F348262

General Info

Members Datasets Scaffolds Average Seq Length
235 199 190 264

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10080681|Ga0265330_100806812
Length 266
Sequence MRQYLDFLDLLLREGRRKQDRTGTGTLSLFGHQMRFDLAQGFPLLTTKKLHRKSIIHELLWFLKGDTNVAYLRENGVTIWDEWADASGELGPVYGRQWRSWACPDGRVIDQIAGVVEDIKRDPFSRRLIVSAWNPADLDKMALAPCHCLFQFYIDETDGQKRLSCQLYQRSADVFLGVPFNIASYALLTHLIARETGCVAGDFVQTFGDAHLYLNHVDQAREQLKREPRSLPQLKLASGALFETRYDDIDIEGYDPWPAIAAPIAV

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
4 2534681786 Brucella suis 92/29 Isolate Unclassified
5 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
6 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
7 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
8 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
9 2643221582 Rhizobium sp. Root651 Isolate Unclassified
10 2643221693 Rhizobium sp. Root491 Isolate Unclassified
11 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
12 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
13 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
14 2751185800 Brucella pituitosa AA2 Isolate Unclassified
15 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
16 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
17 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
18 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
19 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
20 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
21 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
22 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
23 2854911287 Brucella lupini LUP21 Isolate Unclassified
24 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
25 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
26 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
27 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
28 2919404418 Luteibacter sp. 3190 Isolate Unclassified
29 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
30 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
31 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
32 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
33 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
34 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
35 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
36 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
37 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
38 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
39 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
40 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
41 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
42 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
43 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
44 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
45 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
46 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
47 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
48 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
49 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
50 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
122 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
