F348735

General Info

Members Datasets Scaffolds Average Seq Length
236 144 472 555

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10071062|Ga0065712_100710623
Length 568
Sequence MGRMKRPASIIVAVLVAASCAAPGGPPAPKDTPLADLPAIDTNAILADTRALSADEFEGREPGSPGEEKTIAYLTDAAKKIGLEPGNPDGTYIQKVPLVGLTPEKISPLVVKRSGKTLTLKHHDQFIAFSQRVTDKIDLNDSELVFAGYGVQAPEYKWDDFKGLDVKGKTIVVLVGDPPVVDAASTATPKPLDKKTFGGDAMTYYGRWTYKYEKAAELGAAGVLIVHETGPAGYPFSVVQGFGGQRFDLITPDKNMGRAAVQGWLSLEAATALMKLAGQDYDKLKAAALSPDFKPVSLGATASMNFTQMQRTVDSRNVIAKITGADPALKNEYVIYSAHWDHLGIGDPVNGDKIYNGAVDNASGSAMTLEIARAFKKVQPQPKRSIVFLWVTAEEQGLLGSGYYASFPLYPLAKTLANINIDEINPWGRTKDLTIVGLGASDLDDYTRDAAAEQGRVLKPDAEPQKGFYYRSDHFNFAKHGVPALDPDDGVDFIGKPDGYGKAKREQWSNVDYHQPSDVVKSDWDLTGAAEDGKVLFAVGYRVANAARFPEWKNGNEFKATRDKMLGR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0
Rhizosphere 96.61
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10071062 3300005290 Bacteria 5509
2 SwRhRL2b_contig_369444 2162886007 Bacteria 3194
3 JGI24746J21847_1001363 3300001977 Bacteria 3895
4 Ga0065704_10003863 3300005289 Bacteria 7143
5 Ga0065712_10070543 3300005290 Bacteria 5919
6 Ga0065715_10003143 3300005293 Bacteria 4805
7 Ga0065715_10091652 3300005293 Bacteria 5645
8 Ga0065715_10111451 3300005293 Bacteria 2573
9 Ga0065707_10087779 3300005295 Bacteria 4895
10 Ga0065707_10110117 3300005295 Bacteria 2443
11 Ga0070676_10031465 3300005328 Bacteria 3032
12 Ga0070690_100005290 3300005330 Bacteria 7237
13 Ga0070670_100003074 3300005331 Bacteria 13801
14 Ga0068869_100008671 3300005334 Bacteria 6565
15 Ga0070666_10047078 3300005335 Bacteria 2894
16 Ga0070689_100014681 3300005340 Bacteria 5696
17 Ga0070661_100008328 3300005344 Bacteria 7161
18 Ga0070668_100012870 3300005347 Bacteria 6228
19 Ga0070668_100097280 3300005347 Bacteria 2328
20 Ga0070669_100076844 3300005353 Bacteria 2479
21 Ga0070675_100012236 3300005354 Bacteria 6724
22 Ga0070675_100024024 3300005354 Bacteria 4879
23 Ga0070674_100094013 3300005356 Bacteria 2170
24 Ga0070673_100019757 3300005364 Bacteria 4844
25 Ga0070688_100006420 3300005365 Bacteria 6286
26 Ga0070688_100022341 3300005365 Bacteria 3705
27 Ga0070667_100087256 3300005367 Bacteria 2678
28 Ga0070714_100163227 3300005435 Bacteria 2017
29 Ga0070701_10005958 3300005438 Bacteria 5090
30 Ga0070701_10008715 3300005438 Bacteria 4404
31 Ga0070701_10055241 3300005438 Bacteria 2074
32 Ga0070705_100016187 3300005440 Bacteria 3872
33 Ga0070700_100001570 3300005441 Bacteria 11392
34 Ga0070678_100049791 3300005456 Bacteria 3025
35 Ga0070662_100078015 3300005457 Bacteria 2459
36 Ga0068867_100007502 3300005459 Bacteria 7714
37 Ga0068867_100057658 3300005459 Bacteria 2877
38 Ga0068867_100081184 3300005459 Bacteria 2444
39 Ga0070699_100004064 3300005518 Bacteria 12934
40 Ga0070699_100006115 3300005518 Bacteria 10528
