F348367

General Info

Members Datasets Scaffolds Average Seq Length
235 164 223 139

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0013517|Ga0451577_0013517_850_1302
Length 150
Sequence MATSLQFHKRFAGILPALALFGASQVHAANADDAKGLWITAQKDAVIEFKICPDRPGALCGQIVWDKDAGTPADTCGVRIAQLDKYNQDKEAWRDGWIYDPRDKKTYKGVIRVKDKTLNMRAYIGVEVLGETEELFHVDAMPATPVCKAR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
71 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
84 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
85 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
86 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
87 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
88 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
91 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
92 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
93 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
94 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
95 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
96 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
97 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
103 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
104 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
105 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
106 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
107 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
125 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
126 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
127 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
128 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
129 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
130 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
131 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
132 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
133 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
134 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
135 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
136 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
147 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
148 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
149 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
150 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
151 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
152 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
153 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
159 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
160 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
161 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
162 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
163 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
164 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.89
Metatranscriptomes 0
Isolates 5.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.49
Nodule 0
Rhizoplane 3.83
Rhizosphere 39.57
Stem 0
Stem Tuber 0
Unclassified 25.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000726 3300001979 Bacteria 14365
2 JGI25150J39212_1000148 3300002774 Bacteria 39765
3 JGI25151J46595_10000484 3300003187 Bacteria 37639
4 JGI25153J46596_10002611 3300003215 Bacteria 10306
5 JGI25153J46596_10007686 3300003215 Bacteria 5254
6 rootH1_10001291 3300003316 Bacteria 29451
7 rootH1_10135831 3300003316 Bacteria 1888
8 rootL2_10000467 3300003322 Bacteria 50803
9 rootL2_10210459 3300003322 Bacteria 4272
10 rootH1_10301204 3300003323 Bacteria 1087
11 Ga0055524_1000671 3300003775 Bacteria 23984
12 Ga0055530_10007766 3300003791 Bacteria 4444
13 Ga0058692_1000020 3300003856 Bacteria 250589