123 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
197 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
198 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
199 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.57
Metatranscriptomes 1.28
Isolates 19.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.6
Nodule 5.11
Rhizoplane 2.55
Rhizosphere 54.04
Stem 0
Stem Tuber 0
Unclassified 21.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10033308 3300002459 Bacteria 1068
2 JGI25156J39149_1005186 3300002705 Bacteria 3820
3 JGI25162J39368_1000128 3300002737 Bacteria 83781
4 JGI25157J39369_1000211 3300002741 Bacteria 48410
5 JGI25163J39215_1000749 3300002771 Bacteria 8171
6 JGI25164J39214_1000067 3300002772 Bacteria 103259
7 JGI25165J46597_1000167 3300003214 Bacteria 103259
8 Ga0006554J51385_1031742 3300003567 Bacteria 1087
9 Ga0006562J51391_1003487 3300003578 Bacteria 6510
10 Ga0006562J51391_1056881 3300003578 Bacteria 1460
11 Ga0055535_1000074 3300003761 Bacteria 111974
12 Ga0055535_1000256 3300003761 Bacteria 55821
13 Ga0055542_1000110 3300003762 Bacteria 110960
14 Ga0055542_1000206 3300003762 Bacteria 72609
15 Ga0055529_1000024 3300003763 Bacteria 305218
16 Ga0055529_1000121 3300003763 Bacteria 114639
17 Ga0065165_1001503 3300005262 Bacteria 24665
18 Ga0070670_100161106 3300005331 Bacteria 1944
19 Ga0070714_100012754 3300005435 Bacteria 6714
20 Ga0070707_100718755 3300005468 Bacteria 962
21 Ga0068853_100000079 3300005539 Bacteria 66544
22 Ga0070665_100010357 3300005548 Bacteria 9434
23 Ga0070664_100184131 3300005564 Bacteria 1858
24 Ga0068859_100012814 3300005617 Bacteria 8420
25 Ga0075368_10000115 3300006042 Bacteria 20911
26 Ga0075362_10053098 3300006177 Bacteria 1818
27 Ga0075369_10003237 3300006186 Bacteria 5913
28 Ga0075366_10035289 3300006195 Bacteria 2948
29 Ga0075431_100075455 3300006847 Bacteria 3479
30 Ga0075429_100073246 3300006880 Bacteria 2983
31 Ga0097620_100012814 3300006931 Bacteria 8420
32 Ga0105240_10153148 3300009093 Bacteria 2744
33 Ga0111539_10478246 3300009094 Bacteria 1451
34 Ga0114129_10891201 3300009147 Bacteria 1128
35 Ga0105243_10016974 3300009148 Bacteria 5506
36 Ga0105241_10103350 3300009174 Bacteria 2268
37 Ga0157373_10373246 3300013100 Bacteria 1020
38 Ga0157371_10063996 3300013102 Bacteria 2607
39 Ga0157370_10000351 3300013104 Bacteria 58496
40 Ga0171463_1003 3300013249 Bacteria 695693
41 Ga0163162_10003053 3300013306 Bacteria 15999
42 Ga0157372_10114956 3300013307 Bacteria 3085
43 Ga0163163_10004255 3300014325 Bacteria 12199
44 Ga0182008_10017288 3300014497 Bacteria 3743
45 Ga0182006_1061559 3300015261 Bacteria 1415
46 Ga0183363_1093 3300015690 Bacteria 25804
47 Ga0163161_10112030 3300017792 Bacteria 2041
48 Ga0214543_1000038 3300021327 Bacteria 182106
49 Ga0213872_10006331 3300021361 Bacteria 5957
50 Ga0209435_101940 3300025206 Bacteria 2491
51 Ga0209760_100644 3300025207 Bacteria 5773
52 Ga0209784_100011 3300025224 Bacteria 546770
53 Ga0209672_100972 3300025228 Bacteria 12689
54 Ga0209672_102843 3300025228 Bacteria 3926
55 Ga0207427_100026 3300025231 Bacteria 412764
56 Ga0209437_100217 3300025233 Bacteria 105424
57 Ga0209258_100027 3300025242 Bacteria 518449
58 Ga0209258_100165 3300025242 Bacteria 148376
59 Ga0209646_1000397 3300025246 Bacteria 26143