41 Ga0070699_100014601 3300005518 Bacteria 6755
42 Ga0070679_100018440 3300005530 Bacteria 6772
43 Ga0070697_100060999 3300005536 Bacteria 3075
44 Ga0070672_100004637 3300005543 Bacteria 9003
45 Ga0070672_100024099 3300005543 Bacteria 4491
46 Ga0070686_100034502 3300005544 Bacteria 3118
47 Ga0070695_100018049 3300005545 Bacteria 4283
48 Ga0070696_100009093 3300005546 Bacteria 6654
49 Ga0070696_100009482 3300005546 Bacteria 6519
50 Ga0070696_100059731 3300005546 Bacteria 2665
51 Ga0070704_100005730 3300005549 Bacteria 7261
52 Ga0070704_100034047 3300005549 Bacteria 3451
53 Ga0070664_100014299 3300005564 Bacteria 6472
54 Ga0070664_100046006 3300005564 Bacteria 3686
55 Ga0068857_100008157 3300005577 Bacteria 9043
56 Ga0068857_100034134 3300005577 Bacteria 4501
57 Ga0068859_100016007 3300005617 Bacteria 7537
58 Ga0068859_100068863 3300005617 Bacteria 3573
59 Ga0068859_100081640 3300005617 Bacteria 3275
60 Ga0068859_100161209 3300005617 Bacteria 2322
61 Ga0068864_100048746 3300005618 Bacteria 3642
62 Ga0068864_100078129 3300005618 Bacteria 2896
63 Ga0068861_100003723 3300005719 Bacteria 10169
64 Ga0068861_100007177 3300005719 Bacteria 7629
65 Ga0068861_100008024 3300005719 Bacteria 7263
66 Ga0068870_10001671 3300005840 Bacteria 9078
67 Ga0068863_100034078 3300005841 Bacteria 4850
68 Ga0068858_100026720 3300005842 Bacteria 5362
69 Ga0068858_100037635 3300005842 Bacteria 4487
70 Ga0068858_100166276 3300005842 Bacteria 2079
71 Ga0068860_100016367 3300005843 Bacteria 7231
72 Ga0068860_100047061 3300005843 Bacteria 4111
73 Ga0068862_100000965 3300005844 Bacteria 27670
74 Ga0068862_100004940 3300005844 Bacteria 11226
75 Ga0081455_10022296 3300005937 Bacteria 5921
76 Ga0068871_100055530 3300006358 Bacteria 3215
77 Ga0075431_100067492 3300006847 Bacteria 3692
78 Ga0075433_10143535 3300006852 Bacteria 2122
79 Ga0075434_100005095 3300006871 Bacteria 11930
80 Ga0075434_100012832 3300006871 Bacteria 7954
81 Ga0075434_100027477 3300006871 Bacteria 5587
82 Ga0075429_100010805 3300006880 Bacteria 7896
83 Ga0068865_100009299 3300006881 Bacteria 6087
84 Ga0068865_100020105 3300006881 Bacteria 4329
85 Ga0097620_100016007 3300006931 Bacteria 7537
86 Ga0097620_100068871 3300006931 Bacteria 3573
87 Ga0097620_100081648 3300006931 Bacteria 3275
88 Ga0097620_100161219 3300006931 Bacteria 2322
89 Ga0075435_100007942 3300007076 Bacteria 7593
90 Ga0111539_10015154 3300009094 Bacteria 9605
91 Ga0111539_10039916 3300009094 Bacteria 5652
92 Ga0111539_10061298 3300009094 Bacteria 4457
93 Ga0111539_10062395 3300009094 Bacteria 4412
94 Ga0114129_10000079 3300009147 Bacteria 88903
95 Ga0105243_10020287 3300009148 Bacteria 5039
96 Ga0105248_10012461 3300009177 Bacteria 9378
97 Ga0105249_10003192 3300009553 Bacteria 14187