14 Ga0065165_1005360 3300005262 Bacteria 7267
15 Ga0070666_10942732 3300005335 Bacteria 639
16 Ga0070687_100453977 3300005343 Bacteria 853
17 Ga0070671_100469233 3300005355 Bacteria 1081
18 Ga0070667_100331158 3300005367 Bacteria 1376
19 Ga0068867_100000552 3300005459 Bacteria 24723
20 Ga0070706_100314856 3300005467 Bacteria 1460
21 Ga0068854_101405698 3300005578 Bacteria 631
22 Ga0068852_100047705 3300005616 Bacteria 3656
23 Ga0068859_101896453 3300005617 Bacteria 658
24 Ga0068861_100603197 3300005719 Bacteria 1008
25 Ga0075365_10324551 3300006038 Bacteria 1084
26 Ga0075368_10056057 3300006042 Bacteria 1572
27 Ga0075363_100019445 3300006048 Bacteria 3397
28 Ga0075363_100079490 3300006048 Bacteria 1792
29 Ga0075364_11054972 3300006051 Bacteria 552
30 Ga0075432_10474952 3300006058 Bacteria 553
31 Ga0075362_10007150 3300006177 Bacteria 4209
32 Ga0075362_10413315 3300006177 Bacteria 682
33 Ga0075367_10054805 3300006178 Bacteria 2365
34 Ga0075367_10139848 3300006178 Bacteria 1500
35 Ga0075367_10689179 3300006178 Bacteria 650
36 Ga0075366_10014269 3300006195 Bacteria 4537
37 Ga0075366_10026653 3300006195 Bacteria 3386
38 Ga0075366_10173751 3300006195 Bacteria 1308
39 Ga0097621_100521839 3300006237 Bacteria 1078
40 Ga0075370_10006467 3300006353 Bacteria 5897
41 Ga0097620_101895585 3300006931 Bacteria 658
42 Ga0114129_12320663 3300009147 Bacteria 644
43 Ga0105243_10000697 3300009148 Bacteria 32602
44 Ga0105243_10017417 3300009148 Bacteria 5431
45 Ga0105237_10095895 3300009545 Bacteria 2956
46 Ga0157378_10142088 3300013297 Bacteria 2230
47 Ga0163163_10813685 3300014325 Bacteria 998
48 Ga0157379_10309009 3300014968 Bacteria 1442
49 Ga0182005_1015688 3300015265 Bacteria 2111
50 Ga0207425_1000241 3300025245 Bacteria 42565
51 Ga0209129_1000320 3300025258 Bacteria 42469
52 Ga0209129_1000651 3300025258 Bacteria 23242
53 Ga0209129_1018364 3300025258 Bacteria 1345
54 Ga0209673_1010119 3300025273 Bacteria 4005
55 Ga0209025_1000207 3300025294 Bacteria 140774
56 Ga0209758_1000078 3300025297 Bacteria 266153
57 Ga0209758_1000848 3300025297 Bacteria 42565
58 Ga0209050_1002477 3300025298 Bacteria 15691
59 Ga0209256_1001155 3300025299 Bacteria 29900
60 Ga0209257_1076190 3300025304 Bacteria 872
61 Ga0207684_10311806 3300025910 Bacteria 1356
62 Ga0207671_10093825 3300025914 Bacteria 2264
63 Ga0207671_10406187 3300025914 Bacteria 1083
64 Ga0207662_10370011 3300025918 Bacteria 966
65 Ga0207644_10509084 3300025931 Bacteria 994
66 Ga0207709_10005144 3300025935 Bacteria 7462
67 Ga0207709_10012997 3300025935 Bacteria 4590
68 Ga0207689_10021594 3300025942 Bacteria 5412
69 Ga0207658_10350453 3300025986 Bacteria 1285
70 Ga0207674_10595131 3300026116 Bacteria 1068
71 Ga0207698_10300942 3300026142 Bacteria 1493
72 Ga0209371_1000011 3300027312 Bacteria 848456
73 Ga0209974_10019385 3300027876 Bacteria 2255
74 Ga0207428_11300768 3300027907 Bacteria 504
75 Ga0307517_10001740 3300028786 Bacteria 35898
76 Ga0307517_10026585 3300028786 Bacteria 7003
77 Ga0307517_10329641 3300028786 Bacteria 839
78 Ga0307515_10000282 3300028794 Bacteria 125216
79 Ga0307515_10000837 3300028794 Bacteria 70694
80 Ga0307515_10001476 3300028794 Bacteria 52884
81 Ga0307515_10017078 3300028794 Bacteria 13249
82 Ga0307515_10031199 3300028794 Bacteria 8897
83 Ga0268256_1000011 3300030500 Bacteria 848625
84 Ga0307512_10042540 3300030522 Bacteria 3759
85 Ga0307512_10235226 3300030522 Bacteria 935
86 Ga0307513_10018739 3300031456 Bacteria 8264
87 Ga0307513_10231924 3300031456 Bacteria 1658
88 Ga0307513_10243930 3300031456 Bacteria 1599
89 Ga0307509_10001779 3300031507 Bacteria 35792
90 Ga0307509_10003682 3300031507 Bacteria 22922
91 Ga0307509_10121958 3300031507 Bacteria 2582
92 Ga0307509_10163330 3300031507 Bacteria 2120
