F348892

General Info

Members Datasets Scaffolds Average Seq Length
236 162 230 313

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100157711|Ga0070684_1001577113
Length 337
Sequence LAEPRSTYSPGISRNPSTFDIVKEMQKKRLGNSDMELTPIGVGAWAMGGGGWKFAWGPQDDTESVKAIHEALDRGVNWIDTAAVYGLGHSEEVVARALKGRANRPYVFTKCERTWNEQREISPSLKATSIRRECENSLRRLGVDTIDLYQIHWPEPDADVEEGWSTLAKLKEEGKVRWIGVSNFNAQQLERCRKIAPITSLQPPYSAISPEVEKEILPYCLEHNIGVIAYSPMKSGLLTGKMTQERVANLPEDDFRRRAPAFQEPQLTRNLALADLMKQIGERHGRSAGEVAIAWTLRHAAITAAIVGMRSAEQVHGVIGAMNFRLSEQEIAEIASA

Samples

Sample ID Description Type Environment
1 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
2 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
3 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
4 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
161 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
162 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0.85
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0.42
Rhizoplane 0.85
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10024004 3300003320 Bacteria 7605
2 Ga0065712_10136805 3300005290 Bacteria 1489
3 Ga0070658_10098589 3300005327 Bacteria 2414
4 Ga0070683_100000018 3300005329 Bacteria 193063
5 Ga0070683_100073386 3300005329 Bacteria 3195
6 Ga0070666_10102069 3300005335 Bacteria 1978
7 Ga0068868_100012472 3300005338 Bacteria 6214
8 Ga0068868_100175282 3300005338 Bacteria 1777
9 Ga0070660_100055682 3300005339 Bacteria 3057
10 Ga0070668_100012166 3300005347 Bacteria 6408
11 Ga0070669_100004441 3300005353 Bacteria 10112
12 Ga0070675_100005596 3300005354 Bacteria 9618
13 Ga0070675_100202770 3300005354 Bacteria 1722
14 Ga0070671_100021685 3300005355 Bacteria 5247
15 Ga0070674_100179435 3300005356 Bacteria 1621
16 Ga0070673_100085253 3300005364 Bacteria 2571
17 Ga0070667_100006552 3300005367 Bacteria 9680
18 Ga0070667_100045859 3300005367 Bacteria 3677
19 Ga0070709_10040889 3300005434 Bacteria 2853
20 Ga0070709_10042052 3300005434 Bacteria 2820
21 Ga0070714_100223789 3300005435 Bacteria 1730
22 Ga0070713_100034597 3300005436 Bacteria 4061
23 Ga0070713_100042532 3300005436 Bacteria 3709
24 Ga0070713_100110503 3300005436 Bacteria 2396
25 Ga0070713_100182000 3300005436 Bacteria 1889
26 Ga0070710_10033179 3300005437 Bacteria 2802
27 Ga0070711_100002950 3300005439 Bacteria 9811
28 Ga0070711_100093852 3300005439 Bacteria 2168
29 Ga0070708_100006118 3300005445 Bacteria 9577
30 Ga0070681_10023691 3300005458 Bacteria 6179
31 Ga0070707_100174666 3300005468 Unclassified 2094
32 Ga0070699_100163258 3300005518 Bacteria 1972
33 Ga0070679_100127304 3300005530 Bacteria 2528
34 Ga0070684_100000011 3300005535 Bacteria 170628
35 Ga0070684_100157711 3300005535 Bacteria 2058
36 Ga0070665_100030721 3300005548 Bacteria 5405
37 Ga0068855_100556203 3300005563 Bacteria 1241
38 Ga0068856_100034841 3300005614 Bacteria 4932
39 Ga0068863_100178153 3300005841 Bacteria 2040
40 Ga0068858_100018455 3300005842 Bacteria 6531
41 Ga0068862_100016006 3300005844 Bacteria 6235
42 Ga0070717_10000232 3300006028 Bacteria 38506
43 Ga0070717_10032422 3300006028 Bacteria 4210
44 Ga0070717_10062160 3300006028 Bacteria 3097
45 Ga0070717_10118175 3300006028 Unclassified 2268
46 Ga0070717_10162322 3300006028 Bacteria 1939
47 Ga0070717_10226288 3300006028 Bacteria 1646
48 Ga0070715_10017180 3300006163 Bacteria 2734
49 Ga0070712_100000480 3300006175 Bacteria 22817
50 Ga0097621_100180636 3300006237 Bacteria 1823
