F348385

General Info

Members Datasets Scaffolds Average Seq Length
235 131 470 225

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_1016786|Ga0453684_1016786_94_807
Length 237
Sequence MLKFVVVEEEGFMRVLIVEDNRSLNQSLRMSLEDDGYAVDSAFDGNEGEYLAKVTPYDLMVLDIMLPGKNGIQVCKDLRQEGNRTPVLMLTARDTIEDRVVGLDSGADDYLVKPFALPELRARLRALLRRNAPEKSSVIQVADMFLDPATHQVTRAGQPIELTSKEYALLEYFMRNPNRLITREMAEEHVWDYDFEGSSNVIDVYIRRLRRKIDDPYEPKLLETVRGAGYRLLKSAE

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
40 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
73 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.81
Rhizosphere 86.81
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_1016786 3300044712 Bacteria 880
2 rootH2_10039350 3300003320 Bacteria 2455
3 Ga0070683_100047300 3300005329 Bacteria 3975
4 Ga0070683_100052336 3300005329 Bacteria 3782
5 Ga0070683_100056335 3300005329 Bacteria 3650
6 Ga0070683_100075098 3300005329 Bacteria 3158
7 Ga0070690_100599391 3300005330 Bacteria 836
8 Ga0070680_100317041 3300005336 Bacteria 1323
9 Ga0070691_10002891 3300005341 Bacteria 7697
10 Ga0070691_10003794 3300005341 Bacteria 6821
11 Ga0070691_10017354 3300005341 Bacteria 3312
12 Ga0070661_100015494 3300005344 Bacteria 5380
13 Ga0070714_100176438 3300005435 Bacteria 1942
14 Ga0070713_100008239 3300005436 Bacteria 7388
15 Ga0070663_100109820 3300005455 Bacteria 2071
16 Ga0070681_10573401 3300005458 Bacteria 1042
17 Ga0070679_100044006 3300005530 Bacteria 4447
18 Ga0070679_100310467 3300005530 Bacteria 1527
19 Ga0070679_100511302 3300005530 Bacteria 1145
20 Ga0070684_100001203 3300005535 Bacteria 18595
21 Ga0070684_100143891 3300005535 Bacteria 2157
22 Ga0070697_100194091 3300005536 Bacteria 1724
23 Ga0068855_100003983 3300005563 Bacteria 18036
24 Ga0068855_100009583 3300005563 Bacteria 11685
25 Ga0070664_100513084 3300005564 Bacteria 1106
26 Ga0068857_100011072 3300005577 Bacteria 7847
27 Ga0068857_100431278 3300005577 Bacteria 1230
28 Ga0068857_100704927 3300005577 Bacteria 959
29 Ga0068854_100000049 3300005578 Bacteria 87658
30 Ga0068856_100008007 3300005614 Bacteria 10318
31 Ga0068856_100027482 3300005614 Bacteria 5551
32 Ga0068856_100389120 3300005614 Bacteria 1414
33 Ga0068856_100481378 3300005614 Bacteria 1262
34 Ga0070702_100516851 3300005615 Bacteria 880
35 Ga0068861_100001990 3300005719 Bacteria 13206
36 Ga0081455_10016617 3300005937 Bacteria 7094
37 Ga0075428_100231552 3300006844 Bacteria 1994
38 Ga0075431_100826025 3300006847 Bacteria 899
39 Ga0105240_10277164 3300009093 Bacteria 1928
40 Ga0105240_10348331 3300009093 Bacteria 1681
41 Ga0111539_10034264 3300009094 Bacteria 6160
42 Ga0105243_10847830 3300009148 Bacteria 905
43 Ga0105248_10224330 3300009177 Bacteria 2115
44 Ga0105237_10111985 3300009545 Bacteria 2721
45 Ga0157374_10028946 3300013296 Bacteria 5008
46 Ga0157377_10168068 3300014745 Bacteria 1369
47 Ga0197907_10275285 3300020069 Bacteria 2046
48 Ga0206356_11865325 3300020070 Bacteria 16821
49 Ga0213873_10000111 3300021358 Bacteria 15867
50 Ga0213873_10041059 3300021358 Bacteria 1192
51 Ga0213872_10016384 3300021361 Bacteria 3440