93 Ga0307509_10167889 3300031507 Bacteria 2079
94 Ga0307509_10170692 3300031507 Bacteria 2055
95 Ga0307408_100000219 3300031548 Bacteria 61012
96 Ga0307408_100105765 3300031548 Bacteria 2152
97 Ga0307408_100906230 3300031548 Bacteria 807
98 Ga0307508_10000016 3300031616 Bacteria 206976
99 Ga0307508_10001829 3300031616 Bacteria 23544
100 Ga0307514_10001033 3300031649 Bacteria 40119
101 Ga0307514_10001530 3300031649 Bacteria 27605
102 Ga0307514_10009526 3300031649 Bacteria 8160
103 Ga0307514_10117268 3300031649 Bacteria 1868
104 Ga0307514_10194077 3300031649 Bacteria 1288
105 Ga0307516_10005067 3300031730 Bacteria 15943
106 Ga0307516_10337764 3300031730 Bacteria 1174
107 Ga0307406_10000604 3300031901 Bacteria 20514
108 Ga0307416_100002714 3300032002 Bacteria 10258
109 Ga0307416_100005847 3300032002 Bacteria 7627
110 Ga0307507_10051062 3300033179 Bacteria 3984
111 Ga0307507_10131164 3300033179 Bacteria 1960
112 Ga0307507_10279734 3300033179 Bacteria 1045
113 Ga0307510_10029801 3300033180 Bacteria 6202
114 Ga0395905_0358669 3300037471 Bacteria 1350
115 Ga0395905_1316084 3300037471 Bacteria 626
116 Ga0400484_03537 3300038725 Bacteria 7914
117 Ga0400484_13038 3300038725 Bacteria 2909
118 Ga0400490_14606 3300038726 Bacteria 18655
119 Ga0400491_19342 3300038727 Bacteria 17826
120 Ga0400483_022054 3300039062 Bacteria 3173
121 Ga0400483_096403 3300039062 Bacteria 4904
122 Ga0400483_184392 3300039062 Bacteria 1418
123 Ga0400483_193175 3300039062 Bacteria 9297
124 Ga0400483_215542 3300039062 Bacteria 14582
125 Ga0451787_575181 3300041441 Bacteria 872
126 Ga0451789_0413142 3300041443 Bacteria 954
127 Ga0451791_0801499 3300041451 Bacteria 2127
128 Ga0451797_0123089 3300041453 Bacteria 1388
129 Ga0451798_0471284 3300041458 Bacteria 861
130 Ga0451802_0463378 3300041460 Bacteria 1541
131 Ga0451802_1725171 3300041460 Bacteria 1374
132 Ga0451807_1377498 3300041486 Bacteria 609
133 Ga0451835_0779320 3300041492 Bacteria 1076
134 Ga0451839_0801522 3300041496 Bacteria 797
135 Ga0451841_0373014 3300041498 Bacteria 1504
136 Ga0451845_0583438 3300041501 Bacteria 694
137 Ga0451843_0795912 3300041509 Bacteria 507
138 Ga0451853_0881195 3300041512 Bacteria 636
139 Ga0439437_015430 3300042000 Bacteria 898
140 Ga0439450_025647 3300042008 Bacteria 1294
141 Ga0450919_000592 3300042121 Bacteria 4581
142 Ga0450891_004370 3300042129 Bacteria 1326
143 Ga0450892_000843 3300042130 Bacteria 3369
144 Ga0450903_031456 3300042138 Bacteria 800
145 Ga0450918_000056 3300042531 Bacteria 22747
146 Ga0450893_0000840 3300042532 Bacteria 4548
147 Ga0451577_0001066 3300042876 Bacteria 39535
148 Ga0451577_0013517 3300042876 Bacteria 7636
149 Ga0453683_0050748 3300044673 Bacteria 2600
150 Ga0453684_0006104 3300044712 Bacteria 23233
151 Ga0453684_0149056 3300044712 Bacteria 2782
152 Ga0451576_0002708 3300045051 Bacteria 25749
153 Ga0495592_0000387 3300046454 Bacteria 34389
154 Ga0495638_0120021 3300046460 Bacteria 1555
155 Ga0495610_0047022 3300046512 Bacteria 2125
156 Ga0495610_0088029 3300046512 Bacteria 1412
157 Ga0495643_0063091 3300046522 Bacteria 1960
158 Ga0495625_0003792 3300046660 Bacteria 14645
159 Ga0495625_0716880 3300046660 Bacteria 589
160 Ga0495671_0441988 3300046692 Bacteria 622
161 Ga0495687_003133 3300047443 Bacteria 12338
162 Ga0495673_0042977 3300047469 Bacteria 2025
163 Ga0495626_0325165 3300048091 Bacteria 604
164 Ga0496102_0007764 3300048905 Bacteria 9170
165 Ga0496116_0087154 3300048919 Bacteria 1912
166 Ga0496124_0000705 3300048927 Bacteria 54667
167 Ga0501292_002616 3300049515 Bacteria 2337
168 Ga0501293_016337 3300049516 Bacteria 690
169 Ga0501294_012811 3300049517 Bacteria 845
170 Ga0501298_026403 3300049521 Bacteria 1117
171 Ga0501299_016228 3300049522 Bacteria 1317