51 Ga0097621_100209171 3300006237 Unclassified 1697
52 Ga0075430_100242252 3300006846 Unclassified 1494
53 Ga0075430_100330272 3300006846 Bacteria 1260
54 Ga0075431_100001981 3300006847 Bacteria 19537
55 Ga0075431_100015320 3300006847 Bacteria 7769
56 Ga0075431_100042678 3300006847 Bacteria 4679
57 Ga0075429_100020981 3300006880 Bacteria 5668
58 Ga0105240_10005505 3300009093 Bacteria 18869
59 Ga0105240_10020623 3300009093 Bacteria 8786
60 Ga0105240_10347639 3300009093 Bacteria 1683
61 Ga0105247_10061825 3300009101 Bacteria 2322
62 Ga0105247_10072851 3300009101 Bacteria 2151
63 Ga0114129_10063670 3300009147 Bacteria 5148
64 Ga0114129_10113731 3300009147 Bacteria 3732
65 Ga0105248_10040064 3300009177 Bacteria 5250
66 Ga0105248_10118805 3300009177 Bacteria 2982
67 Ga0105248_10149212 3300009177 Bacteria 2638
68 Ga0105248_10155752 3300009177 Bacteria 2578
69 Ga0105237_10000275 3300009545 Bacteria 72320
70 Ga0105237_10024375 3300009545 Bacteria 6190
71 Ga0105237_10209698 3300009545 Bacteria 1948
72 Ga0105238_10291893 3300009551 Bacteria 1613
73 Ga0105249_10005057 3300009553 Bacteria 11361
74 Ga0105239_10015340 3300010375 Bacteria 8489
75 Ga0105239_10050871 3300010375 Unclassified 4543
76 Ga0157370_10255711 3300013104 Bacteria 1619
77 Ga0157369_10027970 3300013105 Bacteria 6244
78 Ga0157369_10033628 3300013105 Bacteria 5634
79 Ga0157369_10046580 3300013105 Bacteria 4712
80 Ga0157369_10096549 3300013105 Bacteria 3153
81 Ga0157369_10317827 3300013105 Bacteria 1619
82 Ga0157374_10003766 3300013296 Bacteria 12752
83 Ga0157374_10283161 3300013296 Bacteria 1637
84 Ga0163162_10028449 3300013306 Bacteria 5531
85 Ga0157372_10009753 3300013307 Bacteria 10212
86 Ga0157375_10098984 3300013308 Bacteria 2994
87 Ga0163163_10006426 3300014325 Bacteria 10273
88 Ga0163163_10054389 3300014325 Bacteria 3955
89 Ga0163163_10158038 3300014325 Bacteria 2312
90 Ga0163163_10688449 3300014325 Bacteria 1086
91 Ga0157376_10005377 3300014969 Bacteria 8950
92 Ga0157376_10011031 3300014969 Bacteria 6641
93 Ga0213873_10001751 3300021358 Bacteria 3648
94 Ga0213875_10041879 3300021388 Bacteria 2153
95 Ga0207697_10002339 3300025315 Bacteria 9872
96 Ga0207692_10030118 3300025898 Bacteria 2585
97 Ga0207645_10004682 3300025907 Bacteria 10068
98 Ga0207695_10025103 3300025913 Bacteria 6684
99 Ga0207695_10292327 3300025913 Bacteria 1521
100 Ga0207695_10391003 3300025913 Unclassified 1275
101 Ga0207671_10000134 3300025914 Bacteria 113822
102 Ga0207671_10009756 3300025914 Bacteria 7991
103 Ga0207693_10001449 3300025915 Bacteria 21002
104 Ga0207693_10301093 3300025915 Bacteria 1256
105 Ga0207663_10001319 3300025916 Bacteria 11471
106 Ga0207663_10227192 3300025916 Bacteria 1361
107 Ga0207662_10009496 3300025918 Bacteria 5356
108 Ga0207657_10115397 3300025919 Bacteria 2213
109 Ga0207681_10038453 3300025923 Bacteria 3170
110 Ga0207659_10020101 3300025926 Bacteria 4406
111 Ga0207700_10011274 3300025928 Bacteria 5693
112 Ga0207700_10078635 3300025928 Bacteria 2567
113 Ga0207700_10100202 3300025928 Bacteria 2308
114 Ga0207700_10353850 3300025928 Unclassified 1279
115 Ga0207690_10133005 3300025932 Bacteria 1823
116 Ga0207665_10144789 3300025939 Bacteria 1697
117 Ga0207711_10047400 3300025941 Bacteria 3673
118 Ga0207711_10173658 3300025941 Bacteria 1957
119 Ga0207711_10396069 3300025941 Bacteria 1282
120 Ga0207661_10000025 3300025944 Bacteria 195900
121 Ga0207661_10120153 3300025944 Bacteria 2236
122 Ga0207661_10159859 3300025944 Bacteria 1954
123 Ga0207661_10182321 3300025944 Bacteria 1835
