F348394

General Info

Members Datasets Scaffolds Average Seq Length
235 130 470 311

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0004611|Ga0451576_0004611_8547_9587
Length 346
Sequence MILIFLFSILVLVGGSFFVIGFMISAPAHRGEKTDHFDGKKFLNPGNAQAKGLTDVFQWMMQRKQGPWTEKKESAFGKKPESMVTDGIKITFVNHSTFLIQIEGVNILTDPVWSERTSPFEFAGPKRMKPPGVRFDDLPKIDYIILSHNHYDHLDINTVKDLYRIHKPKIITPLGVKAFLKNNQINTATDMDWWQEMSLSDSLMIQCVPAQHFSGRGVFDRDATLWCGYVIKNHHGNIYFAGDTGYNEFTFKEIGKRCAPVSVALIPIGAYKPVWFMSPIHCSPAEAIQIHFDVKASQSIATHFGTFPLADDGEDEPIHELGKALIQSNLPPDRFLILNEGEGKVF

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.4
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 4.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0004611 3300045051 Bacteria 17781
2 Ga0065704_10128786 3300005289 Bacteria 1657
3 Ga0065712_10104379 3300005290 Bacteria 1962
4 Ga0065707_10087506 3300005295 Bacteria 4994
5 Ga0070676_10241115 3300005328 Bacteria 1202
6 Ga0070683_100382533 3300005329 Bacteria 1341
7 Ga0070690_100088701 3300005330 Bacteria 2033
8 Ga0070677_10146900 3300005333 Bacteria 1093
9 Ga0070689_100249067 3300005340 Bacteria 1465
10 Ga0070661_100108552 3300005344 Bacteria 2071
11 Ga0070668_100172410 3300005347 Bacteria 1762
12 Ga0070668_100270953 3300005347 Bacteria 1415
13 Ga0070669_100010405 3300005353 Bacteria 6606
14 Ga0070675_100000435 3300005354 Bacteria 28364
15 Ga0070675_100009481 3300005354 Bacteria 7576
16 Ga0070674_100004507 3300005356 Bacteria 7950
17 Ga0070674_100042563 3300005356 Bacteria 3086
18 Ga0070673_100001897 3300005364 Bacteria 12540
19 Ga0070688_100064966 3300005365 Bacteria 2317
20 Ga0070709_10061500 3300005434 Bacteria 2391
21 Ga0070714_100005079 3300005435 Bacteria 10012
22 Ga0070713_100008820 3300005436 Bacteria 7177
23 Ga0070705_100174003 3300005440 Bacteria 1452
24 Ga0070678_100339080 3300005456 Bacteria 1289
25 Ga0068867_100143410 3300005459 Bacteria 1869
26 Ga0070707_100022049 3300005468 Bacteria 6022
27 Ga0070707_100134205 3300005468 Bacteria 2408
28 Ga0070698_100007242 3300005471 Bacteria 12016
29 Ga0070698_100089579 3300005471 Unclassified 3060
30 Ga0070699_100005414 3300005518 Bacteria 11191
31 Ga0070699_100061864 3300005518 Bacteria 3244
32 Ga0070684_100517124 3300005535 Bacteria 1106
33 Ga0070697_100024101 3300005536 Bacteria 4844
34 Ga0070672_100139714 3300005543 Bacteria 1997
35 Ga0070686_100154579 3300005544 Bacteria 1610
36 Ga0070686_100239216 3300005544 Unclassified 1321
37 Ga0070695_100015410 3300005545 Bacteria 4617
38 Ga0070696_100011594 3300005546 Bacteria 5906
39 Ga0070696_100020820 3300005546 Bacteria 4445
40 Ga0070704_100077743 3300005549 Bacteria 2432
41 Ga0068856_100025304 3300005614 Bacteria 5785
42 Ga0068859_100031536 3300005617 Bacteria 5322
43 Ga0068859_100121494 3300005617 Bacteria 2679
44 Ga0068864_100009977 3300005618 Bacteria 7836
45 Ga0068861_100198938 3300005719 Bacteria 1681
46 Ga0068863_100060729 3300005841 Bacteria 3575
47 Ga0068863_100336187 3300005841 Bacteria 1469