172 Ga0501303_007699 3300049526 Bacteria 965
173 Ga0501206_006604 3300049653 Bacteria 1510
174 Ga0501206_029248 3300049653 Bacteria 814
175 Ga0501222_056063 3300049662 Bacteria 587
176 Ga0501243_117295 3300049675 Bacteria 549
177 Ga0501257_025975 3300049686 Bacteria 1396
178 Ga0501257_122507 3300049686 Bacteria 698
179 Ga0501262_004428 3300049759 Bacteria 1630
180 Ga0501262_011419 3300049759 Bacteria 1124
181 Ga0501281_04756 3300049777 Bacteria 951
182 nmdc:mga03683_44805_c1 3300050489 Bacteria 1829
183 nmdc:mga03n38_118080_c1 3300050490 Bacteria 1300
184 nmdc:mga00v17_1068395_c1 3300050491 Bacteria 506
185 nmdc:mga00v17_242561_c1 3300050491 Bacteria 1168
186 nmdc:mga0k408_11018_c1 3300050493 Bacteria 4909
187 nmdc:mga0k408_1853_c1 3300050493 Bacteria 11360
188 nmdc:mga0k408_204189_c1 3300050493 Bacteria 1180
189 nmdc:mga0k408_242661_c1 3300050493 Bacteria 1076
190 nmdc:mga0k408_261858_c1 3300050493 Bacteria 1033
191 nmdc:mga0k408_45239_c1 3300050493 Bacteria 2539
192 nmdc:mga0k408_92342_c1 3300050493 Bacteria 1779
193 nmdc:mga06z11_147447_c1 3300050494 Bacteria 1335
194 nmdc:mga06z11_576005_c1 3300050494 Bacteria 684
195 nmdc:mga06z11_98060_c1 3300050494 Bacteria 1603
196 nmdc:mga04h51_192632_c1 3300050495 Bacteria 798
197 nmdc:mga07m45_107544_c1 3300050496 Bacteria 1605
198 nmdc:mga07m45_1432_c1 3300050496 Bacteria 10939
199 nmdc:mga07m45_269812_c1 3300050496 Bacteria 990
200 nmdc:mga07m45_513_c1 3300050496 Bacteria 16432
201 nmdc:mga07m45_619320_c1 3300050496 Bacteria 625
202 nmdc:mga0sz30_569434_c1 3300050516 Bacteria 512
203 Ga0500610_0087824 3300053079 Bacteria 1617
204 Ga0500578_0000013 3300053086 Bacteria 185921
205 Ga0500578_0218970 3300053086 Bacteria 1158
206 Ga0500643_114977 3300053087 Bacteria 726
207 Ga0500644_0190531 3300053088 Bacteria 844
208 Ga0500583_0228180 3300053092 Bacteria 922
209 Ga0500651_0003007 3300053093 Bacteria 9096
210 Ga0500650_0369270 3300053098 Bacteria 625
211 Ga0500562_015044 3300053108 Bacteria 1984
212 Ga0500628_109862 3300053129 Bacteria 738
213 Ga0500652_000278 3300053131 Bacteria 19044
214 Ga0500658_0224213 3300053134 Bacteria 862
215 Ga0500568_0022164 3300053139 Bacteria 2723
216 Ga0500604_0003090 3300053151 Bacteria 4470
217 Ga0500604_0034787 3300053151 Bacteria 1496
218 Ga0500604_0035292 3300053151 Bacteria 1487
219 Ga0500622_0001029 3300053156 Bacteria 23369
220 Ga0500627_0175789 3300053158 Bacteria 964
221 Ga0500584_127232 3300053726 Bacteria 998
222 Ga0500645_215772 3300053730 Bacteria 515
223 Ga0500587_000096 3300053739 Bacteria 7634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030522 Ga0307512_10235226 Ga0307512_102352262 128
2 3300031507 Ga0307509_10163330 Ga0307509_101633303 128
3 3300033179 Ga0307507_10051062 Ga0307507_100510625 128
4 3300005355 Ga0070671_100469233 Ga0070671_1004692331 129
5 3300005719 Ga0068861_100603197 Ga0068861_1006031972 129
6 3300006038 Ga0075365_10324551 Ga0075365_103245512 129
7 3300006048 Ga0075363_100079490 Ga0075363_1000794902 129
8 3300006177 Ga0075362_10007150 Ga0075362_100071504 129
9 3300009147 Ga0114129_12320663 Ga0114129_123206631 129
10 3300009148 Ga0105243_10000697 Ga0105243_100006979 129
11 3300025931 Ga0207644_10509084 Ga0207644_105090842 129
12 3300025942 Ga0207689_10021594 Ga0207689_100215944 129
13 3300041441 Ga0451787_575181 Ga0451787_575181_11_403 129
14 3300041458 Ga0451798_0471284 Ga0451798_0471284_391_783 129
15 3300041460 Ga0451802_0463378 Ga0451802_0463378_538_930 129
16 3300042008 Ga0439450_025647 Ga0439450_025647_331_753 129
17 3300047443 Ga0495687_003133 Ga0495687_003133_1993_2415 129
18 3300048091 Ga0495626_0325165 Ga0495626_0325165_19_441 129
19 3300048919 Ga0496116_0087154 Ga0496116_0087154_171_563 129