124 Ga0207667_10044981 3300025949 Bacteria 4676
125 Ga0207667_10267784 3300025949 Bacteria 1747
126 Ga0207712_10005523 3300025961 Bacteria 7976
127 Ga0207658_10031595 3300025986 Bacteria 3761
128 Ga0207658_10109344 3300025986 Bacteria 2182
129 Ga0207677_10009380 3300026023 Bacteria 5508
130 Ga0207703_10013376 3300026035 Bacteria 6395
131 Ga0207702_10005525 3300026078 Bacteria 11046
132 Ga0207676_10336135 3300026095 Bacteria 1392
133 Ga0268265_10008732 3300028380 Bacteria 6851
134 Ga0265338_10037316 3300028800 Bacteria 4628
135 Ga0265338_10149321 3300028800 Bacteria 1818
136 Ga0265760_10000396 3300031090 Bacteria 12199
137 Ga0265760_10005751 3300031090 Bacteria 3546
138 Ga0265331_10044913 3300031250 Bacteria 2134
139 Ga0265316_10004502 3300031344 Bacteria 13846
140 Ga0265316_10021831 3300031344 Bacteria 5411
141 Ga0265316_10158001 3300031344 Bacteria 1696
142 Ga0307509_10156731 3300031507 Bacteria 2182
143 Ga0307408_100009719 3300031548 Bacteria 6338
144 Ga0316579_10155578 3300031691 Bacteria 1104
145 Ga0265314_10025114 3300031711 Bacteria 4501
146 Ga0265314_10099813 3300031711 Bacteria 1869
147 Ga0316576_10078796 3300031727 Bacteria 2442
148 Ga0307410_10002262 3300031852 Bacteria 9214
149 Ga0307407_10282253 3300031903 Unclassified 1151
150 Ga0307409_100183125 3300031995 Bacteria 1856
151 Ga0307416_100273174 3300032002 Bacteria 1661
152 Ga0307415_100073994 3300032126 Bacteria 2406
153 Ga0373945_0049708 3300035116 Bacteria 1539
154 Ga0373943_0062583 3300035170 Bacteria 1863
155 Ga0373935_0124604 3300035692 Bacteria 1725
156 Ga0373927_0059405 3300035695 Bacteria 2473
157 Ga0373933_0009382 3300035724 Bacteria 5345
158 Ga0373947_0299779 3300035725 Bacteria 1071
159 Ga0395905_0108194 3300037471 Unclassified 2610
160 Ga0436365_0198630 3300039437 Bacteria 2614
161 Ga0436365_1389792 3300039437 Bacteria 1828
162 Ga0436361_0145631 3300039447 Bacteria 18777
163 Ga0436361_0650330 3300039447 Bacteria 20279
164 Ga0436362_0712339 3300039453 Bacteria 4989
165 Ga0439439_0071720 3300041406 Bacteria 928
166 Ga0439449_0020574 3300042007 Bacteria 2472
167 Ga0439457_033216 3300042014 Bacteria 1145
168 Ga0451577_0624779 3300042876 Bacteria 977
169 Ga0453684_0185382 3300044712 Unclassified 2439
170 Ga0451576_0666247 3300045051 Bacteria 1093
171 Ga0495592_0127202 3300046454 Bacteria 1786
172 Ga0495629_0099229 3300046459 Bacteria 2032
173 Ga0495650_0000041 3300046471 Bacteria 363945
174 Ga0495580_0000470 3300046472 Bacteria 33520
175 Ga0495580_0001126 3300046472 Bacteria 23554
176 Ga0495582_0007048 3300046473 Bacteria 6248
177 Ga0495664_0063358 3300046477 Bacteria 2203
178 Ga0495594_0000638 3300046499 Bacteria 18047
179 Ga0495628_0211639 3300046516 Bacteria 1458
180 Ga0495643_0000104 3300046522 Bacteria 140570
181 Ga0495665_0090054 3300046531 Unclassified 1612
182 Ga0495587_0055326 3300046536 Bacteria 2337
183 Ga0495645_0002203 3300046543 Bacteria 13248
184 Ga0495645_0068838 3300046543 Bacteria 2555
185 Ga0495645_0185819 3300046543 Unclassified 1420
186 Ga0495645_0256807 3300046543 Bacteria 1159
187 Ga0495635_0140937 3300046663 Bacteria 1642
188 Ga0495635_0169430 3300046663 Bacteria 1485
189 Ga0495657_0144470 3300046675 Unclassified 1481
190 Ga0495646_0071647 3300046680 Bacteria 2039
191 Ga0495658_0063066 3300046683 Bacteria 2132
192 Ga0495613_0004053 3300046689 Bacteria 10962
193 Ga0495604_0021777 3300047317 Bacteria 5117
194 Ga0495604_0106906 3300047317 Bacteria 2046
195 Ga0495604_0151407 3300047317 Bacteria 1648