52 Ga0213872_10078287 3300021361 Bacteria 1486
53 Ga0213874_10000106 3300021377 Bacteria 13630
54 Ga0213876_10006186 3300021384 Bacteria 6531
55 Ga0213875_10000001 3300021388 Bacteria 2793540
56 Ga0213871_10085996 3300021441 Bacteria 906
57 Ga0224712_10001243 3300022467 Bacteria 5749
58 Ga0207688_10164068 3300025901 Bacteria 1318
59 Ga0207707_10790213 3300025912 Bacteria 791
60 Ga0207695_10216482 3300025913 Bacteria 1824
61 Ga0207693_10037859 3300025915 Bacteria 3801
62 Ga0207693_10361115 3300025915 Bacteria 1136
63 Ga0207649_10043330 3300025920 Bacteria 2751
64 Ga0207652_10122778 3300025921 Bacteria 2312
65 Ga0207652_10421615 3300025921 Bacteria 1203
66 Ga0207694_10880851 3300025924 Bacteria 757
67 Ga0207700_10004558 3300025928 Bacteria 8192
68 Ga0207700_10344396 3300025928 Unclassified 1297
69 Ga0207700_10595178 3300025928 Bacteria 984
70 Ga0207664_10036325 3300025929 Bacteria 3808
71 Ga0207661_10010618 3300025944 Bacteria 6636
72 Ga0207661_10043967 3300025944 Bacteria 3527
73 Ga0207661_10113684 3300025944 Bacteria 2294
74 Ga0207661_10125496 3300025944 Bacteria 2191
75 Ga0207661_10349393 3300025944 Bacteria 1334
76 Ga0207667_10000149 3300025949 Bacteria 104305
77 Ga0207667_10001047 3300025949 Bacteria 35210
78 Ga0207640_10000008 3300025981 Bacteria 290578
79 Ga0207639_10102470 3300026041 Bacteria 2317
80 Ga0207639_10401754 3300026041 Bacteria 1234
81 Ga0207678_10201837 3300026067 Bacteria 1700
82 Ga0207678_10255415 3300026067 Bacteria 1501
83 Ga0207702_10020192 3300026078 Bacteria 5518
84 Ga0207702_10068833 3300026078 Bacteria 3041
85 Ga0207702_10330172 3300026078 Bacteria 1455
86 Ga0207674_10004258 3300026116 Bacteria 17260
87 Ga0207674_10009869 3300026116 Bacteria 10863
88 Ga0207674_10644685 3300026116 Bacteria 1023
89 Ga0207675_100004729 3300026118 Bacteria 13111
90 Ga0207428_10056427 3300027907 Bacteria 3121
91 Ga0265334_10025978 3300028573 Unclassified 2367
92 Ga0265323_10040509 3300028653 Bacteria 1694
93 Ga0265323_10057814 3300028653 Bacteria 1356
94 Ga0265322_10047215 3300028654 Bacteria 1224
95 Ga0265338_10215368 3300028800 Bacteria 1438
96 Ga0265320_10042444 3300031240 Bacteria 2256
97 Ga0265325_10066276 3300031241 Bacteria 1821
98 Ga0265325_10072067 3300031241 Bacteria 1732
99 Ga0265340_10009786 3300031247 Bacteria 5139
100 Ga0265340_10042537 3300031247 Bacteria 2230
101 Ga0265339_10142698 3300031249 Unclassified 1217
102 Ga0265331_10006404 3300031250 Bacteria 6965
103 Ga0265316_10041529 3300031344 Unclassified 3681
104 Ga0307513_10281847 3300031456 Bacteria 1439
105 Ga0316579_10007647 3300031691 Bacteria 4472
106 Ga0316579_10126021 3300031691 Bacteria 1232
107 Ga0316579_10176234 3300031691 Bacteria 1033
108 Ga0265342_10011280 3300031712 Bacteria 6126
109 Ga0316577_10484575 3300031733 Bacteria 703
110 Ga0373953_0070528 3300035117 Bacteria 1441
111 Ga0373933_0310410 3300035724 Bacteria 1022
112 Ga0373937_0311522 3300036401 Bacteria 1489
113 Ga0316582_0028013 3300036647 Bacteria 3410
114 Ga0316582_0034637 3300036647 Bacteria 3111
115 Ga0316582_0083347 3300036647 Bacteria 2092