48 Ga0068858_100003337 3300005842 Bacteria 15991
49 Ga0068858_100186042 3300005842 Bacteria 1962
50 Ga0068858_100195985 3300005842 Bacteria 1909
51 Ga0068858_100292442 3300005842 Bacteria 1553
52 Ga0068860_100018029 3300005843 Bacteria 6874
53 Ga0068860_100067282 3300005843 Bacteria 3404
54 Ga0068862_100019252 3300005844 Bacteria 5693
55 Ga0068862_100106258 3300005844 Bacteria 2461
56 Ga0075428_100051478 3300006844 Bacteria 4515
57 Ga0075428_100101547 3300006844 Bacteria 3135
58 Ga0075430_100001954 3300006846 Bacteria 16932
59 Ga0075430_100032306 3300006846 Bacteria 4443
60 Ga0075431_100006404 3300006847 Bacteria 11686
61 Ga0075431_100037026 3300006847 Bacteria 5026
62 Ga0075431_100051195 3300006847 Bacteria 4260
63 Ga0075433_10017436 3300006852 Bacteria 5947
64 Ga0075433_10067679 3300006852 Bacteria 3135
65 Ga0075433_10478047 3300006852 Unclassified 1098
66 Ga0075434_100000156 3300006871 Bacteria 42644
67 Ga0075434_100055626 3300006871 Bacteria 3932
68 Ga0075429_100020489 3300006880 Bacteria 5738
69 Ga0075429_100088820 3300006880 Bacteria 2694
70 Ga0075429_100115952 3300006880 Bacteria 2342
71 Ga0075429_100339469 3300006880 Bacteria 1315
72 Ga0068865_100181064 3300006881 Bacteria 1623
73 Ga0075436_100000066 3300006914 Bacteria 63159
74 Ga0075436_100013689 3300006914 Bacteria 5556
75 Ga0075436_100063298 3300006914 Bacteria 2557
76 Ga0097620_100031536 3300006931 Bacteria 5322
77 Ga0097620_100121497 3300006931 Bacteria 2679
78 Ga0075435_100000022 3300007076 Bacteria 88799
79 Ga0075435_100001923 3300007076 Bacteria 13531
80 Ga0075435_100019042 3300007076 Bacteria 5232
81 Ga0075435_100121721 3300007076 Bacteria 2178
82 Ga0075435_100366653 3300007076 Bacteria 1236
83 Ga0105240_10294739 3300009093 Bacteria 1858
84 Ga0105240_10317349 3300009093 Bacteria 1777
85 Ga0111539_10011473 3300009094 Bacteria 11121
86 Ga0111539_10012672 3300009094 Bacteria 10561
87 Ga0111539_10024756 3300009094 Bacteria 7362
88 Ga0111539_10038027 3300009094 Bacteria 5806
89 Ga0111539_10354313 3300009094 Bacteria 1708
90 Ga0111539_10371428 3300009094 Bacteria 1665
91 Ga0111539_10451302 3300009094 Bacteria 1497
92 Ga0105247_10016871 3300009101 Bacteria 4378
93 Ga0114129_10001781 3300009147 Bacteria 29343
94 Ga0114129_10002567 3300009147 Bacteria 25225
95 Ga0114129_10005391 3300009147 Bacteria 18055
96 Ga0114129_10013998 3300009147 Bacteria 11428
97 Ga0114129_10018544 3300009147 Bacteria 9907
98 Ga0114129_10050776 3300009147 Bacteria 5824
99 Ga0114129_10089141 3300009147 Bacteria 4276
100 Ga0114129_10089591 3300009147 Bacteria 4265
101 Ga0114129_10109647 3300009147 Bacteria 3810
102 Ga0114129_10127885 3300009147 Bacteria 3492
103 Ga0114129_10146003 3300009147 Bacteria 3240
104 Ga0114129_10348163 3300009147 Bacteria 1963
105 Ga0105241_10360079 3300009174 Bacteria 1266
106 Ga0105248_10007843 3300009177 Bacteria 11725
107 Ga0105248_10222467 3300009177 Bacteria 2125
108 Ga0105249_10015789 3300009553 Bacteria 6689
109 Ga0105249_10041215 3300009553 Bacteria 4196