196 Ga0495674_0028929 3300047319 Bacteria 5048
197 Ga0495675_0078056 3300047444 Unclassified 2086
198 Ga0495684_0013296 3300047471 Bacteria 6345
199 Ga0495684_0074025 3300047471 Unclassified 2588
200 Ga0495686_0003671 3300047472 Bacteria 13132
201 Ga0495602_0063546 3300048088 Bacteria 3198
202 Ga0495614_0066049 3300048089 Bacteria 1556
203 Ga0496112_0018637 3300048915 Bacteria 6540
204 Ga0496114_0414101 3300048917 Unclassified 1194
205 Ga0496126_0000853 3300048929 Bacteria 53738
206 Ga0501301_003360 3300049524 Bacteria 1098
207 Ga0501032_0003867 3300049569 Bacteria 11367
208 Ga0501032_0101141 3300049569 Bacteria 1910
209 Ga0501033_0002897 3300049570 Bacteria 14354
210 Ga0501034_0456330 3300049571 Bacteria 1195
211 Ga0501036_0004673 3300049572 Bacteria 11063
212 Ga0501037_0051898 3300049573 Bacteria 2999
213 Ga0501038_0000072 3300049574 Bacteria 83742
214 Ga0501039_0352811 3300049575 Bacteria 1156
215 Ga0501043_0001570 3300049579 Bacteria 19893
216 Ga0501046_0000811 3300049580 Bacteria 30402
217 Ga0501047_0008956 3300049581 Bacteria 9448
218 Ga0501073_0009372 3300049589 Bacteria 7226
219 Ga0501035_0227303 3300049822 Bacteria 1591
220 nmdc:mga09592_89843_c1 3300050508 Bacteria 2624
221 nmdc:mga0qj67_297685_c1 3300050509 Bacteria 1307
222 nmdc:mga0qj67_422281_c1 3300050509 Unclassified 1075
223 nmdc:mga0qj67_447293_c1 3300050509 Bacteria 1041
224 nmdc:mga06r32_1566_c1 3300050510 Bacteria 20624
225 nmdc:mga06r32_267543_c1 3300050510 Bacteria 1697
226 nmdc:mga06r32_30218_c1 3300050510 Bacteria 5083
227 nmdc:mga06r32_46532_c1 3300050510 Bacteria 4140
228 nmdc:mga0n895_199829_c1 3300050512 Bacteria 2030
229 Ga0500651_0000002 3300053093 Bacteria 476609
230 Ga0500556_0004055 3300053104 Bacteria 4207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0071720 Ga0439439_0071720_35_793 242
2 3300046543 Ga0495645_0256807 Ga0495645_0256807_109_1065 263
3 3300005439 Ga0070711_100093852 Ga0070711_1000938521 280
4 3300006028 Ga0070717_10226288 Ga0070717_102262882 280
5 3300025915 Ga0207693_10301093 Ga0207693_103010932 280
6 3300025916 Ga0207663_10227192 Ga0207663_102271921 280
7 3300025928 Ga0207700_10100202 Ga0207700_101002022 280
8 3300046683 Ga0495658_0063066 Ga0495658_0063066_1244_2122 280
9 3300021358 Ga0213873_10001751 Ga0213873_100017511 281
10 3300039453 Ga0436362_0712339 Ga0436362_0712339_427_1386 281
11 3300025944 Ga0207661_10000025 Ga0207661_1000002514 282
12 3300045051 Ga0451576_0666247 Ga0451576_0666247_180_1064 282
13 3300046531 Ga0495665_0090054 Ga0495665_0090054_668_1552 282
14 3300047471 Ga0495684_0013296 Ga0495684_0013296_5192_6076 282
15 3300035116 Ga0373945_0049708 Ga0373945_0049708_48_1076 283
16 3300035170 Ga0373943_0062583 Ga0373943_0062583_87_1118 283
17 3300035695 Ga0373927_0059405 Ga0373927_0059405_749_1780 283
18 3300035725 Ga0373947_0299779 Ga0373947_0299779_21_989 283
19 3300046472 Ga0495580_0000470 Ga0495580_0000470_24040_25071 283
20 3300046473 Ga0495582_0007048 Ga0495582_0007048_2737_3768 283
21 3300046543 Ga0495645_0185819 Ga0495645_0185819_19_921 283
22 3300009093 Ga0105240_10020623 Ga0105240_100206232 284
23 3300009545 Ga0105237_10024375 Ga0105237_100243754 284
24 3300010375 Ga0105239_10050871 Ga0105239_100508714 284
25 3300025913 Ga0207695_10391003 Ga0207695_103910032 284
26 3300025914 Ga0207671_10009756 Ga0207671_100097567 284
27 3300025944 Ga0207661_10182321 Ga0207661_101823212 284
28 3300049524 Ga0501301_003360 Ga0501301_003360_83_1015 284