116 Ga0316584_0085116 3300036712 Bacteria 2367
117 Ga0395898_0070535 3300037466 Bacteria 3378
118 Ga0395898_0238846 3300037466 Bacteria 1733
119 Ga0316581_0004395 3300037588 Bacteria 3594
120 Ga0436364_0273345 3300037853 Bacteria 2794207
121 Ga0436364_1014899 3300037853 Bacteria 1425
122 Ga0436364_1079281 3300037853 Bacteria 994
123 Ga0436364_1119573 3300037853 Bacteria 7213
124 Ga0436365_0562130 3300039437 Bacteria 3088
125 Ga0436365_1268702 3300039437 Bacteria 893
126 Ga0436365_1695035 3300039437 Bacteria 137591
127 Ga0436360_0494164 3300039438 Bacteria 1681
128 Ga0436360_0834072 3300039438 Bacteria 1122
129 Ga0436360_0898329 3300039438 Bacteria 977
130 Ga0436361_0144032 3300039447 Bacteria 685
131 Ga0436361_0271861 3300039447 Bacteria 5654
132 Ga0436361_0404476 3300039447 Bacteria 2377
133 Ga0436361_0440518 3300039447 Unclassified 5225
134 Ga0436361_0443364 3300039447 Bacteria 1850
135 Ga0436361_0766883 3300039447 Bacteria 2678
136 Ga0436361_0985182 3300039447 Bacteria 860
137 Ga0436361_1016108 3300039447 Bacteria 1100
138 Ga0436363_0246724 3300039450 Bacteria 56776
139 Ga0436363_1385974 3300039450 Bacteria 2910
140 Ga0436362_0203546 3300039453 Bacteria 36636
141 Ga0436362_0405261 3300039453 Bacteria 1345
142 Ga0436362_0695547 3300039453 Bacteria 8887
143 Ga0436362_0867521 3300039453 Bacteria 8201
144 Ga0451577_0004873 3300042876 Bacteria 13986
145 Ga0451577_0068734 3300042876 Bacteria 3159
146 Ga0451577_0171414 3300042876 Bacteria 1955
147 Ga0451577_0347781 3300042876 Bacteria 1345
148 Ga0451577_0458385 3300042876 Bacteria 1158
149 Ga0451577_0554745 3300042876 Bacteria 1043
150 Ga0451577_0892939 3300042876 Bacteria 800
151 Ga0466969_0071771 3300044656 Bacteria 1664
152 Ga0453683_0047072 3300044673 Bacteria 2703
153 Ga0453683_0055406 3300044673 Bacteria 2482
154 Ga0453683_0062239 3300044673 Bacteria 2333
155 Ga0453683_0078820 3300044673 Bacteria 2063
156 Ga0453683_0429569 3300044673 Bacteria 853
157 Ga0466966_0212301 3300044684 Bacteria 1169
158 Ga0466963_0097230 3300044694 Bacteria 2012
159 Ga0466963_0261654 3300044694 Bacteria 1215
160 Ga0466963_0376186 3300044694 Bacteria 1001
161 Ga0453684_0000232 3300044712 Bacteria 240951
162 Ga0453684_0002913 3300044712 Bacteria 40117
163 Ga0453684_0004178 3300044712 Bacteria 31101
164 Ga0453684_0029528 3300044712 Bacteria 7781
165 Ga0453684_0041078 3300044712 Bacteria 6263
166 Ga0453684_0067363 3300044712 Bacteria 4553
167 Ga0453684_0139400 3300044712 Bacteria 2899
168 Ga0453684_0149297 3300044712 Bacteria 2780
169 Ga0453684_0183060 3300044712 Bacteria 2458
170 Ga0453684_0222274 3300044712 Bacteria 2187
171 Ga0453684_0315713 3300044712 Bacteria 1771
172 Ga0453684_0324088 3300044712 Bacteria 1744
173 Ga0453684_0371455 3300044712 Bacteria 1608
174 Ga0453684_0376547 3300044712 Bacteria 1595
175 Ga0453684_0468905 3300044712 Bacteria 1399
176 Ga0453684_0472285 3300044712 Bacteria 1393
177 Ga0453684_0528226 3300044712 Bacteria 1303
178 Ga0453684_0805138 3300044712 Bacteria 1013
179 Ga0453684_0859134 3300044712 Bacteria 974
180 Ga0453684_1179461 3300044712 Bacteria 805