110 Ga0105246_10023814 3300011119 Bacteria 3967
111 Ga0157372_10302347 3300013307 Bacteria 1861
112 Ga0157375_10048590 3300013308 Bacteria 4151
113 Ga0163163_10050804 3300014325 Bacteria 4084
114 Ga0163163_10099790 3300014325 Bacteria 2925
115 Ga0157380_10260214 3300014326 Bacteria 1576
116 Ga0157380_10262572 3300014326 Bacteria 1569
117 Ga0157377_10037675 3300014745 Bacteria 2665
118 Ga0157377_10065364 3300014745 Bacteria 2089
119 Ga0157377_10223084 3300014745 Bacteria 1208
120 Ga0157379_10048377 3300014968 Bacteria 3795
121 Ga0157379_10249363 3300014968 Bacteria 1611
122 Ga0207642_10086592 3300025899 Bacteria 1536
123 Ga0207688_10020248 3300025901 Bacteria 3631
124 Ga0207699_10179807 3300025906 Bacteria 1421
125 Ga0207645_10000691 3300025907 Bacteria 28019
126 Ga0207695_10119523 3300025913 Bacteria 2605
127 Ga0207649_10146564 3300025920 Bacteria 1621
128 Ga0207646_10024082 3300025922 Bacteria 5581
129 Ga0207681_10007769 3300025923 Bacteria 6568
130 Ga0207681_10059351 3300025923 Bacteria 2622
131 Ga0207681_10336995 3300025923 Bacteria 1204
132 Ga0207700_10046105 3300025928 Bacteria 3222
133 Ga0207669_10067945 3300025937 Bacteria 2223
134 Ga0207669_10300267 3300025937 Bacteria 1220
135 Ga0207691_10069688 3300025940 Bacteria 3177
136 Ga0207691_10145761 3300025940 Bacteria 2084
137 Ga0207711_10009182 3300025941 Bacteria 8260
138 Ga0207711_10148873 3300025941 Bacteria 2111
139 Ga0207689_10061750 3300025942 Bacteria 3082
140 Ga0207661_10393608 3300025944 Bacteria 1256
141 Ga0207651_10019223 3300025960 Bacteria 4087
142 Ga0207712_10074252 3300025961 Bacteria 2455
143 Ga0207703_10032454 3300026035 Bacteria 4133
144 Ga0207703_10228210 3300026035 Bacteria 1668
145 Ga0207703_10237975 3300026035 Bacteria 1635
146 Ga0207703_10260793 3300026035 Bacteria 1566
147 Ga0207678_10232517 3300026067 Unclassified 1578
148 Ga0207702_10098675 3300026078 Bacteria 2573
149 Ga0207641_10047221 3300026088 Bacteria 3630
150 Ga0207641_10172813 3300026088 Bacteria 1974
151 Ga0207641_10309330 3300026088 Bacteria 1495
152 Ga0207676_10162864 3300026095 Bacteria 1934
153 Ga0207675_100045689 3300026118 Bacteria 4092
154 Ga0207683_10057960 3300026121 Bacteria 3400
155 Ga0207428_10003423 3300027907 Bacteria 15421
156 Ga0207428_10004668 3300027907 Bacteria 12980
157 Ga0207428_10005545 3300027907 Bacteria 11754
158 Ga0207428_10016412 3300027907 Bacteria 6371
159 Ga0207428_10032200 3300027907 Bacteria 4315
160 Ga0268266_10204132 3300028379 Bacteria 1810
161 Ga0268265_10004265 3300028380 Bacteria 9985
162 Ga0268265_10405789 3300028380 Bacteria 1261
163 Ga0268264_10195008 3300028381 Unclassified 1849
164 Ga0268264_10227066 3300028381 Bacteria 1722
165 Ga0268264_10284887 3300028381 Bacteria 1549
166 Ga0373926_0065844 3300035083 Bacteria 1326
167 Ga0373934_0011779 3300035086 Bacteria 3294
168 Ga0373934_0034618 3300035086 Bacteria 1985
169 Ga0373946_0005071 3300035171 Bacteria 4742
170 Ga0373955_0057988 3300035172 Bacteria 2129