60 Ga0209026_1000018 3300025250 Bacteria 381351
61 Ga0209148_1000001 3300025254 Bacteria 2545271
62 Ga0209148_1000092 3300025254 Bacteria 249076
63 Ga0209759_1000066 3300025256 Bacteria 184163
64 Ga0209233_1000002 3300025261 Bacteria 2501366
65 Ga0209455_1000019 3300025272 Bacteria 705658
66 Ga0209050_1000538 3300025298 Bacteria 62826
67 Ga0207654_10010505 3300025911 Bacteria 4714
68 Ga0207650_10002806 3300025925 Bacteria 12027
69 Ga0207709_10227675 3300025935 Bacteria 1349
70 Ga0207670_10381624 3300025936 Bacteria 1123
71 Ga0207679_10155439 3300025945 Bacteria 1867
72 Ga0207639_10000046 3300026041 Bacteria 134165
73 Ga0207676_10261519 3300026095 Bacteria 1563
74 Ga0209983_1032140 3300027665 Bacteria 1121
75 Ga0268266_10017271 3300028379 Bacteria 6160
76 Ga0265330_10080681 3300031235 Bacteria 1402
77 Ga0265328_10000041 3300031239 Bacteria 89398
78 Ga0265328_10000375 3300031239 Bacteria 20819
79 Ga0265328_10036327 3300031239 Bacteria 1820
80 Ga0265329_10044546 3300031242 Bacteria 1418
81 Ga0265331_10001219 3300031250 Bacteria 19343
82 Ga0265331_10008538 3300031250 Bacteria 5820
83 Ga0265327_10007761 3300031251 Bacteria 8191
84 Ga0265316_10012475 3300031344 Bacteria 7618
85 Ga0307416_100159545 3300032002 Bacteria 2082
86 Ga0307415_100330816 3300032126 Bacteria 1275
87 Ga0373937_0026443 3300036401 Bacteria 5245
88 Ga0395899_0023210 3300037312 Bacteria 4702
89 Ga0395898_0000922 3300037466 Bacteria 47049
90 Ga0400491_10962 3300038727 Bacteria 1596
91 Ga0400488_04209 3300038741 Bacteria 6451
92 Ga0400487_02813 3300039110 Bacteria 3506
93 Ga0400487_51829 3300039110 Bacteria 8967
94 Ga0436361_0069717 3300039447 Bacteria 2732
95 Ga0439465_0088928 3300041413 Bacteria 1055
96 Ga0451793_0020339 3300041452 Bacteria 2597
97 Ga0439449_0002827 3300042007 Bacteria 6751
98 Ga0439459_0000117 3300042438 Bacteria 7594
99 Ga0451577_0003143 3300042876 Bacteria 18605
100 Ga0466961_0000645 3300044693 Bacteria 21905
101 Ga0495629_0002267 3300046459 Bacteria 14831
102 Ga0495629_0075936 3300046459 Bacteria 2346
103 Ga0495638_0000497 3300046460 Bacteria 46775
104 Ga0495651_0076887 3300046462 Bacteria 2528
105 Ga0495605_0018133 3300046474 Bacteria 3779
106 Ga0495662_0057370 3300046476 Bacteria 1880
107 Ga0495664_0138139 3300046477 Bacteria 1477
108 Ga0495584_0004915 3300046491 Bacteria 7132
109 Ga0495631_0050519 3300046518 Bacteria 1818
110 Ga0495637_0043319 3300046520 Bacteria 1922
111 Ga0495637_0052240 3300046520 Bacteria 1707
112 Ga0495644_0012345 3300046523 Bacteria 3284
113 Ga0495609_0084030 3300046538 Bacteria 1389
114 Ga0495633_0048274 3300046558 Bacteria 2010
115 Ga0495611_0107660 3300046648 Bacteria 1296
116 Ga0495625_0008650 3300046660 Bacteria 8655
117 Ga0495625_0013357 3300046660 Bacteria 6601
118 Ga0495588_0001754 3300046674 Bacteria 9235
119 Ga0495657_0023715 3300046675 Bacteria 4382
120 Ga0495670_0026280 3300046691 Bacteria 2881
121 Ga0495589_0211645 3300046794 Bacteria 912
122 Ga0495600_0006237 3300046809 Bacteria 7237
123 Ga0495660_0034741 3300046810 Bacteria 2819
124 Ga0495681_0015618 3300047470 Bacteria 4289
125 Ga0495626_0002661 3300048091 Bacteria 12112
126 Ga0495626_0008168 3300048091 Bacteria 5766
127 Ga0496110_0012211 3300048913 Bacteria 7057
128 Ga0496111_0012000 3300048914 Bacteria 5857
129 Ga0496111_0365525 3300048914 Bacteria 1068