181 Ga0466957_0027112 3300044842 Bacteria 3403
182 Ga0466959_0108560 3300045049 Bacteria 1982
183 Ga0451576_0000045 3300045051 Bacteria 334210
184 Ga0451576_0004404 3300045051 Bacteria 18329
185 Ga0451576_1062291 3300045051 Bacteria 848
186 Ga0466967_0323411 3300045976 Bacteria 1488
187 Ga0466967_0961597 3300045976 Bacteria 850
188 Ga0495674_0388639 3300047319 Bacteria 1128
189 Ga0495684_0524454 3300047471 Bacteria 811
190 Ga0496101_0069327 3300048904 Bacteria 2580
191 Ga0496102_0740338 3300048905 Bacteria 906
192 Ga0496104_0037185 3300048907 Bacteria 4553
193 Ga0496104_0049539 3300048907 Bacteria 3961
194 Ga0496105_0088822 3300048908 Bacteria 2553
195 Ga0496107_0138132 3300048910 Bacteria 1801
196 Ga0496108_0469122 3300048911 Bacteria 1100
197 Ga0496109_0005929 3300048912 Bacteria 10251
198 Ga0496109_0625180 3300048912 Bacteria 1013
199 Ga0496110_0463707 3300048913 Bacteria 1154
200 Ga0496111_0116000 3300048914 Bacteria 1975
201 Ga0496112_0130033 3300048915 Bacteria 2489
202 Ga0496112_0160861 3300048915 Bacteria 2212
203 Ga0496112_0162661 3300048915 Bacteria 2198
204 Ga0496112_0284672 3300048915 Bacteria 1599
205 Ga0496113_0093585 3300048916 Bacteria 2320
206 Ga0496125_0024024 3300048928 Bacteria 5614
207 Ga0501033_0149598 3300049570 Bacteria 1685
208 Ga0501036_0352195 3300049572 Bacteria 1229
209 Ga0501036_0514905 3300049572 Bacteria 995
210 Ga0501037_0003142 3300049573 Bacteria 11991
211 Ga0501039_0257261 3300049575 Bacteria 1372
212 Ga0501039_0456443 3300049575 Bacteria 1004
213 Ga0501040_0034478 3300049576 Bacteria 3428
214 Ga0501042_0004057 3300049578 Bacteria 9287
215 Ga0501043_0043912 3300049579 Bacteria 3514
216 Ga0501046_0104401 3300049580 Bacteria 2172
217 Ga0501047_0094477 3300049581 Bacteria 2869
218 Ga0501047_0378935 3300049581 Bacteria 1249
219 Ga0501070_0111550 3300049586 Bacteria 2261
220 Ga0501070_0183277 3300049586 Bacteria 1723
221 Ga0501072_0082738 3300049588 Bacteria 2544
222 Ga0501075_0010646 3300049591 Bacteria 6471
223 Ga0501077_0015131 3300049593 Bacteria 4851
224 Ga0501079_0016704 3300049741 Bacteria 5605
225 Ga0501081_0511146 3300049743 Bacteria 896
226 Ga0501035_0387483 3300049822 Bacteria 1165
227 Ga0501044_0007625 3300049823 Bacteria 11901
228 Ga0501044_0157245 3300049823 Bacteria 2252
229 Ga0501045_0017549 3300049824 Bacteria 5082
230 Ga0501045_0093882 3300049824 Bacteria 2219
231 nmdc:mga08y16_114484_c1 3300050511 Bacteria 2808
232 Ga0495601_0103854 3300053077 Bacteria 1837
233 Ga0495619_0418721 3300053085 Bacteria 924
234 Ga0501084_0195114 3300054114 Bacteria 1708
235 Ga0501082_0142578 3300060353 Bacteria 2080
236 Ga0453684_1016786
237 rootH2_10039350
238 Ga0070683_100047300
239 Ga0070683_100052336
240 Ga0070683_100056335
241 Ga0070683_100075098
242 Ga0070690_100599391
243 Ga0070680_100317041
244 Ga0070691_10002891
245 Ga0070691_10003794
246 Ga0070691_10017354
247 Ga0070661_100015494
248 Ga0070714_100176438
249 Ga0070713_100008239
250 Ga0070663_100109820
251 Ga0070681_10573401
252 Ga0070679_100044006
253 Ga0070679_100310467
254 Ga0070679_100511302
255 Ga0070684_100001203
