070700_100655891
245 Ga0070708_100007474
246 Ga0070663_101194742
247 Ga0070681_10241756
248 Ga0070681_10850116
249 Ga0070706_100266873
250 Ga0070707_100014779
251 Ga0070698_100858991
252 Ga0070679_100372474
253 Ga0070679_101343027
254 Ga0070697_100022712
255 Ga0070697_102006958
256 Ga0070686_100317548
257 Ga0068856_100451591
258 Ga0068864_100835420
259 Ga0068858_100180665
260 Ga0070717_10589826
261 Ga0075433_10488903
262 Ga0105240_11373794
263 Ga0114129_10640834
264 Ga0105242_10365153
265 Ga0105030_119715
266 Ga0163163_10212968
267 Ga0157379_10999879
268 Ga0207684_10024273
269 Ga0207707_10215440
270 Ga0207707_10494205
271 Ga0207660_10953954
272 Ga0207652_10607014
273 Ga0207646_10022635
274 Ga0207681_11104921
275 Ga0207687_11548435
276 Ga0207664_10026607
277 Ga0207644_10008567
278 Ga0207661_10385079
279 Ga0207712_10428668
280 Ga0207678_10789951
281 Ga0207702_10352730
282 Ga0207702_10500144
283 Ga0207702_11299004
284 Ga0209974_10052558
285 Ga0268266_10388919
286 Ga0316579_10525786
287 Ga0307412_10436755
288 Ga0307409_101629922
289 Ga0307416_100214731
290 Ga0307416_100423545
291 Ga0307415_100006708
292 Ga0307415_100075796
293 Ga0307415_101764073
294 Ga0316582_0568429
295 Ga0439454_009730
296 Ga0439456_060691
297 Ga0450911_017588
298 Ga0450920_020698
299 Ga0450910_001180
300 Ga0439458_0151318
301 Ga0450918_015386
302 Ga0453683_0030825
303 Ga0466965_0575415
304 Ga0466966_0004033
305 Ga0466964_0100940
306 Ga0466959_0006828
307 Ga0466967_0043393
308 Ga0466967_1054094
309 Ga0495603_0003150
310 Ga0495591_065386
311 Ga0495664_0667790
312 Ga0495585_0064861
313 Ga0495585_0121579
314 Ga0495596_0041942
315 Ga0495644_0063817
316 Ga0495663_0010804
317 Ga0495663_0041350
318 Ga0495642_0429910
319 Ga0495598_0292026
320 Ga0495609_0036469
321 Ga0495656_0016704
322 Ga0495659_0412927
323 Ga0495661_0044273
324 Ga0495661_0083241
325 Ga0495613_0252134
326 Ga0495589_0138674
327 Ga0495636_0024773
328 Ga0495677_0087980
329 Ga0496100_0051532
330 Ga0496101_0312842
331 Ga0496101_0827069
332 Ga0496102_0000021
333 Ga0496102_0111367
334 Ga0496103_0000001
335 Ga0496104_0135691
336 Ga0496105_0219828
337 Ga0496106_0022096
338 Ga0496108_0003377
339 Ga0496109_0014379
340 Ga0496109_0075480
341 Ga0496110_0007915
342 Ga0496110_0049897
343 Ga0496111_0069020
344 Ga0496111_0075296
345 Ga0496111_0170063
346 Ga0496112_0086910
347 Ga0496114_0255519
348 Ga0496115_1170738
349 Ga0496125_0000097
350 Ga0496126_0650012
351 Ga0501031_0002608
352 Ga0501031_0063960
353 Ga0501031_0121253
354 Ga0501031_0149243
355 Ga0501032_0001008
356 Ga0501032_0468779
357 Ga0501033_0002030
358 Ga0501033_0263235
359 Ga0501034_0090154
360 Ga0501034_0486604
361 Ga0501036_0024636
362 Ga0501036_0034174
363 Ga0501036_0148065
364 Ga0501036_0354056
365 Ga0501037_0004914
366 Ga0501038_0000771
367 Ga0501038_0025326
368 Ga0501039_0002686
369 Ga0501039_0003713
370 Ga0501039_0019114
371 Ga0501039_0330686
372 Ga0501039_1055180
373 Ga0501040_0027090
374 Ga0501040_0674808
375 Ga0501041_0000092
376 Ga0501041_0018746
377 Ga0501041_0101461
378 Ga0501041_0195102
379 Ga0501041_0754837
380 Ga0501042_0020912
381 Ga0501042_0021830
382 Ga0501042_0141602
383 Ga0501042_0392078
384 Ga0501042_0546732
385 Ga0501043_0012077