98 Ga0105249_10152915 3300009553 Bacteria 2223
99 Ga0105246_10026584 3300011119 Bacteria 3783
100 Ga0157378_10150640 3300013297 Bacteria 2167
101 Ga0163162_10013470 3300013306 Bacteria 7982
102 Ga0157375_10022353 3300013308 Bacteria 5821
103 Ga0163163_10020580 3300014325 Bacteria 6217
104 Ga0163163_10041944 3300014325 Bacteria 4478
105 Ga0163163_10111204 3300014325 Bacteria 2768
106 Ga0157380_10008857 3300014326 Bacteria 7191
107 Ga0157377_10032285 3300014745 Bacteria 2850
108 Ga0157377_10050931 3300014745 Bacteria 2334
109 Ga0157379_10003429 3300014968 Bacteria 13411
110 Ga0157379_10009589 3300014968 Bacteria 8432
111 Ga0163161_10010166 3300017792 Bacteria 6514
112 Ga0213872_10000280 3300021361 Bacteria 43485
113 Ga0213875_10013745 3300021388 Bacteria 3965
114 Ga0207697_10000697 3300025315 Bacteria 19115
115 Ga0207688_10001103 3300025901 Bacteria 13851
116 Ga0207680_10013817 3300025903 Bacteria 4158
117 Ga0207645_10002320 3300025907 Bacteria 15044
118 Ga0207645_10005463 3300025907 Bacteria 9199
119 Ga0207643_10000836 3300025908 Bacteria 18714
120 Ga0207643_10003780 3300025908 Bacteria 8138
121 Ga0207707_10112979 3300025912 Bacteria 2374
122 Ga0207707_10125395 3300025912 Bacteria 2246
123 Ga0207660_10067988 3300025917 Bacteria 2582
124 Ga0207662_10036002 3300025918 Bacteria 2892
125 Ga0207649_10049984 3300025920 Bacteria 2585
126 Ga0207652_10134225 3300025921 Bacteria 2209
127 Ga0207681_10041446 3300025923 Bacteria 3069
128 Ga0207650_10062050 3300025925 Bacteria 2792
129 Ga0207659_10011889 3300025926 Bacteria 5515
130 Ga0207659_10017506 3300025926 Bacteria 4682
131 Ga0207659_10127188 3300025926 Bacteria 1961
132 Ga0207706_10016206 3300025933 Bacteria 6734
133 Ga0207706_10025834 3300025933 Bacteria 5260
134 Ga0207709_10025914 3300025935 Bacteria 3362
135 Ga0207670_10005480 3300025936 Bacteria 6971
136 Ga0207670_10010603 3300025936 Bacteria 5316
137 Ga0207669_10054232 3300025937 Bacteria 2420
138 Ga0207704_10062476 3300025938 Bacteria 2316
139 Ga0207691_10000562 3300025940 Bacteria 37130
140 Ga0207691_10006362 3300025940 Bacteria 11410
141 Ga0207711_10050038 3300025941 Bacteria 3577
142 Ga0207689_10020575 3300025942 Bacteria 5552
143 Ga0207689_10024223 3300025942 Bacteria 5092
144 Ga0207661_10007750 3300025944 Bacteria 7646
145 Ga0207679_10024065 3300025945 Bacteria 4172
146 Ga0207679_10041867 3300025945 Bacteria 3288
147 Ga0207651_10040159 3300025960 Bacteria 3093
148 Ga0207651_10096703 3300025960 Bacteria 2178
149 Ga0207712_10133075 3300025961 Bacteria 1898
150 Ga0207658_10020112 3300025986 Bacteria 4622
151 Ga0207703_10019691 3300026035 Bacteria 5275
152 Ga0207703_10061892 3300026035 Bacteria 3065
153 Ga0207708_10000984 3300026075 Bacteria 21320
154 Ga0207708_10032467 3300026075 Bacteria 3965
155 Ga0207708_10068691 3300026075 Bacteria 2712