29 3300013308 Ga0157375_10098984 Ga0157375_100989842 286
30 3300049569 Ga0501032_0101141 Ga0501032_0101141_167_1120 286
31 3300049822 Ga0501035_0227303 Ga0501035_0227303_437_1390 286
32 3300042876 Ga0451577_0624779 Ga0451577_0624779_35_967 287
33 3300044712 Ga0453684_0185382 Ga0453684_0185382_1301_2233 287
34 3300039447 Ga0436361_0145631 Ga0436361_0145631_16224_17207 288
35 3300009093 Ga0105240_10005505 Ga0105240_1000550517 289
36 3300009545 Ga0105237_10000275 Ga0105237_100002757 289
37 3300025913 Ga0207695_10025103 Ga0207695_100251034 289
38 3300025914 Ga0207671_10000134 Ga0207671_100001347 289
39 3300025944 Ga0207661_10159859 Ga0207661_101598591 289
40 3300028800 Ga0265338_10037316 Ga0265338_100373164 290
41 3300031711 Ga0265314_10099813 Ga0265314_100998132 290
42 3300005468 Ga0070707_100174666 Ga0070707_1001746661 291
43 3300009177 Ga0105248_10040064 Ga0105248_100400646 291
44 3300014325 Ga0163163_10054389 Ga0163163_100543893 291
45 3300025941 Ga0207711_10047400 Ga0207711_100474003 291
46 3300025944 Ga0207661_10120153 Ga0207661_101201532 291
47 3300046516 Ga0495628_0211639 Ga0495628_0211639_468_1409 291
48 3300046663 Ga0495635_0169430 Ga0495635_0169430_161_1102 291
49 3300005329 Ga0070683_100073386 Ga0070683_1000733862 292
50 3300005436 Ga0070713_100034597 Ga0070713_1000345972 292
51 3300006028 Ga0070717_10062160 Ga0070717_100621602 292
52 3300013307 Ga0157372_10009753 Ga0157372_100097534 292
53 3300046536 Ga0495587_0055326 Ga0495587_0055326_663_1589 292
54 3300046543 Ga0495645_0002203 Ga0495645_0002203_929_1855 292
55 3300046663 Ga0495635_0140937 Ga0495635_0140937_363_1289 292
56 3300046680 Ga0495646_0071647 Ga0495646_0071647_765_1691 292
57 3300047317 Ga0495604_0021777 Ga0495604_0021777_1878_2804 292
58 3300047472 Ga0495686_0003671 Ga0495686_0003671_5402_6352 292
59 3300048088 Ga0495602_0063546 Ga0495602_0063546_2231_3157 292
60 3300005434 Ga0070709_10042052 Ga0070709_100420521 293
61 3300005436 Ga0070713_100110503 Ga0070713_1001105032 293
62 3300005842 Ga0068858_100018455 Ga0068858_1000184554 293
63 3300006028 Ga0070717_10032422 Ga0070717_100324222 293
64 3300006846 Ga0075430_100242252 Ga0075430_1002422522 293
65 3300006847 Ga0075431_100042678 Ga0075431_1000426782 293
66 3300009101 Ga0105247_10061825 Ga0105247_100618251 293
67 3300025928 Ga0207700_10011274 Ga0207700_100112744 293
68 3300026035 Ga0207703_10013376 Ga0207703_100133762 293
69 3300031250 Ga0265331_10044913 Ga0265331_100449132 293
70 3300031344 Ga0265316_10004502 Ga0265316_100045024 293
71 3300031548 Ga0307408_100009719 Ga0307408_1000097195 293
72 3300031852 Ga0307410_10002262 Ga0307410_100022622 293
73 3300031903 Ga0307407_10282253 Ga0307407_102822531 293
74 3300031995 Ga0307409_100183125 Ga0307409_1001831252 293
75 3300032126 Ga0307415_100073994 Ga0307415_1000739943 293
76 3300042007 Ga0439449_0020574 Ga0439449_0020574_256_1200 293
77 3300042014 Ga0439457_033216 Ga0439457_033216_113_1057 293
78 3300046454 Ga0495592_0127202 Ga0495592_0127202_676_1626 293
79 3300049575 Ga0501039_0352811 Ga0501039_0352811_77_1027 293
80 3300050509 nmdc:mga0qj67_422281_c1 nmdc:mga0qj67_422281_c1_67_1056 293
81 3300050510 nmdc:mga06r32_30218_c1 nmdc:mga06r32_30218_c1_2288_3277 293
82 3300005434 Ga0070709_10040889 Ga0070709_100408892 294
83 3300005518 Ga0070699_100163258 Ga0070699_1001632582 294
84 3300006237 Ga0097621_100180636 Ga0097621_1001806362 294
85 3300006847 Ga0075431_100015320 Ga0075431_1000153204 294
86 3300009177 Ga0105248_10118805 Ga0105248_101188054 294