20 3300050489 nmdc:mga03683_44805_c1 nmdc:mga03683_44805_c1_443_865 129
21 3300050490 nmdc:mga03n38_118080_c1 nmdc:mga03n38_118080_c1_419_841 129
22 3300050491 nmdc:mga00v17_242561_c1 nmdc:mga00v17_242561_c1_426_848 129
23 3300050493 nmdc:mga0k408_11018_c1 nmdc:mga0k408_11018_c1_320_712 129
24 3300050493 nmdc:mga0k408_204189_c1 nmdc:mga0k408_204189_c1_588_980 129
25 3300050493 nmdc:mga0k408_92342_c1 nmdc:mga0k408_92342_c1_322_744 129
26 3300050494 nmdc:mga06z11_147447_c1 nmdc:mga06z11_147447_c1_865_1287 129
27 3300050494 nmdc:mga06z11_98060_c1 nmdc:mga06z11_98060_c1_530_922 129
28 3300050495 nmdc:mga04h51_192632_c1 nmdc:mga04h51_192632_c1_343_765 129
29 3300050496 nmdc:mga07m45_513_c1 nmdc:mga07m45_513_c1_43_435 129
30 3300050516 nmdc:mga0sz30_569434_c1 nmdc:mga0sz30_569434_c1_41_463 129
31 3300053086 Ga0500578_0218970 Ga0500578_0218970_444_836 129
32 3300053098 Ga0500650_0369270 Ga0500650_0369270_17_409 129
33 3300053129 Ga0500628_109862 Ga0500628_109862_14_406 129
34 3300053131 Ga0500652_000278 Ga0500652_000278_1222_1614 129
35 3300053139 Ga0500568_0022164 Ga0500568_0022164_2252_2644 129
36 3300053151 Ga0500604_0034787 Ga0500604_0034787_523_915 129
37 3300053156 Ga0500622_0001029 Ga0500622_0001029_4887_5279 129
38 3300053158 Ga0500627_0175789 Ga0500627_0175789_134_526 129
39 3300053730 Ga0500645_215772 Ga0500645_215772_14_406 129
40 3300005335 Ga0070666_10942732 Ga0070666_109427321 130
41 3300005367 Ga0070667_100331158 Ga0070667_1003311582 130
42 3300005617 Ga0068859_101896453 Ga0068859_1018964532 130
43 3300006237 Ga0097621_100521839 Ga0097621_1005218392 130
44 3300006931 Ga0097620_101895585 Ga0097620_1018955852 130
45 3300009545 Ga0105237_10095895 Ga0105237_100958952 130
46 3300014325 Ga0163163_10813685 Ga0163163_108136852 130
47 3300014968 Ga0157379_10309009 Ga0157379_103090092 130
48 3300050491 nmdc:mga00v17_1068395_c1 nmdc:mga00v17_1068395_c1_70_465 130
49 3300053726 Ga0500584_127232 Ga0500584_127232_542_937 130
50 3300025914 Ga0207671_10093825 Ga0207671_100938254 131
51 3300025986 Ga0207658_10350453 Ga0207658_103504532 131
52 3300031507 Ga0307509_10167889 Ga0307509_101678893 131
53 3300041501 Ga0451845_0583438 Ga0451845_0583438_18_416 132
54 3300053086 Ga0500578_0000013 Ga0500578_0000013_101053_101454 132
55 3300053108 Ga0500562_015044 Ga0500562_015044_1382_1783 132
56 3300053151 Ga0500604_0003090 Ga0500604_0003090_3028_3429 132
57 3300050496 nmdc:mga07m45_269812_c1 nmdc:mga07m45_269812_c1_369_791 133
58 3300005616 Ga0068852_100047705 Ga0068852_1000477052 134
59 3300026142 Ga0207698_10300942 Ga0207698_103009422 134
60 3300031649 Ga0307514_10194077 Ga0307514_101940772 134
61 3300053092 Ga0500583_0228180 Ga0500583_0228180_425_847 134
62 iso_pu_bacteria 2585428057 2587730910 134
63 iso_pu_bacteria 2643221592 2643970167 134
64 iso_pu_bacteria 2643221625 2644141166 134
65 iso_pu_bacteria 2643221648 2644274221 134
66 3300028786 Ga0307517_10001740 Ga0307517_1000174012 135
67 iso_pu_bacteria 2585428062 2587754947 135
68 3300003215 JGI25153J46596_10002611 JGI25153J46596_100026112 136
69 3300005578 Ga0068854_101405698 Ga0068854_1014056982 136
70 3300013297 Ga0157378_10142088 Ga0157378_101420882 136
71 3300025258 Ga0209129_1018364 Ga0209129_10183641 136
72 3300025297 Ga0209758_1000078 Ga0209758_1000078161 136
73 3300037471 Ga0395905_0358669 Ga0395905_0358669_674_1087 136
74 3300037471 Ga0395905_1316084 Ga0395905_1316084_61_474 136
75 3300049653 Ga0501206_029248 Ga0501206_029248_62_475 136
76 iso_pu_bacteria 2585428058 2587735758 136
77 iso_pu_bacteria 2643221644 2644248534 136
78 iso_pu_bacteria 2919704043 2919707859 136
79 3300002774 JGI25150J39212_1000148 JGI25150J39212_100014813 137
80 3300003215 JGI25153J46596_10007686 JGI25153J46596_100076863 137