386 Ga0501043_0379086
387 Ga0501046_0001786
388 Ga0501046_0023511
389 Ga0501046_0099759
390 Ga0501046_0664632
391 Ga0501046_0712047
392 Ga0501047_0001439
393 Ga0501048_0004668
394 Ga0501048_0032820
395 Ga0501048_0072357
396 Ga0501048_0405908
397 Ga0501067_0009604
398 Ga0501068_0001053
399 Ga0501068_0002584
400 Ga0501068_0013640
401 Ga0501069_0002818
402 Ga0501069_0145871
403 Ga0501069_0526428
404 Ga0501070_0019665
405 Ga0501070_0076907
406 Ga0501071_0000097
407 Ga0501071_0002261
408 Ga0501071_0057746
409 Ga0501071_0149053
410 Ga0501071_0223439
411 Ga0501071_0263687
412 Ga0501071_0462679
413 Ga0501072_0008932
414 Ga0501072_0011548
415 Ga0501072_0011660
416 Ga0501072_0023069
417 Ga0501072_0068906
418 Ga0501072_0275345
419 Ga0501072_0475056
420 Ga0501072_1479369
421 Ga0501073_0006420
422 Ga0501074_0010607
423 Ga0501074_0065459
424 Ga0501075_0010907
425 Ga0501075_0038367
426 Ga0501075_0095613
427 Ga0501075_0133586
428 Ga0501076_0000734
429 Ga0501076_0008749
430 Ga0501076_0021081
431 Ga0501076_0034420
432 Ga0501076_0225715
433 Ga0501076_0323223
434 Ga0501076_0389745
435 Ga0501077_0019299
436 Ga0501077_0047536
437 Ga0501077_0053822
438 Ga0501077_0097501
439 Ga0501079_0004733
440 Ga0501079_0019144
441 Ga0501079_0912996
442 Ga0501080_0055444
443 Ga0501080_0111566
444 Ga0501080_0240116
445 Ga0501081_0000837
446 Ga0501081_0366849
447 Ga0501083_0000086
448 Ga0501083_0184238
449 Ga0501035_0405628
450 Ga0501044_0001726
451 Ga0501044_0648557
452 Ga0501044_0950885
453 Ga0501045_0006566
454 Ga0501045_0042071
455 Ga0501045_0062849
456 Ga0501045_0398711
457 nmdc:mga05p37_809037_c1
458 nmdc:mga09592_303543_c1
459 nmdc:mga06r32_834653_c1
460 nmdc:mga0a205_81569_c1
461 Ga0495601_0311530
462 Ga0495655_0000008
463 Ga0500628_000043
464 Ga0501084_0017756
465 Ga0501084_0027097
466 Ga0501084_0036897
467 Ga0501084_0101439
468 Ga0501084_0251978
469 Ga0501084_0276833
470 Ga0501082_0014647
471 Ga0530510_0011525
472 Ga0530510_0941868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

19

137

0.85

PF18029

Glyoxalase_6

Glyoxalase-like domain

22

138

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.8965 2 138
4pav-assembly6.cif.gz_F structure of hypothetical protein sa1046 from s. aureus. 0.8958 1 125
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.8911 1 125
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8862 3 125
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.8844 2 138
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.909 70 124 3.30.720.110
3bqxA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8893 2 138 3.10.180.10
4pavC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.883 6 125 3.10.180.10
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8727 6 125 3.10.180.10
3bqxA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.871 2 138 3.10.180.10
ID Description Score Start End GO Terms
AF-N9MQE2-F1-model_v4 VOC domain-containing protein 0.9888 70 126
AF-A0A4S1FN10-F1-model_v4 VOC family protein 0.987 70 127
AF-A0A328XVT4-F1-model_v4 VOC domain-containing protein 0.9862 69 126
AF-A0A4P2QFH0-F1-model_v4 VOC domain-containing protein 0.9812 70 129
AF-A0A7W0G7P7-F1-model_v4 VOC family protein 0.9807 74 138

Map