171 Ga0373924_0010597 3300035410 Bacteria 3406
172 Ga0373935_0012410 3300035692 Bacteria 5125
173 Ga0373927_0131069 3300035695 Bacteria 1638
174 Ga0373947_0067999 3300035725 Bacteria 2178
175 Ga0373937_0123987 3300036401 Bacteria 2409
176 Ga0373937_0292688 3300036401 Bacteria 1538
177 Ga0373925_0444397 3300037068 Unclassified 1061
178 Ga0450912_000040 3300042116 Bacteria 4257
179 Ga0453684_0002430 3300044712 Bacteria 45310
180 Ga0495603_0046669 3300046455 Bacteria 2581
181 Ga0495582_0119619 3300046473 Bacteria 1484
182 Ga0495635_0077082 3300046663 Bacteria 2284
183 Ga0495659_0032830 3300046664 Bacteria 1819
184 Ga0495588_0047722 3300046674 Bacteria 2199
185 Ga0495646_0180230 3300046680 Unclassified 1160
186 Ga0495658_0258064 3300046683 Bacteria 1097
187 Ga0495669_0068447 3300046684 Bacteria 1615
188 Ga0495604_0182356 3300047317 Bacteria 1468
189 Ga0495675_0171999 3300047444 Unclassified 1330
190 Ga0496108_0004148 3300048911 Bacteria 11654
191 Ga0496110_0044251 3300048913 Bacteria 3888
192 Ga0496111_0171284 3300048914 Bacteria 1613
193 Ga0496112_0014241 3300048915 Bacteria 7370
194 Ga0496112_0037912 3300048915 Bacteria 4707
195 Ga0496113_0123819 3300048916 Bacteria 2024
196 Ga0496113_0132322 3300048916 Bacteria 1958
197 Ga0496114_0249430 3300048917 Bacteria 1562
198 nmdc:mga05p37_111825_c1 3300050507 Bacteria 3359
199 nmdc:mga05p37_148422_c1 3300050507 Bacteria 2870
200 nmdc:mga05p37_168088_c1 3300050507 Bacteria 2676
201 nmdc:mga05p37_177016_c1 3300050507 Bacteria 2598
202 nmdc:mga05p37_253176_c1 3300050507 Bacteria 2111
203 nmdc:mga05p37_28158_c1 3300050507 Bacteria 6849
204 nmdc:mga05p37_4982_c1 3300050507 Bacteria 15563
205 nmdc:mga05p37_58170_c1 3300050507 Bacteria 4761
206 nmdc:mga05p37_6020_c1 3300050507 Bacteria 14279
207 nmdc:mga05p37_83494_c1 3300050507 Bacteria 3935
208 nmdc:mga09592_161363_c1 3300050508 Bacteria 1937
209 nmdc:mga09592_58438_c1 3300050508 Bacteria 3261
210 nmdc:mga09592_76647_c1 3300050508 Bacteria 2844
211 nmdc:mga0qj67_5614_c1 3300050509 Bacteria 9169
212 nmdc:mga06r32_112632_c1 3300050510 Bacteria 2678
213 nmdc:mga06r32_164596_c1 3300050510 Bacteria 2201
214 nmdc:mga06r32_2581_c1 3300050510 Bacteria 16171
215 nmdc:mga06r32_67709_c1 3300050510 Unclassified 3448
216 nmdc:mga08y16_112020_c1 3300050511 Bacteria 2841
217 nmdc:mga08y16_32653_c1 3300050511 Bacteria 5472
218 nmdc:mga08y16_434_c1 3300050511 Bacteria 38502
219 nmdc:mga08y16_49247_c1 3300050511 Bacteria 4410
220 nmdc:mga08y16_50737_c1 3300050511 Bacteria 4342
221 nmdc:mga0n895_244279_c1 3300050512 Bacteria 1822
222 nmdc:mga0n895_43309_c1 3300050512 Bacteria 4386
223 nmdc:mga0n895_5190_c1 3300050512 Bacteria 10840
224 nmdc:mga0n895_51_c1 3300050512 Bacteria 70034
225 nmdc:mga0rr50_107929_c1 3300050513 Bacteria 2198
226 nmdc:mga0rr50_12_c1 3300050513 Bacteria 215691
227 nmdc:mga0rr50_490731_c1 3300050513 Bacteria 1044
228 nmdc:mga0rr50_54996_c1 3300050513 Bacteria 2968
229 nmdc:mga08x19_245_c1 3300050514 Bacteria 41363