81 3300003775 Ga0055524_1000671 Ga0055524_100067112 137
82 3300005343 Ga0070687_100453977 Ga0070687_1004539771 137
83 3300005467 Ga0070706_100314856 Ga0070706_1003148562 137
84 3300025245 Ga0207425_1000241 Ga0207425_100024127 137
85 3300025258 Ga0209129_1000320 Ga0209129_100032026 137
86 3300025297 Ga0209758_1000848 Ga0209758_100084827 137
87 3300025299 Ga0209256_1001155 Ga0209256_100115510 137
88 3300025910 Ga0207684_10311806 Ga0207684_103118062 137
89 3300025918 Ga0207662_10370011 Ga0207662_103700112 137
90 3300031649 Ga0307514_10001033 Ga0307514_1000103312 137
91 3300003791 Ga0055530_10007766 Ga0055530_100077663 138
92 3300005262 Ga0065165_1005360 Ga0065165_10053603 138
93 3300006051 Ga0075364_11054972 Ga0075364_110549721 138
94 3300025273 Ga0209673_1010119 Ga0209673_10101194 138
95 3300025298 Ga0209050_1002477 Ga0209050_100247710 138
96 3300025304 Ga0209257_1076190 Ga0209257_10761901 138
97 3300028786 Ga0307517_10026585 Ga0307517_100265857 138
98 3300030522 Ga0307512_10042540 Ga0307512_100425403 138
99 3300031507 Ga0307509_10001779 Ga0307509_100017793 138
100 3300031507 Ga0307509_10170692 Ga0307509_101706922 138
101 3300031616 Ga0307508_10001829 Ga0307508_100018292 138
102 3300031649 Ga0307514_10009526 Ga0307514_100095266 138
103 3300031649 Ga0307514_10117268 Ga0307514_101172681 138
104 3300033179 Ga0307507_10131164 Ga0307507_101311642 138
105 3300033180 Ga0307510_10029801 Ga0307510_100298013 138
106 3300046454 Ga0495592_0000387 Ga0495592_0000387_9514_9930 138
107 3300053088 Ga0500644_0190531 Ga0500644_0190531_188_607 138
108 3300003316 rootH1_10135831 rootH1_101358312 139
109 3300006042 Ga0075368_10056057 Ga0075368_100560572 139
110 3300006177 Ga0075362_10413315 Ga0075362_104133151 139
111 3300006178 Ga0075367_10139848 Ga0075367_101398482 139
112 3300028794 Ga0307515_10000837 Ga0307515_1000083730 139
113 3300028794 Ga0307515_10017078 Ga0307515_1001707813 139
114 3300031456 Ga0307513_10231924 Ga0307513_102319242 139
115 3300031456 Ga0307513_10243930 Ga0307513_102439302 139
116 3300031548 Ga0307408_100105765 Ga0307408_1001057652 139
117 3300031730 Ga0307516_10005067 Ga0307516_100050678 139
118 3300032002 Ga0307416_100005847 Ga0307416_1000058473 139
119 3300039062 Ga0400483_022054 Ga0400483_022054_808_1278 139
120 3300039062 Ga0400483_096403 Ga0400483_096403_920_1390 139
121 3300039062 Ga0400483_193175 Ga0400483_193175_7779_8249 139
122 3300041460 Ga0451802_1725171 Ga0451802_1725171_252_722 139
123 3300041486 Ga0451807_1377498 Ga0451807_1377498_77_547 139
124 3300041496 Ga0451839_0801522 Ga0451839_0801522_219_686 139
125 3300041498 Ga0451841_0373014 Ga0451841_0373014_572_1039 139
126 3300041509 Ga0451843_0795912 Ga0451843_0795912_18_437 139
127 3300046512 Ga0495610_0047022 Ga0495610_0047022_128_598 139
128 3300046522 Ga0495643_0063091 Ga0495643_0063091_685_1155 139
129 3300046660 Ga0495625_0003792 Ga0495625_0003792_5314_5784 139
130 3300049516 Ga0501293_016337 Ga0501293_016337_58_477 139
131 3300049517 Ga0501294_012811 Ga0501294_012811_229_648 139
132 3300049521 Ga0501298_026403 Ga0501298_026403_408_827 139
133 3300049522 Ga0501299_016228 Ga0501299_016228_442_861 139
134 3300049526 Ga0501303_007699 Ga0501303_007699_372_791 139
135 3300049653 Ga0501206_006604 Ga0501206_006604_617_1036 139
136 3300049675 Ga0501243_117295 Ga0501243_117295_82_501 139
137 3300049686 Ga0501257_025975 Ga0501257_025975_955_1374 139
138 3300049759 Ga0501262_011419 Ga0501262_011419_334_753 139
139 3300049777 Ga0501281_04756 Ga0501281_04756_209_628 139
140 3300050493 nmdc:mga0k408_261858_c1 nmdc:mga0k408_261858_c1_226_708 139
141 3300050494 nmdc:mga06z11_576005_c1 nmdc:mga06z11_576005_c1_227_646 139
142 3300050496 nmdc:mga07m45_107544_c1 nmdc:mga07m45_107544_c1_610_1077 139