256 Ga0070684_100143891
257 Ga0070697_100194091
258 Ga0068855_100003983
259 Ga0068855_100009583
260 Ga0070664_100513084
261 Ga0068857_100011072
262 Ga0068857_100431278
263 Ga0068857_100704927
264 Ga0068854_100000049
265 Ga0068856_100008007
266 Ga0068856_100027482
267 Ga0068856_100389120
268 Ga0068856_100481378
269 Ga0070702_100516851
270 Ga0068861_100001990
271 Ga0081455_10016617
272 Ga0075428_100231552
273 Ga0075431_100826025
274 Ga0105240_10277164
275 Ga0105240_10348331
276 Ga0111539_10034264
277 Ga0105243_10847830
278 Ga0105248_10224330
279 Ga0105237_10111985
280 Ga0157374_10028946
281 Ga0157377_10168068
282 Ga0197907_10275285
283 Ga0206356_11865325
284 Ga0213873_10000111
285 Ga0213873_10041059
286 Ga0213872_10016384
287 Ga0213872_10078287
288 Ga0213874_10000106
289 Ga0213876_10006186
290 Ga0213875_10000001
291 Ga0213871_10085996
292 Ga0224712_10001243
293 Ga0207688_10164068
294 Ga0207707_10790213
295 Ga0207695_10216482
296 Ga0207693_10037859
297 Ga0207693_10361115
298 Ga0207649_10043330
299 Ga0207652_10122778
300 Ga0207652_10421615
301 Ga0207694_10880851
302 Ga0207700_10004558
303 Ga0207700_10344396
304 Ga0207700_10595178
305 Ga0207664_10036325
306 Ga0207661_10010618
307 Ga0207661_10043967
308 Ga0207661_10113684
309 Ga0207661_10125496
310 Ga0207661_10349393
311 Ga0207667_10000149
312 Ga0207667_10001047
313 Ga0207640_10000008
314 Ga0207639_10102470
315 Ga0207639_10401754
316 Ga0207678_10201837
317 Ga0207678_10255415
318 Ga0207702_10020192
319 Ga0207702_10068833
320 Ga0207702_10330172
321 Ga0207674_10004258
322 Ga0207674_10009869
323 Ga0207674_10644685
324 Ga0207675_100004729
325 Ga0207428_10056427
326 Ga0265334_10025978
327 Ga0265323_10040509
328 Ga0265323_10057814
329 Ga0265322_10047215
330 Ga0265338_10215368
331 Ga0265320_10042444
332 Ga0265325_10066276
333 Ga0265325_10072067
334 Ga0265340_10009786
335 Ga0265340_10042537
336 Ga0265339_10142698
337 Ga0265331_10006404
338 Ga0265316_10041529
339 Ga0307513_10281847
340 Ga0316579_10007647
341 Ga0316579_10126021
342 Ga0316579_10176234
343 Ga0265342_10011280
344 Ga0316577_10484575
345 Ga0373953_0070528
346 Ga0373933_0310410
347 Ga0373937_0311522
348 Ga0316582_0028013
349 Ga0316582_0034637
350 Ga0316582_0083347
351 Ga0316584_0085116
352 Ga0395898_0070535
353 Ga0395898_0238846
354 Ga0316581_0004395
355 Ga0436364_0273345
356 Ga0436364_1014899
357 Ga0436364_1079281
358 Ga0436364_1119573
359 Ga0436365_0562130
360 Ga0436365_1268702
361 Ga0436365_1695035
362 Ga0436360_0494164
363 Ga0436360_0834072
364 Ga0436360_0898329
365 Ga0436361_0144032
366 Ga0436361_0271861
367 Ga0436361_0404476
368 Ga0436361_0440518
369 Ga0436361_0443364
370 Ga0436361_0766883
371 Ga0436361_0985182
372 Ga0436361_1016108
373 Ga0436363_0246724
374 Ga0436363_1385974
375 Ga0436362_0203546
376 Ga0436362_0405261
377 Ga0436362_0695547
378 Ga0436362_0867521
379 Ga0451577_0004873
380 Ga0451577_0068734
381 Ga0451577_0171414
382 Ga0451577_0347781
383 Ga0451577_0458385
384 Ga0451577_0554745
385 Ga0451577_0892939
386 Ga0466969_0071771
387 Ga0453683_0047072
388 Ga0453683_0055406
389 Ga0453683_0062239