87 3300014325 Ga0163163_10688449 Ga0163163_106884491 294
88 3300025949 Ga0207667_10267784 Ga0207667_102677842 294
89 3300031344 Ga0265316_10158001 Ga0265316_101580012 294
90 3300031507 Ga0307509_10156731 Ga0307509_101567312 294
91 3300046543 Ga0495645_0068838 Ga0495645_0068838_11_1048 294
92 3300005335 Ga0070666_10102069 Ga0070666_101020692 295
93 3300005338 Ga0068868_100175282 Ga0068868_1001752822 295
94 3300005355 Ga0070671_100021685 Ga0070671_1000216852 295
95 3300005364 Ga0070673_100085253 Ga0070673_1000852532 295
96 3300005548 Ga0070665_100030721 Ga0070665_1000307215 295
97 3300005841 Ga0068863_100178153 Ga0068863_1001781532 295
98 3300009093 Ga0105240_10347639 Ga0105240_103476391 295
99 3300009177 Ga0105248_10149212 Ga0105248_101492122 295
100 3300009177 Ga0105248_10155752 Ga0105248_101557522 295
101 3300013105 Ga0157369_10033628 Ga0157369_100336282 295
102 3300013105 Ga0157369_10096549 Ga0157369_100965492 295
103 3300013296 Ga0157374_10003766 Ga0157374_1000376613 295
104 3300014325 Ga0163163_10006426 Ga0163163_100064265 295
105 3300014325 Ga0163163_10158038 Ga0163163_101580382 295
106 3300014969 Ga0157376_10011031 Ga0157376_100110312 295
107 3300025913 Ga0207695_10292327 Ga0207695_102923272 295
108 3300025941 Ga0207711_10173658 Ga0207711_101736582 295
109 3300025941 Ga0207711_10396069 Ga0207711_103960691 295
110 3300026095 Ga0207676_10336135 Ga0207676_103361352 295
111 3300031344 Ga0265316_10021831 Ga0265316_100218315 295
112 3300039437 Ga0436365_1389792 Ga0436365_1389792_120_1073 295
113 3300046459 Ga0495629_0099229 Ga0495629_0099229_1043_2005 295
114 3300046471 Ga0495650_0000041 Ga0495650_0000041_362730_363683 295
115 3300046477 Ga0495664_0063358 Ga0495664_0063358_372_1340 295
116 3300046499 Ga0495594_0000638 Ga0495594_0000638_1043_2005 295
117 3300046689 Ga0495613_0004053 Ga0495613_0004053_8456_9418 295
118 3300047319 Ga0495674_0028929 Ga0495674_0028929_2451_3419 295
119 3300047471 Ga0495684_0074025 Ga0495684_0074025_531_1499 295
120 3300048089 Ga0495614_0066049 Ga0495614_0066049_461_1423 295
121 3300048917 Ga0496114_0414101 Ga0496114_0414101_29_1000 295
122 3300053093 Ga0500651_0000002 Ga0500651_0000002_384394_385356 295
123 3300014969 Ga0157376_10005377 Ga0157376_1000537711 296
124 3300039437 Ga0436365_0198630 Ga0436365_0198630_19_975 296
125 3300039447 Ga0436361_0650330 Ga0436361_0650330_13925_14908 296
126 3300046472 Ga0495580_0001126 Ga0495580_0001126_4288_5265 296
127 3300046675 Ga0495657_0144470 Ga0495657_0144470_374_1378 296
128 3300047317 Ga0495604_0106906 Ga0495604_0106906_892_1926 296
129 3300047317 Ga0495604_0151407 Ga0495604_0151407_550_1503 296
130 3300047444 Ga0495675_0078056 Ga0495675_0078056_396_1346 296
131 3300006846 Ga0075430_100330272 Ga0075430_1003302721 297
132 3300006847 Ga0075431_100001981 Ga0075431_1000019817 297
133 3300006880 Ga0075429_100020981 Ga0075429_1000209812 297
134 3300009147 Ga0114129_10063670 Ga0114129_100636701 297
135 3300050508 nmdc:mga09592_89843_c1 nmdc:mga09592_89843_c1_1024_2019 297
136 3300050509 nmdc:mga0qj67_297685_c1 nmdc:mga0qj67_297685_c1_221_1216 297
137 3300050510 nmdc:mga06r32_1566_c1 nmdc:mga06r32_1566_c1_9535_10530 297
138 3300013105 Ga0157369_10027970 Ga0157369_100279708 298
139 3300031090 Ga0265760_10000396 Ga0265760_100003967 298
140 iso_pu_bacteria 2884215851 2884216799 298
141 3300005535 Ga0070684_100157711 Ga0070684_1001577113 300
142 iso_pu_bacteria 2617270889 2617917637 300
143 iso_pu_bacteria 642555144 642605371 300