156 Ga0207641_10060190 3300026088 Bacteria 3236
157 Ga0207648_10003593 3300026089 Bacteria 16219
158 Ga0207648_10033554 3300026089 Bacteria 4527
159 Ga0207648_10042050 3300026089 Bacteria 4012
160 Ga0207676_10020737 3300026095 Bacteria 4812
161 Ga0207676_10028805 3300026095 Bacteria 4153
162 Ga0207676_10088821 3300026095 Bacteria 2531
163 Ga0207674_10026509 3300026116 Bacteria 6151
164 Ga0207674_10033079 3300026116 Bacteria 5416
165 Ga0207675_100002149 3300026118 Bacteria 19583
166 Ga0207675_100017397 3300026118 Bacteria 6710
167 Ga0207675_100128800 3300026118 Bacteria 2399
168 Ga0207683_10006166 3300026121 Bacteria 10275
169 Ga0207683_10038478 3300026121 Bacteria 4169
170 Ga0207683_10049075 3300026121 Bacteria 3694
171 Ga0207698_10115225 3300026142 Bacteria 2262
172 Ga0207428_10003282 3300027907 Bacteria 15733
173 Ga0207428_10005022 3300027907 Bacteria 12443
174 Ga0207428_10013607 3300027907 Bacteria 7100
175 Ga0268266_10065042 3300028379 Bacteria 3152
176 Ga0268265_10000887 3300028380 Bacteria 27910
177 Ga0268264_10025572 3300028381 Bacteria 4824
178 Ga0307416_100013087 3300032002 Bacteria 5626
179 Ga0436364_0157527 3300037853 Unclassified 2584
180 Ga0436364_0167843 3300037853 Bacteria 3966
181 Ga0436364_1244976 3300037853 Bacteria 2781
182 Ga0436365_0061898 3300039437 Bacteria 5724
183 Ga0436365_0414784 3300039437 Bacteria 2770
184 Ga0436361_0207335 3300039447 Bacteria 51296
185 Ga0436363_0143841 3300039450 Bacteria 3358
186 Ga0436362_0930933 3300039453 Bacteria 3635
187 Ga0453684_0096499 3300044712 Bacteria 3631
188 Ga0451576_0144887 3300045051 Bacteria 2477
189 Ga0451576_0169392 3300045051 Bacteria 2279
190 Ga0495642_0005259 3300046528 Bacteria 4978
191 Ga0495621_0001095 3300046539 Bacteria 6967
192 Ga0495669_0039709 3300046684 Bacteria 2084
193 Ga0501034_0118505 3300049571 Bacteria 2634
194 Ga0501038_0044448 3300049574 Bacteria 3859
195 Ga0501039_0052292 3300049575 Bacteria 3161
196 Ga0501040_0020015 3300049576 Bacteria 4456
197 Ga0501041_0081755 3300049577 Bacteria 1989
198 Ga0501042_0080295 3300049578 Bacteria 2337
199 Ga0501071_0036537 3300049587 Bacteria 3504
200 Ga0501071_0073612 3300049587 Bacteria 2492
201 Ga0501073_0029371 3300049589 Bacteria 3930
202 Ga0501075_0000810 3300049591 Bacteria 19574
203 Ga0501075_0093293 3300049591 Bacteria 2285
204 Ga0501076_0067965 3300049592 Bacteria 2846
205 Ga0501076_0070401 3300049592 Bacteria 2796
206 Ga0501076_0088444 3300049592 Bacteria 2489
207 Ga0501080_0139447 3300049742 Bacteria 2242
208 Ga0501081_0003051 3300049743 Bacteria 10625
209 Ga0501081_0073595 3300049743 Bacteria 2383
210 Ga0501044_0003092 3300049823 Bacteria 18842
211 Ga0501045_0002474 3300049824 Bacteria 12562
212 Ga0501045_0021038 3300049824 Bacteria 4664
213 nmdc:mga06z11_25656_c1 3300050494 Bacteria 2796