230 nmdc:mga08x19_86758_c1 3300050514 Bacteria 2061
231 nmdc:mga0a205_2310_c1 3300050515 Bacteria 16835
232 nmdc:mga0a205_75839_c1 3300050515 Bacteria 3249
233 nmdc:mga0a205_89178_c1 3300050515 Unclassified 2981
234 Ga0495601_0132979 3300053077 Bacteria 1621
235 Ga0495619_0115880 3300053085 Bacteria 1834
236 Ga0451576_0004611
237 Ga0065704_10128786
238 Ga0065712_10104379
239 Ga0065707_10087506
240 Ga0070676_10241115
241 Ga0070683_100382533
242 Ga0070690_100088701
243 Ga0070677_10146900
244 Ga0070689_100249067
245 Ga0070661_100108552
246 Ga0070668_100172410
247 Ga0070668_100270953
248 Ga0070669_100010405
249 Ga0070675_100000435
250 Ga0070675_100009481
251 Ga0070674_100004507
252 Ga0070674_100042563
253 Ga0070673_100001897
254 Ga0070688_100064966
255 Ga0070709_10061500
256 Ga0070714_100005079
257 Ga0070713_100008820
258 Ga0070705_100174003
259 Ga0070678_100339080
260 Ga0068867_100143410
261 Ga0070707_100022049
262 Ga0070707_100134205
263 Ga0070698_100007242
264 Ga0070698_100089579
265 Ga0070699_100005414
266 Ga0070699_100061864
267 Ga0070684_100517124
268 Ga0070697_100024101
269 Ga0070672_100139714
270 Ga0070686_100154579
271 Ga0070686_100239216
272 Ga0070695_100015410
273 Ga0070696_100011594
274 Ga0070696_100020820
275 Ga0070704_100077743
276 Ga0068856_100025304
277 Ga0068859_100031536
278 Ga0068859_100121494
279 Ga0068864_100009977
280 Ga0068861_100198938
281 Ga0068863_100060729
282 Ga0068863_100336187
283 Ga0068858_100003337
284 Ga0068858_100186042
285 Ga0068858_100195985
286 Ga0068858_100292442
287 Ga0068860_100018029
288 Ga0068860_100067282
289 Ga0068862_100019252
290 Ga0068862_100106258
291 Ga0075428_100051478
292 Ga0075428_100101547
293 Ga0075430_100001954
294 Ga0075430_100032306
295 Ga0075431_100006404
296 Ga0075431_100037026
297 Ga0075431_100051195
298 Ga0075433_10017436
299 Ga0075433_10067679
300 Ga0075433_10478047
301 Ga0075434_100000156
302 Ga0075434_100055626
303 Ga0075429_100020489
304 Ga0075429_100088820
305 Ga0075429_100115952
306 Ga0075429_100339469
307 Ga0068865_100181064
308 Ga0075436_100000066
309 Ga0075436_100013689
310 Ga0075436_100063298
311 Ga0097620_100031536
312 Ga0097620_100121497
313 Ga0075435_100000022
314 Ga0075435_100001923
315 Ga0075435_100019042
316 Ga0075435_100121721
317 Ga0075435_100366653
318 Ga0105240_10294739
319 Ga0105240_10317349
320 Ga0111539_10011473
321 Ga0111539_10012672
322 Ga0111539_10024756
323 Ga0111539_10038027
324 Ga0111539_10354313
325 Ga0111539_10371428
326 Ga0111539_10451302
327 Ga0105247_10016871
328 Ga0114129_10001781
329 Ga0114129_10002567
330 Ga0114129_10005391
331 Ga0114129_10013998
332 Ga0114129_10018544
333 Ga0114129_10050776
334 Ga0114129_10089141
335 Ga0114129_10089591
336 Ga0114129_10109647
337 Ga0114129_10127885
338 Ga0114129_10146003
339 Ga0114129_10348163
340 Ga0105241_10360079
341 Ga0105248_10007843
342 Ga0105248_10222467
343 Ga0105249_10015789
344 Ga0105249_10041215
345 Ga0105246_10023814
346 Ga0157372_10302347
347 Ga0157375_10048590
348 Ga0163163_10050804