390 Ga0453683_0078820
391 Ga0453683_0429569
392 Ga0466966_0212301
393 Ga0466963_0097230
394 Ga0466963_0261654
395 Ga0466963_0376186
396 Ga0453684_0000232
397 Ga0453684_0002913
398 Ga0453684_0004178
399 Ga0453684_0029528
400 Ga0453684_0041078
401 Ga0453684_0067363
402 Ga0453684_0139400
403 Ga0453684_0149297
404 Ga0453684_0183060
405 Ga0453684_0222274
406 Ga0453684_0315713
407 Ga0453684_0324088
408 Ga0453684_0371455
409 Ga0453684_0376547
410 Ga0453684_0468905
411 Ga0453684_0472285
412 Ga0453684_0528226
413 Ga0453684_0805138
414 Ga0453684_0859134
415 Ga0453684_1179461
416 Ga0466957_0027112
417 Ga0466959_0108560
418 Ga0451576_0000045
419 Ga0451576_0004404
420 Ga0451576_1062291
421 Ga0466967_0323411
422 Ga0466967_0961597
423 Ga0495674_0388639
424 Ga0495684_0524454
425 Ga0496101_0069327
426 Ga0496102_0740338
427 Ga0496104_0037185
428 Ga0496104_0049539
429 Ga0496105_0088822
430 Ga0496107_0138132
431 Ga0496108_0469122
432 Ga0496109_0005929
433 Ga0496109_0625180
434 Ga0496110_0463707
435 Ga0496111_0116000
436 Ga0496112_0130033
437 Ga0496112_0160861
438 Ga0496112_0162661
439 Ga0496112_0284672
440 Ga0496113_0093585
441 Ga0496125_0024024
442 Ga0501033_0149598
443 Ga0501036_0352195
444 Ga0501036_0514905
445 Ga0501037_0003142
446 Ga0501039_0257261
447 Ga0501039_0456443
448 Ga0501040_0034478
449 Ga0501042_0004057
450 Ga0501043_0043912
451 Ga0501046_0104401
452 Ga0501047_0094477
453 Ga0501047_0378935
454 Ga0501070_0111550
455 Ga0501070_0183277
456 Ga0501072_0082738
457 Ga0501075_0010646
458 Ga0501077_0015131
459 Ga0501079_0016704
460 Ga0501081_0511146
461 Ga0501035_0387483
462 Ga0501044_0007625
463 Ga0501044_0157245
464 Ga0501045_0017549
465 Ga0501045_0093882
466 nmdc:mga08y16_114484_c1
467 Ga0495601_0103854
468 Ga0495619_0418721
469 Ga0501084_0195114
470 Ga0501082_0142578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

15

125

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

157

232

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9842 1 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9822 1 119
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9814 1 119
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9769 2 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.974 1 119
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9988 1 80 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9851 1 80 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9834 2 119 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9824 1 80 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9814 1 77 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2H6GJT0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9832 2 118 GO:0000155
GO:0005524
AF-A0A7X8BZ15-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.983 2 118 GO:0000155
AF-A0A7C1ETQ0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9828 2 118 GO:0000155
AF-A0A7C1Q4C2-F1-model_v4 deleted 0.9802 1 111
AF-A0A7G9YH64-F1-model_v4 Sensor histidine kinase RcsC (EC 2.7.13.3) 0.9797 1 118 GO:0000155
GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map