214 nmdc:mga05p37_1831_c1 3300050507 Bacteria 24798
215 nmdc:mga05p37_23_c1 3300050507 Bacteria 119324
216 nmdc:mga05p37_66713_c1 3300050507 Bacteria 4426
217 nmdc:mga0qj67_3051_c1 3300050509 Bacteria 12034
218 nmdc:mga0qj67_78514_c1 3300050509 Bacteria 2642
219 nmdc:mga06r32_19163_c1 3300050510 Bacteria 6279
220 nmdc:mga08y16_152214_c1 3300050511 Bacteria 2404
221 nmdc:mga08y16_21843_c1 3300050511 Bacteria 6753
222 nmdc:mga08y16_5316_c1 3300050511 Bacteria 13469
223 nmdc:mga08y16_7473_c1 3300050511 Bacteria 11446
224 nmdc:mga08y16_8464_c1 3300050511 Bacteria 10772
225 nmdc:mga0n895_6122_c1 3300050512 Bacteria 10160
226 nmdc:mga0rr50_5378_c1 3300050513 Bacteria 7631
227 nmdc:mga0a205_35048_c1 3300050515 Bacteria 4818
228 nmdc:mga0a205_37099_c1 3300050515 Bacteria 4686
229 nmdc:mga0a205_43644_c1 3300050515 Bacteria 4322
230 nmdc:mga0a205_45886_c1 3300050515 Bacteria 4214
231 nmdc:mga0a205_936_c2 3300050515 Bacteria 22084
232 Ga0501084_0003614 3300054114 Bacteria 12556
233 Ga0501084_0168428 3300054114 Bacteria 1849
234 Ga0530510_0002997 3300061734 Bacteria 11580
235 Ga0530510_0003918 3300061734 Bacteria 10265
236 Ga0530510_0122106 3300061734 Bacteria 1913
237 Ga0065712_10071062
238 SwRhRL2b_contig_369444
239 JGI24746J21847_1001363
240 Ga0065704_10003863
241 Ga0065712_10070543
242 Ga0065715_10003143
243 Ga0065715_10091652
244 Ga0065715_10111451
245 Ga0065707_10087779
246 Ga0065707_10110117
247 Ga0070676_10031465
248 Ga0070690_100005290
249 Ga0070670_100003074
250 Ga0068869_100008671
251 Ga0070666_10047078
252 Ga0070689_100014681
253 Ga0070661_100008328
254 Ga0070668_100012870
255 Ga0070668_100097280
256 Ga0070669_100076844
257 Ga0070675_100012236
258 Ga0070675_100024024
259 Ga0070674_100094013
260 Ga0070673_100019757
261 Ga0070688_100006420
262 Ga0070688_100022341
263 Ga0070667_100087256
264 Ga0070714_100163227
265 Ga0070701_10005958
266 Ga0070701_10008715
267 Ga0070701_10055241
268 Ga0070705_100016187
269 Ga0070700_100001570
270 Ga0070678_100049791
271 Ga0070662_100078015
272 Ga0068867_100007502
273 Ga0068867_100057658
274 Ga0068867_100081184
275 Ga0070699_100004064
276 Ga0070699_100006115
277 Ga0070699_100014601
278 Ga0070679_100018440
279 Ga0070697_100060999
280 Ga0070672_100004637
281 Ga0070672_100024099
282 Ga0070686_100034502
283 Ga0070695_100018049
284 Ga0070696_100009093
285 Ga0070696_100009482
286 Ga0070696_100059731
287 Ga0070704_100005730
288 Ga0070704_100034047
289 Ga0070664_100014299
290 Ga0070664_100046006
291 Ga0068857_100008157
292 Ga0068857_100034134
293 Ga0068859_100016007
294 Ga0068859_100068863
295 Ga0068859_100081640
296 Ga0068859_100161209
297 Ga0068864_100048746
298 Ga0068864_100078129
299 Ga0068861_100003723
300 Ga0068861_100007177
301 Ga0068861_100008024
302 Ga0068870_10001671