130 Ga0496113_0038664 3300048916 Bacteria 3509
131 Ga0496116_0107101 3300048919 Bacteria 1653
132 Ga0496117_0000002 3300048920 Bacteria 2483758
133 Ga0496117_0005653 3300048920 Bacteria 13045
134 Ga0496118_0000087 3300048921 Bacteria 176693
135 Ga0496118_0101864 3300048921 Bacteria 1937
136 Ga0496119_0015291 3300048922 Bacteria 5926
137 Ga0496119_0090748 3300048922 Bacteria 1736
138 Ga0496119_0097266 3300048922 Bacteria 1659
139 Ga0496120_0000180 3300048923 Bacteria 107518
140 Ga0496120_0012345 3300048923 Bacteria 5821
141 Ga0496121_0020069 3300048924 Bacteria 6639
142 Ga0496122_0000004 3300048925 Bacteria 645283
143 Ga0496122_0008984 3300048925 Bacteria 10625
144 Ga0496122_0029402 3300048925 Bacteria 4636
145 Ga0496123_0000007 3300048926 Bacteria 645283
146 Ga0496124_0224383 3300048927 Bacteria 1410
147 Ga0496125_0000412 3300048928 Bacteria 79970
148 Ga0496125_0201207 3300048928 Bacteria 1303
149 Ga0496125_0314070 3300048928 Bacteria 953
150 Ga0496126_0011232 3300048929 Bacteria 9291
151 Ga0496126_0267507 3300048929 Bacteria 1419
152 Ga0501031_0008597 3300049568 Bacteria 6645
153 Ga0501031_0146336 3300049568 Bacteria 1544
154 Ga0501032_0053699 3300049569 Bacteria 2713
155 Ga0501032_0082177 3300049569 Bacteria 2143
156 Ga0501033_0090261 3300049570 Bacteria 2241
157 Ga0501034_0018054 3300049571 Bacteria 7239
158 Ga0501038_0008714 3300049574 Bacteria 9310
159 Ga0501038_0199043 3300049574 Bacteria 1608
160 Ga0501039_0238933 3300049575 Bacteria 1428
161 Ga0501043_0106562 3300049579 Bacteria 2202
162 Ga0501043_0183870 3300049579 Bacteria 1628
163 Ga0501046_0005153 3300049580 Bacteria 11714
164 Ga0501047_0503707 3300049581 Bacteria 1037
165 Ga0501070_0015026 3300049586 Bacteria 6514
166 Ga0501070_0019669 3300049586 Bacteria 5662
167 Ga0501070_0036125 3300049586 Bacteria 4126
168 Ga0501074_0017584 3300049590 Bacteria 5192
169 Ga0501074_0043816 3300049590 Bacteria 3239
170 Ga0501235_004215 3300049669 Bacteria 3116
171 Ga0501079_0160831 3300049741 Bacteria 1751
172 Ga0501080_0000611 3300049742 Bacteria 28272
173 Ga0501035_0098191 3300049822 Bacteria 2571
174 Ga0501035_0223351 3300049822 Bacteria 1607
175 Ga0501044_0131586 3300049823 Bacteria 2495
176 Ga0501044_0206611 3300049823 Bacteria 1920
177 Ga0501044_0362680 3300049823 Bacteria 1367
178 nmdc:mga03683_103743_c1 3300050489 Bacteria 1252
179 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
180 nmdc:mga0yw44_2944_c1 3300050492 Bacteria 7416
181 nmdc:mga0k408_41193_c1 3300050493 Bacteria 2659
182 nmdc:mga06z11_31333_c1 3300050494 Bacteria 2583
183 nmdc:mga07m45_171076_c1 3300050496 Bacteria 1263
184 nmdc:mga06r32_46368_c1 3300050510 Bacteria 4147
185 nmdc:mga0sz30_234_c1 3300050516 Bacteria 21206
186 Ga0495619_0025327 3300053085 Bacteria 3809
187 Ga0500561_0000158 3300053137 Bacteria 12739
188 Ga0500568_0140107 3300053139 Bacteria 897
189 Ga0500634_0010642 3300053161 Bacteria 4708
190 Ga0500645_030759 3300053730 Bacteria 1615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0018133 Ga0495605_0018133_2144_2917 257
2 3300046491 Ga0495584_0004915 Ga0495584_0004915_3185_3958 257
3 3300046518 Ga0495631_0050519 Ga0495631_0050519_427_1200 257
4 3300046520 Ga0495637_0043319 Ga0495637_0043319_1015_1788 257