349 Ga0163163_10099790
350 Ga0157380_10260214
351 Ga0157380_10262572
352 Ga0157377_10037675
353 Ga0157377_10065364
354 Ga0157377_10223084
355 Ga0157379_10048377
356 Ga0157379_10249363
357 Ga0207642_10086592
358 Ga0207688_10020248
359 Ga0207699_10179807
360 Ga0207645_10000691
361 Ga0207695_10119523
362 Ga0207649_10146564
363 Ga0207646_10024082
364 Ga0207681_10007769
365 Ga0207681_10059351
366 Ga0207681_10336995
367 Ga0207700_10046105
368 Ga0207669_10067945
369 Ga0207669_10300267
370 Ga0207691_10069688
371 Ga0207691_10145761
372 Ga0207711_10009182
373 Ga0207711_10148873
374 Ga0207689_10061750
375 Ga0207661_10393608
376 Ga0207651_10019223
377 Ga0207712_10074252
378 Ga0207703_10032454
379 Ga0207703_10228210
380 Ga0207703_10237975
381 Ga0207703_10260793
382 Ga0207678_10232517
383 Ga0207702_10098675
384 Ga0207641_10047221
385 Ga0207641_10172813
386 Ga0207641_10309330
387 Ga0207676_10162864
388 Ga0207675_100045689
389 Ga0207683_10057960
390 Ga0207428_10003423
391 Ga0207428_10004668
392 Ga0207428_10005545
393 Ga0207428_10016412
394 Ga0207428_10032200
395 Ga0268266_10204132
396 Ga0268265_10004265
397 Ga0268265_10405789
398 Ga0268264_10195008
399 Ga0268264_10227066
400 Ga0268264_10284887
401 Ga0373926_0065844
402 Ga0373934_0011779
403 Ga0373934_0034618
404 Ga0373946_0005071
405 Ga0373955_0057988
406 Ga0373924_0010597
407 Ga0373935_0012410
408 Ga0373927_0131069
409 Ga0373947_0067999
410 Ga0373937_0123987
411 Ga0373937_0292688
412 Ga0373925_0444397
413 Ga0450912_000040
414 Ga0453684_0002430
415 Ga0495603_0046669
416 Ga0495582_0119619
417 Ga0495635_0077082
418 Ga0495659_0032830
419 Ga0495588_0047722
420 Ga0495646_0180230
421 Ga0495658_0258064
422 Ga0495669_0068447
423 Ga0495604_0182356
424 Ga0495675_0171999
425 Ga0496108_0004148
426 Ga0496110_0044251
427 Ga0496111_0171284
428 Ga0496112_0014241
429 Ga0496112_0037912
430 Ga0496113_0123819
431 Ga0496113_0132322
432 Ga0496114_0249430
433 nmdc:mga05p37_111825_c1
434 nmdc:mga05p37_148422_c1
435 nmdc:mga05p37_168088_c1
436 nmdc:mga05p37_177016_c1
437 nmdc:mga05p37_253176_c1
438 nmdc:mga05p37_28158_c1
439 nmdc:mga05p37_4982_c1
440 nmdc:mga05p37_58170_c1
441 nmdc:mga05p37_6020_c1
442 nmdc:mga05p37_83494_c1
443 nmdc:mga09592_161363_c1
444 nmdc:mga09592_58438_c1
445 nmdc:mga09592_76647_c1
446 nmdc:mga0qj67_5614_c1
447 nmdc:mga06r32_112632_c1
448 nmdc:mga06r32_164596_c1
449 nmdc:mga06r32_2581_c1
450 nmdc:mga06r32_67709_c1
451 nmdc:mga08y16_112020_c1
452 nmdc:mga08y16_32653_c1
453 nmdc:mga08y16_434_c1
454 nmdc:mga08y16_49247_c1
455 nmdc:mga08y16_50737_c1
456 nmdc:mga0n895_244279_c1
457 nmdc:mga0n895_43309_c1
458 nmdc:mga0n895_5190_c1
459 nmdc:mga0n895_51_c1
460 nmdc:mga0rr50_107929_c1
461 nmdc:mga0rr50_12_c1
462 nmdc:mga0rr50_490731_c1
463 nmdc:mga0rr50_54996_c1
464 nmdc:mga08x19_245_c1
465 nmdc:mga08x19_86758_c1
466 nmdc:mga0a205_2310_c1
467 nmdc:mga0a205_75839_c1
468 nmdc:mga0a205_89178_c1
469 Ga0495601_0132979
470 Ga0495619_0115880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