303 Ga0068863_100034078
304 Ga0068858_100026720
305 Ga0068858_100037635
306 Ga0068858_100166276
307 Ga0068860_100016367
308 Ga0068860_100047061
309 Ga0068862_100000965
310 Ga0068862_100004940
311 Ga0081455_10022296
312 Ga0068871_100055530
313 Ga0075431_100067492
314 Ga0075433_10143535
315 Ga0075434_100005095
316 Ga0075434_100012832
317 Ga0075434_100027477
318 Ga0075429_100010805
319 Ga0068865_100009299
320 Ga0068865_100020105
321 Ga0097620_100016007
322 Ga0097620_100068871
323 Ga0097620_100081648
324 Ga0097620_100161219
325 Ga0075435_100007942
326 Ga0111539_10015154
327 Ga0111539_10039916
328 Ga0111539_10061298
329 Ga0111539_10062395
330 Ga0114129_10000079
331 Ga0105243_10020287
332 Ga0105248_10012461
333 Ga0105249_10003192
334 Ga0105249_10152915
335 Ga0105246_10026584
336 Ga0157378_10150640
337 Ga0163162_10013470
338 Ga0157375_10022353
339 Ga0163163_10020580
340 Ga0163163_10041944
341 Ga0163163_10111204
342 Ga0157380_10008857
343 Ga0157377_10032285
344 Ga0157377_10050931
345 Ga0157379_10003429
346 Ga0157379_10009589
347 Ga0163161_10010166
348 Ga0213872_10000280
349 Ga0213875_10013745
350 Ga0207697_10000697
351 Ga0207688_10001103
352 Ga0207680_10013817
353 Ga0207645_10002320
354 Ga0207645_10005463
355 Ga0207643_10000836
356 Ga0207643_10003780
357 Ga0207707_10112979
358 Ga0207707_10125395
359 Ga0207660_10067988
360 Ga0207662_10036002
361 Ga0207649_10049984
362 Ga0207652_10134225
363 Ga0207681_10041446
364 Ga0207650_10062050
365 Ga0207659_10011889
366 Ga0207659_10017506
367 Ga0207659_10127188
368 Ga0207706_10016206
369 Ga0207706_10025834
370 Ga0207709_10025914
371 Ga0207670_10005480
372 Ga0207670_10010603
373 Ga0207669_10054232
374 Ga0207704_10062476
375 Ga0207691_10000562
376 Ga0207691_10006362
377 Ga0207711_10050038
378 Ga0207689_10020575
379 Ga0207689_10024223
380 Ga0207661_10007750
381 Ga0207679_10024065
382 Ga0207679_10041867
383 Ga0207651_10040159
384 Ga0207651_10096703
385 Ga0207712_10133075
386 Ga0207658_10020112
387 Ga0207703_10019691
388 Ga0207703_10061892
389 Ga0207708_10000984
390 Ga0207708_10032467
391 Ga0207708_10068691
392 Ga0207641_10060190
393 Ga0207648_10003593
394 Ga0207648_10033554
395 Ga0207648_10042050
396 Ga0207676_10020737
397 Ga0207676_10028805
398 Ga0207676_10088821
399 Ga0207674_10026509
400 Ga0207674_10033079
401 Ga0207675_100002149
402 Ga0207675_100017397
403 Ga0207675_100128800
404 Ga0207683_10006166
405 Ga0207683_10038478
406 Ga0207683_10049075
407 Ga0207698_10115225
408 Ga0207428_10003282
409 Ga0207428_10005022
410 Ga0207428_10013607
411 Ga0268266_10065042
412 Ga0268265_10000887
413 Ga0268264_10025572
414 Ga0307416_100013087
415 Ga0436364_0157527
416 Ga0436364_0167843
417 Ga0436364_1244976
418 Ga0436365_0061898
419 Ga0436365_0414784
420 Ga0436361_0207335
421 Ga0436363_0143841