5 3300046523 Ga0495644_0012345 Ga0495644_0012345_1515_2288 257
6 3300046538 Ga0495609_0084030 Ga0495609_0084030_601_1374 257
7 3300046648 Ga0495611_0107660 Ga0495611_0107660_161_934 257
8 3300046691 Ga0495670_0026280 Ga0495670_0026280_754_1527 257
9 3300046794 Ga0495589_0211645 Ga0495589_0211645_107_880 257
10 3300046810 Ga0495660_0034741 Ga0495660_0034741_1011_1784 257
11 iso_pu_bacteria 2508501122 2509111305 260
12 iso_pu_bacteria 2509276019 2509376415 260
13 iso_pu_bacteria 2524023207 2524448611 260
14 iso_pu_bacteria 2534681786 2535485101 260
15 iso_pu_bacteria 2554235003 2554248176 260
16 iso_pu_bacteria 2558860100 2558868422 260
17 iso_pu_bacteria 2558860242 2559295292 260
18 iso_pu_bacteria 2599185156 2599331707 260
19 iso_pu_bacteria 2643221582 2643920398 260
20 iso_pu_bacteria 2643221693 2644522014 260
21 iso_pu_bacteria 2657244999 2657681509 260
22 iso_pu_bacteria 2721755693 2723604332 260
23 iso_pu_bacteria 2728369359 2730135022 260
24 iso_pu_bacteria 2751185800 2753359727 260
25 iso_pu_bacteria 2751185905 2753810126 260
26 iso_pu_bacteria 2758568016 2758641986 260
27 iso_pu_bacteria 2791355094 2792639127 260
28 iso_pu_bacteria 2802428803 2802436689 260
29 iso_pu_bacteria 2802429268 2804752701 260
30 iso_pu_bacteria 2838074704 2838076918 260
31 iso_pu_bacteria 2842922631 2842924112 260
32 iso_pu_bacteria 2848992105 2848994371 260
33 iso_pu_bacteria 2854911287 2854912377 260
34 iso_pu_bacteria 2884338543 2884341641 260
35 iso_pu_bacteria 2889276214 2889280291 260
36 iso_pu_bacteria 2899845264 2899850689 260
37 iso_pu_bacteria 2904595352 2904595779 260
38 iso_pu_bacteria 2919404418 2919406253 260
39 iso_pu_bacteria 2920760137 2920761592 260
40 iso_pu_bacteria 2920822456 2920825154 260
41 iso_pu_bacteria 2926760298 2926762885 260
42 iso_pu_bacteria 2937113482 2937117883 260
43 iso_pu_bacteria 2939702853 2939705379 260
44 iso_pu_bacteria 2957415311 2957417574 260
45 iso_pu_bacteria 2957443900 2957446317 260
46 iso_pu_bacteria 2960617483 2960621463 260
47 iso_pu_bacteria 2960660292 2960661439 260
48 iso_pu_bacteria 2977523885 2977526273 260
49 iso_pu_bacteria 2979089926 2979094623 260
50 iso_pu_bacteria 2979095461 2979100812 260
51 iso_pu_bacteria 2996706504 2996711608 260
52 iso_pu_bacteria 648028048 648170454 260
53 iso_pu_bacteria 650716007 650740501 260
54 iso_pu_bacteria 8011350971 8011351019 260
55 iso_pu_bacteria 8018150411 8018153177 260
56 3300031235 Ga0265330_10080681 Ga0265330_100806812 262
57 3300031239 Ga0265328_10000041 Ga0265328_1000004159 262
58 3300031239 Ga0265328_10000375 Ga0265328_1000037524 262
59 3300031239 Ga0265328_10036327 Ga0265328_100363272 262
60 3300031242 Ga0265329_10044546 Ga0265329_100445462 262
61 3300031250 Ga0265331_10001219 Ga0265331_1000121921 262
62 3300031250 Ga0265331_10008538 Ga0265331_100085382 262
63 3300031251 Ga0265327_10007761 Ga0265327_100077615 262
64 3300031344 Ga0265316_10012475 Ga0265316_100124757 262
65 3300002459 JGI24751J29686_10033308 JGI24751J29686_100333081 264
66 3300002705 JGI25156J39149_1005186 JGI25156J39149_10051862 264
67 3300002737 JGI25162J39368_1000128 JGI25162J39368_10001283 264
68 3300002741 JGI25157J39369_1000211 JGI25157J39369_100021133 264
69 3300002771 JGI25163J39215_1000749 JGI25163J39215_10007493 264
70 3300002772 JGI25164J39214_1000067 JGI25164J39214_100006721 264