143 3300050496 nmdc:mga07m45_619320_c1 nmdc:mga07m45_619320_c1_13_480 139
144 3300053134 Ga0500658_0224213 Ga0500658_0224213_109_579 139
145 3300053739 Ga0500587_000096 Ga0500587_000096_2303_2773 139
146 iso_pu_bacteria 2585428062 2587759269 139
147 3300001979 JGI24740J21852_10000726 JGI24740J21852_100007262 140
148 3300003187 JGI25151J46595_10000484 JGI25151J46595_1000048435 140
149 3300003316 rootH1_10001291 rootH1_1000129112 140
150 3300003322 rootL2_10000467 rootL2_1000046720 140
151 3300003322 rootL2_10210459 rootL2_102104592 140
152 3300003323 rootH1_10301204 rootH1_103012042 140
153 3300003856 Ga0058692_1000020 Ga0058692_100002091 140
154 3300005459 Ga0068867_100000552 Ga0068867_1000005525 140
155 3300006048 Ga0075363_100019445 Ga0075363_1000194452 140
156 3300006058 Ga0075432_10474952 Ga0075432_104749521 140
157 3300006178 Ga0075367_10054805 Ga0075367_100548053 140
158 3300006178 Ga0075367_10689179 Ga0075367_106891791 140
159 3300006195 Ga0075366_10014269 Ga0075366_100142693 140
160 3300006195 Ga0075366_10026653 Ga0075366_100266534 140
161 3300006195 Ga0075366_10173751 Ga0075366_101737512 140
162 3300006353 Ga0075370_10006467 Ga0075370_100064674 140
163 3300009148 Ga0105243_10017417 Ga0105243_100174174 140
164 3300015265 Ga0182005_1015688 Ga0182005_10156881 140
165 3300025258 Ga0209129_1000651 Ga0209129_100065119 140
166 3300025294 Ga0209025_1000207 Ga0209025_100020775 140
167 3300025914 Ga0207671_10406187 Ga0207671_104061872 140
168 3300025935 Ga0207709_10005144 Ga0207709_100051444 140
169 3300025935 Ga0207709_10012997 Ga0207709_100129974 140
170 3300026116 Ga0207674_10595131 Ga0207674_105951312 140
171 3300027312 Ga0209371_1000011 Ga0209371_1000011356 140
172 3300027876 Ga0209974_10019385 Ga0209974_100193852 140
173 3300027907 Ga0207428_11300768 Ga0207428_113007681 140
174 3300028786 Ga0307517_10329641 Ga0307517_103296412 140
175 3300028794 Ga0307515_10000282 Ga0307515_1000028293 140
176 3300028794 Ga0307515_10001476 Ga0307515_1000147644 140
177 3300028794 Ga0307515_10031199 Ga0307515_100311997 140
178 3300030500 Ga0268256_1000011 Ga0268256_1000011356 140
179 3300031456 Ga0307513_10018739 Ga0307513_100187393 140
180 3300031507 Ga0307509_10003682 Ga0307509_100036822 140
181 3300031507 Ga0307509_10121958 Ga0307509_101219583 140
182 3300031548 Ga0307408_100000219 Ga0307408_10000021944 140
183 3300031548 Ga0307408_100906230 Ga0307408_1009062302 140
184 3300031616 Ga0307508_10000016 Ga0307508_10000016124 140
185 3300031649 Ga0307514_10001530 Ga0307514_1000153015 140
186 3300031730 Ga0307516_10337764 Ga0307516_103377642 140
187 3300031901 Ga0307406_10000604 Ga0307406_1000060418 140
188 3300032002 Ga0307416_100002714 Ga0307416_1000027141 140
189 3300033179 Ga0307507_10279734 Ga0307507_102797342 140
190 3300038725 Ga0400484_03537 Ga0400484_03537_588_1031 140
191 3300038725 Ga0400484_13038 Ga0400484_13038_2251_2694 140
192 3300038726 Ga0400490_14606 Ga0400490_14606_3169_3612 140
193 3300038727 Ga0400491_19342 Ga0400491_19342_15032_15475 140
194 3300039062 Ga0400483_184392 Ga0400483_184392_908_1351 140
195 3300039062 Ga0400483_215542 Ga0400483_215542_13591_14034 140
196 3300041443 Ga0451789_0413142 Ga0451789_0413142_212_643 140
197 3300041451 Ga0451791_0801499 Ga0451791_0801499_1026_1457 140
198 3300041453 Ga0451797_0123089 Ga0451797_0123089_493_924 140
199 3300041492 Ga0451835_0779320 Ga0451835_0779320_512_943 140
200 3300041512 Ga0451853_0881195 Ga0451853_0881195_80_511 140
201 3300042000 Ga0439437_015430 Ga0439437_015430_183_611 140
202 3300042121 Ga0450919_000592 Ga0450919_000592_2930_3382 140
203 3300042129 Ga0450891_004370 Ga0450891_004370_844_1272 140
204 3300042130 Ga0450892_000843 Ga0450892_000843_2299_2727 140