422 Ga0436362_0930933
423 Ga0453684_0096499
424 Ga0451576_0144887
425 Ga0451576_0169392
426 Ga0495642_0005259
427 Ga0495621_0001095
428 Ga0495669_0039709
429 Ga0501034_0118505
430 Ga0501038_0044448
431 Ga0501039_0052292
432 Ga0501040_0020015
433 Ga0501041_0081755
434 Ga0501042_0080295
435 Ga0501071_0036537
436 Ga0501071_0073612
437 Ga0501073_0029371
438 Ga0501075_0000810
439 Ga0501075_0093293
440 Ga0501076_0067965
441 Ga0501076_0070401
442 Ga0501076_0088444
443 Ga0501080_0139447
444 Ga0501081_0003051
445 Ga0501081_0073595
446 Ga0501044_0003092
447 Ga0501045_0002474
448 Ga0501045_0021038
449 nmdc:mga06z11_25656_c1
450 nmdc:mga05p37_1831_c1
451 nmdc:mga05p37_23_c1
452 nmdc:mga05p37_66713_c1
453 nmdc:mga0qj67_3051_c1
454 nmdc:mga0qj67_78514_c1
455 nmdc:mga06r32_19163_c1
456 nmdc:mga08y16_152214_c1
457 nmdc:mga08y16_21843_c1
458 nmdc:mga08y16_5316_c1
459 nmdc:mga08y16_7473_c1
460 nmdc:mga08y16_8464_c1
461 nmdc:mga0n895_6122_c1
462 nmdc:mga0rr50_5378_c1
463 nmdc:mga0a205_35048_c1
464 nmdc:mga0a205_37099_c1
465 nmdc:mga0a205_43644_c1
466 nmdc:mga0a205_45886_c1
467 nmdc:mga0a205_936_c2
468 Ga0501084_0003614
469 Ga0501084_0168428
470 Ga0530510_0002997
471 Ga0530510_0003918
472 Ga0530510_0122106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

317

538

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b7i-assembly1.cif.gz_A crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine phosphonic acid 0.7894 306 541
6esl-assembly1.cif.gz_A crystal structure of the legionella pneumoppila lapa 0.7852 308 539
6ica-assembly2.cif.gz_B the crystal structure of legionella pneumophila lapa aminopeptidase 0.7805 306 541
1amp-assembly1.cif.gz_A crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family 0.7745 306 541
6ica-assembly3.cif.gz_C the crystal structure of legionella pneumophila lapa aminopeptidase 0.7679 306 541
ID Description Score Start End Superfamily
1cp6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7914 306 541 3.40.630.10
af_P77357_2_289_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7678 310 390 3.40.630.10
1xjoA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7501 306 537 3.40.630.10
5ib9A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7443 302 547 3.40.630.10
3guxB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7302 306 534 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2V8HUV7-F1-model_v4 Peptidase M28 0.9863 141 560 GO:0006508
GO:0008235
AF-A0A7W1P3I4-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9836 37 561 GO:0006508
GO:0008235
AF-A0A2V8H457-F1-model_v4 Peptidase M28 domain-containing protein 0.9819 386 559
AF-A0A2V8HUV7-F1-model_v4 Peptidase M28 0.9794 141 560 GO:0006508
GO:0008235
AF-A0A2V6FH04-F1-model_v4 Peptidase M28 0.9779 129 560 GO:0006508
GO:0008235

Map