71 3300003214 JGI25165J46597_1000167 JGI25165J46597_100016721 264
72 3300003567 Ga0006554J51385_1031742 Ga0006554J51385_10317422 264
73 3300003578 Ga0006562J51391_1003487 Ga0006562J51391_10034872 264
74 3300003578 Ga0006562J51391_1056881 Ga0006562J51391_10568812 264
75 3300003761 Ga0055535_1000074 Ga0055535_10000744 264
76 3300003761 Ga0055535_1000256 Ga0055535_10002569 264
77 3300003762 Ga0055542_1000110 Ga0055542_100011045 264
78 3300003762 Ga0055542_1000206 Ga0055542_100020623 264
79 3300003763 Ga0055529_1000024 Ga0055529_100002472 264
80 3300003763 Ga0055529_1000121 Ga0055529_10001215 264
81 3300005262 Ga0065165_1001503 Ga0065165_10015038 264
82 3300005331 Ga0070670_100161106 Ga0070670_1001611062 264
83 3300005435 Ga0070714_100012754 Ga0070714_1000127544 264
84 3300005468 Ga0070707_100718755 Ga0070707_1007187552 264
85 3300005539 Ga0068853_100000079 Ga0068853_10000007917 264
86 3300005548 Ga0070665_100010357 Ga0070665_1000103575 264
87 3300005564 Ga0070664_100184131 Ga0070664_1001841311 264
88 3300005617 Ga0068859_100012814 Ga0068859_1000128145 264
89 3300006042 Ga0075368_10000115 Ga0075368_100001156 264
90 3300006177 Ga0075362_10053098 Ga0075362_100530982 264
91 3300006186 Ga0075369_10003237 Ga0075369_100032372 264
92 3300006195 Ga0075366_10035289 Ga0075366_100352895 264
93 3300006847 Ga0075431_100075455 Ga0075431_1000754554 264
94 3300006880 Ga0075429_100073246 Ga0075429_1000732462 264
95 3300006931 Ga0097620_100012814 Ga0097620_1000128145 264
96 3300009093 Ga0105240_10153148 Ga0105240_101531484 264
97 3300009094 Ga0111539_10478246 Ga0111539_104782461 264
98 3300009147 Ga0114129_10891201 Ga0114129_108912012 264
99 3300009148 Ga0105243_10016974 Ga0105243_100169747 264
100 3300009174 Ga0105241_10103350 Ga0105241_101033502 264
101 3300013100 Ga0157373_10373246 Ga0157373_103732461 264
102 3300013102 Ga0157371_10063996 Ga0157371_100639963 264
103 3300013104 Ga0157370_10000351 Ga0157370_1000035165 264
104 3300013249 Ga0171463_1003 Ga0171463_1003225 264
105 3300013306 Ga0163162_10003053 Ga0163162_1000305312 264
106 3300013307 Ga0157372_10114956 Ga0157372_101149562 264
107 3300014325 Ga0163163_10004255 Ga0163163_1000425511 264
108 3300014497 Ga0182008_10017288 Ga0182008_100172883 264
109 3300015261 Ga0182006_1061559 Ga0182006_10615591 264
110 3300015690 Ga0183363_1093 Ga0183363_109311 264
111 3300017792 Ga0163161_10112030 Ga0163161_101120302 264
112 3300021327 Ga0214543_1000038 Ga0214543_1000038123 264
113 3300021361 Ga0213872_10006331 Ga0213872_100063314 264
114 3300025206 Ga0209435_101940 Ga0209435_1019402 264
115 3300025207 Ga0209760_100644 Ga0209760_1006446 264
116 3300025224 Ga0209784_100011 Ga0209784_100011222 264
117 3300025228 Ga0209672_100972 Ga0209672_1009729 264
118 3300025228 Ga0209672_102843 Ga0209672_1028433 264
119 3300025231 Ga0207427_100026 Ga0207427_100026110 264
120 3300025233 Ga0209437_100217 Ga0209437_10021770 264
121 3300025242 Ga0209258_100027 Ga0209258_100027325 264
122 3300025242 Ga0209258_100165 Ga0209258_10016540 264
123 3300025246 Ga0209646_1000397 Ga0209646_100039716 264
124 3300025250 Ga0209026_1000018 Ga0209026_1000018219 264
125 3300025254 Ga0209148_1000001 Ga0209148_10000011063 264
126 3300025254 Ga0209148_1000092 Ga0209148_100009241 264