205 3300042138 Ga0450903_031456 Ga0450903_031456_73_501 140
206 3300042531 Ga0450918_000056 Ga0450918_000056_6155_6607 140
207 3300042532 Ga0450893_0000840 Ga0450893_0000840_2880_3308 140
208 3300042876 Ga0451577_0001066 Ga0451577_0001066_28785_29207 140
209 3300042876 Ga0451577_0013517 Ga0451577_0013517_850_1302 140
210 3300044673 Ga0453683_0050748 Ga0453683_0050748_429_881 140
211 3300044712 Ga0453684_0006104 Ga0453684_0006104_19775_20203 140
212 3300044712 Ga0453684_0149056 Ga0453684_0149056_287_739 140
213 3300045051 Ga0451576_0002708 Ga0451576_0002708_6358_6810 140
214 3300046460 Ga0495638_0120021 Ga0495638_0120021_120_542 140
215 3300046512 Ga0495610_0088029 Ga0495610_0088029_884_1315 140
216 3300046660 Ga0495625_0716880 Ga0495625_0716880_149_571 140
217 3300046692 Ga0495671_0441988 Ga0495671_0441988_78_500 140
218 3300047469 Ga0495673_0042977 Ga0495673_0042977_630_1052 140
219 3300048905 Ga0496102_0007764 Ga0496102_0007764_4088_4510 140
220 3300048927 Ga0496124_0000705 Ga0496124_0000705_12754_13197 140
221 3300049515 Ga0501292_002616 Ga0501292_002616_216_638 140
222 3300049662 Ga0501222_056063 Ga0501222_056063_77_499 140
223 3300049686 Ga0501257_122507 Ga0501257_122507_200_622 140
224 3300049759 Ga0501262_004428 Ga0501262_004428_1177_1599 140
225 3300050493 nmdc:mga0k408_1853_c1 nmdc:mga0k408_1853_c1_3451_3873 140
226 3300050493 nmdc:mga0k408_242661_c1 nmdc:mga0k408_242661_c1_65_487 140
227 3300050493 nmdc:mga0k408_45239_c1 nmdc:mga0k408_45239_c1_570_992 140
228 3300050496 nmdc:mga07m45_1432_c1 nmdc:mga07m45_1432_c1_7910_8332 140
229 3300053079 Ga0500610_0087824 Ga0500610_0087824_1058_1480 140
230 3300053087 Ga0500643_114977 Ga0500643_114977_123_554 140
231 3300053093 Ga0500651_0003007 Ga0500651_0003007_5252_5683 140
232 3300053151 Ga0500604_0035292 Ga0500604_0035292_350_781 140
233 iso_pu_bacteria 8021622325 8021624717 140
234 iso_pu_bacteria 8021626552 8021630391 140
235 iso_pu_bacteria 8021648035 8021648596 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09917

DUF2147

Uncharacterized protein conserved in bacteria (DUF2147)

36

136

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4inn-assembly1.cif.gz_A protein hp1028 from the human pathogen helicobacter pylori belongs to the lipocalin family 0.6809 27 130
6jm5-assembly2.cif.gz_B crystal structure of tbc1d23 c terminal domain 0.602 95 126
8bhy-assembly1.cif.gz_D dna-pk ku80 mediated dimer bound to paxx and xlf 0.6012 100 129
6ew5-assembly4.cif.gz_D human myelin protein p2 f57a mutant, monoclinic crystal form 0.5989 25 129
7tol-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with archaeal lipid, 5'deoxyadenosine, and methionine bound 0.5872 88 119
ID Description Score Start End Superfamily
af_Q9N589_34_139_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7094 83 126 2.30.29.30
4innA00 Mainly Beta;Beta Barrel;Lipocalin; 0.6929 27 130 2.40.128.520
af_F1QTP6_122_221_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6884 83 120 2.30.29.30
af_Q0DV08_215_351_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6804 96 125 2.30.29.30
af_M9PCC9_52_133_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6657 100 134 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A519DXE7-F1-model_v4 DUF2147 domain-containing protein 0.9824 20 140
AF-A0A519DXE7-F1-model_v4 DUF2147 domain-containing protein 0.9744 20 140
AF-A0A7C2FJ00-F1-model_v4 DUF2147 domain-containing protein 0.9041 83 129
AF-A0A1I6LBI8-F1-model_v4 Uncharacterized conserved protein, DUF2147 family 0.9014 3 140
AF-A0A7W5BFZ1-F1-model_v4 Uncharacterized protein (DUF2147 family) 0.9013 1 140

Feature Viewer

pLDDT pTM Quality
86.02 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map