144 3300032002 Ga0307416_100273174 Ga0307416_1002731742 301
145 iso_pu_bacteria 2585428059 2587739344 301
146 iso_pu_bacteria 2643221676 2644426016 301
147 iso_pu_bacteria 8054795415 8054800739 301
148 3300005436 Ga0070713_100182000 Ga0070713_1001820002 302
149 3300048929 Ga0496126_0000853 Ga0496126_0000853_50184_51137 302
150 3300049569 Ga0501032_0003867 Ga0501032_0003867_4565_5518 302
151 3300049570 Ga0501033_0002897 Ga0501033_0002897_5001_5954 302
152 3300049571 Ga0501034_0456330 Ga0501034_0456330_97_1047 302
153 3300049572 Ga0501036_0004673 Ga0501036_0004673_4490_5443 302
154 3300049573 Ga0501037_0051898 Ga0501037_0051898_309_1262 302
155 3300049574 Ga0501038_0000072 Ga0501038_0000072_43154_44107 302
156 3300049579 Ga0501043_0001570 Ga0501043_0001570_2569_3522 302
157 3300049580 Ga0501046_0000811 Ga0501046_0000811_4438_5391 302
158 3300049581 Ga0501047_0008956 Ga0501047_0008956_5481_6434 302
159 3300049589 Ga0501073_0009372 Ga0501073_0009372_408_1361 302
160 3300005290 Ga0065712_10136805 Ga0065712_101368052 303
161 3300005327 Ga0070658_10098589 Ga0070658_100985891 303
162 3300005354 Ga0070675_100202770 Ga0070675_1002027701 303
163 3300005356 Ga0070674_100179435 Ga0070674_1001794351 303
164 3300005458 Ga0070681_10023691 Ga0070681_100236913 303
165 3300005530 Ga0070679_100127304 Ga0070679_1001273043 303
166 3300005563 Ga0068855_100556203 Ga0068855_1005562032 303
167 3300009551 Ga0105238_10291893 Ga0105238_102918932 303
168 3300013104 Ga0157370_10255711 Ga0157370_102557113 303
169 3300013105 Ga0157369_10317827 Ga0157369_103178271 303
170 3300025949 Ga0207667_10044981 Ga0207667_100449811 303
171 3300031711 Ga0265314_10025114 Ga0265314_100251143 303
172 3300005329 Ga0070683_100000018 Ga0070683_100000018164 304
173 3300005535 Ga0070684_100000011 Ga0070684_100000011149 304
174 3300009147 Ga0114129_10113731 Ga0114129_101137313 304
175 3300013105 Ga0157369_10046580 Ga0157369_100465803 304
176 3300021388 Ga0213875_10041879 Ga0213875_100418792 304
177 3300025928 Ga0207700_10078635 Ga0207700_100786352 304
178 3300028800 Ga0265338_10149321 Ga0265338_101493211 304
179 3300031691 Ga0316579_10155578 Ga0316579_101555781 304
180 3300035692 Ga0373935_0124604 Ga0373935_0124604_590_1564 304
181 3300035724 Ga0373933_0009382 Ga0373933_0009382_1630_2586 304
182 3300037471 Ga0395905_0108194 Ga0395905_0108194_1188_2156 304
183 3300050510 nmdc:mga06r32_46532_c1 nmdc:mga06r32_46532_c1_3020_4000 304
184 3300005338 Ga0068868_100012472 Ga0068868_1000124722 305
185 3300005339 Ga0070660_100055682 Ga0070660_1000556823 305
186 3300005347 Ga0070668_100012166 Ga0070668_1000121668 305
187 3300005353 Ga0070669_100004441 Ga0070669_1000044418 305
188 3300005354 Ga0070675_100005596 Ga0070675_1000055967 305
189 3300005367 Ga0070667_100006552 Ga0070667_1000065524 305
190 3300005844 Ga0068862_100016006 Ga0068862_1000160064 305
191 3300009553 Ga0105249_10005057 Ga0105249_100050576 305
192 3300010375 Ga0105239_10015340 Ga0105239_100153407 305
193 3300013296 Ga0157374_10283161 Ga0157374_102831612 305
194 3300013306 Ga0163162_10028449 Ga0163162_100284494 305
195 3300025315 Ga0207697_10002339 Ga0207697_1000233911 305
196 3300025907 Ga0207645_10004682 Ga0207645_100046828 305
197 3300025918 Ga0207662_10009496 Ga0207662_100094962 305
198 3300025919 Ga0207657_10115397 Ga0207657_101153972 305
199 3300025923 Ga0207681_10038453 Ga0207681_100384532 305
200 3300025926 Ga0207659_10020101 Ga0207659_100201014 305