90

188

0.92

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

105

304

0.92

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

89

303

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qn9-assembly1.cif.gz_A structure of human nape-pld 0.9327 17 285
4qn9-assembly1.cif.gz_A structure of human nape-pld 0.8795 17 285
3kl7-assembly1.cif.gz_A crystal structure of putative metal-dependent hydrolase (yp_001302908.1) from parabacteroides distasonis atcc 8503 at 2.30 a resolution 0.8558 28 275
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8458 28 284
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.8412 28 284
ID Description Score Start End Superfamily
af_Q8BH82_99_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9438 28 284 3.60.15.10
af_A4HVR7_83_395_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9239 24 274 3.60.15.10
af_Q8ILT3_120_417_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.916 3 284 3.60.15.10
af_Q55BC7_55_359_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9141 16 284 3.60.15.10
af_Q8ILT3_120_417_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9038 3 284 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2V8AT20-F1-model_v4 Hydrolase 0.9663 1 285 GO:0005737
GO:0008270
GO:0070290
AF-A0A2V8AT20-F1-model_v4 Hydrolase 0.9629 1 285 GO:0005737
GO:0008270
GO:0070290
AF-A0A1E5D043-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9592 173 280 GO:0005737
AF-A0A2D6BDR6-F1-model_v4 deleted 0.954 173 285
AF-A0A284VIT3-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9493 28 282 GO:0005737
GO:0008270
GO:0070290

Map