201 3300025932 Ga0207690_10133005 Ga0207690_101330052 305
202 3300025961 Ga0207712_10005523 Ga0207712_100055236 305
203 3300025986 Ga0207658_10031595 Ga0207658_100315953 305
204 3300026023 Ga0207677_10009380 Ga0207677_100093803 305
205 3300028380 Ga0268265_10008732 Ga0268265_100087325 305
206 3300050512 nmdc:mga0n895_199829_c1 nmdc:mga0n895_199829_c1_735_1682 305
207 3300005367 Ga0070667_100045859 Ga0070667_1000458594 306
208 3300005614 Ga0068856_100034841 Ga0068856_1000348413 306
209 3300025986 Ga0207658_10109344 Ga0207658_101093441 306
210 3300026078 Ga0207702_10005525 Ga0207702_100055255 306
211 3300031727 Ga0316576_10078796 Ga0316576_100787962 306
212 3300005435 Ga0070714_100223789 Ga0070714_1002237892 308
213 3300005436 Ga0070713_100042532 Ga0070713_1000425321 308
214 3300005437 Ga0070710_10033179 Ga0070710_100331792 308
215 3300005439 Ga0070711_100002950 Ga0070711_1000029503 308
216 3300005445 Ga0070708_100006118 Ga0070708_1000061185 308
217 3300006028 Ga0070717_10000232 Ga0070717_1000023211 308
218 3300006028 Ga0070717_10118175 Ga0070717_101181753 308
219 3300006028 Ga0070717_10162322 Ga0070717_101623222 308
220 3300006163 Ga0070715_10017180 Ga0070715_100171803 308
221 3300006175 Ga0070712_100000480 Ga0070712_10000048022 308
222 3300006237 Ga0097621_100209171 Ga0097621_1002091711 308
223 3300009101 Ga0105247_10072851 Ga0105247_100728513 308
224 3300009545 Ga0105237_10209698 Ga0105237_102096981 308
225 3300025898 Ga0207692_10030118 Ga0207692_100301182 308
226 3300025915 Ga0207693_10001449 Ga0207693_1000144920 308
227 3300025916 Ga0207663_10001319 Ga0207663_100013198 308
228 3300025928 Ga0207700_10353850 Ga0207700_103538502 308
229 3300025939 Ga0207665_10144789 Ga0207665_101447891 308
230 3300031090 Ga0265760_10005751 Ga0265760_100057512 308
231 3300046522 Ga0495643_0000104 Ga0495643_0000104_30046_31011 308
232 3300048915 Ga0496112_0018637 Ga0496112_0018637_4386_5354 308
233 3300050509 nmdc:mga0qj67_447293_c1 nmdc:mga0qj67_447293_c1_50_1012 308
234 3300050510 nmdc:mga06r32_267543_c1 nmdc:mga06r32_267543_c1_139_1101 308
235 3300053104 Ga0500556_0004055 Ga0500556_0004055_2226_3290 308
236 3300003320 rootH2_10024004 rootH2_100240044 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

39

337

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9003 13 303
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.8918 3 305
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.8842 4 305
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.8836 3 309
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8788 4 291
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9066 3 305 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8987 3 305 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8884 11 304 3.20.20.100
3n2tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8842 4 305 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8792 3 305 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A0S8KEC8-F1-model_v4 Aldo/keto reductase 0.9621 3 305 GO:0005829
GO:0016491
AF-A0A535A132-F1-model_v4 Aldo/keto reductase 0.9619 1 305 GO:0005829
AF-A0A3M1A6V9-F1-model_v4 Aldo/keto reductase 0.9573 3 305 GO:0005829
GO:0016491
AF-A0A4Q3V2N6-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.9564 102 207 GO:0004033
GO:0005737
AF-A0A382Q2E1-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9525 3 163 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
91.06 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map