127 3300025256 Ga0209759_1000066 Ga0209759_100006679 264
128 3300025261 Ga0209233_1000002 Ga0209233_10000021167 264
129 3300025272 Ga0209455_1000019 Ga0209455_1000019392 264
130 3300025298 Ga0209050_1000538 Ga0209050_100053840 264
131 3300025911 Ga0207654_10010505 Ga0207654_100105055 264
132 3300025925 Ga0207650_10002806 Ga0207650_1000280611 264
133 3300025935 Ga0207709_10227675 Ga0207709_102276752 264
134 3300025936 Ga0207670_10381624 Ga0207670_103816241 264
135 3300025945 Ga0207679_10155439 Ga0207679_101554391 264
136 3300026041 Ga0207639_10000046 Ga0207639_1000004633 264
137 3300026095 Ga0207676_10261519 Ga0207676_102615191 264
138 3300027665 Ga0209983_1032140 Ga0209983_10321402 264
139 3300028379 Ga0268266_10017271 Ga0268266_100172712 264
140 3300032002 Ga0307416_100159545 Ga0307416_1001595451 264
141 3300032126 Ga0307415_100330816 Ga0307415_1003308162 264
142 3300036401 Ga0373937_0026443 Ga0373937_0026443_1220_2014 264
143 3300037312 Ga0395899_0023210 Ga0395899_0023210_2075_2869 264
144 3300037466 Ga0395898_0000922 Ga0395898_0000922_8376_9170 264
145 3300038727 Ga0400491_10962 Ga0400491_10962_121_915 264
146 3300038741 Ga0400488_04209 Ga0400488_04209_559_1353 264
147 3300039110 Ga0400487_02813 Ga0400487_02813_678_1472 264
148 3300039110 Ga0400487_51829 Ga0400487_51829_3833_4627 264
149 3300039447 Ga0436361_0069717 Ga0436361_0069717_1678_2499 264
150 3300041413 Ga0439465_0088928 Ga0439465_0088928_71_865 264
151 3300041452 Ga0451793_0020339 Ga0451793_0020339_940_1734 264
152 3300042007 Ga0439449_0002827 Ga0439449_0002827_170_964 264
153 3300042438 Ga0439459_0000117 Ga0439459_0000117_6524_7318 264
154 3300042876 Ga0451577_0003143 Ga0451577_0003143_2803_3624 264
155 3300044693 Ga0466961_0000645 Ga0466961_0000645_15654_16448 264
156 3300046459 Ga0495629_0002267 Ga0495629_0002267_2043_2837 264
157 3300046459 Ga0495629_0075936 Ga0495629_0075936_255_1049 264
158 3300046460 Ga0495638_0000497 Ga0495638_0000497_3698_4492 264
159 3300046462 Ga0495651_0076887 Ga0495651_0076887_1447_2241 264
160 3300046476 Ga0495662_0057370 Ga0495662_0057370_553_1347 264
161 3300046477 Ga0495664_0138139 Ga0495664_0138139_130_924 264
162 3300046520 Ga0495637_0052240 Ga0495637_0052240_712_1506 264
163 3300046558 Ga0495633_0048274 Ga0495633_0048274_965_1759 264
164 3300046660 Ga0495625_0008650 Ga0495625_0008650_1671_2465 264
165 3300046660 Ga0495625_0013357 Ga0495625_0013357_362_1156 264
166 3300046674 Ga0495588_0001754 Ga0495588_0001754_1426_2220 264
167 3300046675 Ga0495657_0023715 Ga0495657_0023715_2164_2958 264
168 3300046809 Ga0495600_0006237 Ga0495600_0006237_4090_4884 264
169 3300047470 Ga0495681_0015618 Ga0495681_0015618_1556_2350 264
170 3300048091 Ga0495626_0002661 Ga0495626_0002661_3342_4136 264
171 3300048091 Ga0495626_0008168 Ga0495626_0008168_1262_2056 264
172 3300048913 Ga0496110_0012211 Ga0496110_0012211_256_1050 264
173 3300048914 Ga0496111_0012000 Ga0496111_0012000_4318_5112 264
174 3300048914 Ga0496111_0365525 Ga0496111_0365525_135_929 264
175 3300048916 Ga0496113_0038664 Ga0496113_0038664_2704_3498 264
176 3300048919 Ga0496116_0107101 Ga0496116_0107101_720_1514 264
177 3300048920 Ga0496117_0000002 Ga0496117_0000002_532580_533374 264
178 3300048920 Ga0496117_0005653 Ga0496117_0005653_250_1083 264
179 3300048921 Ga0496118_0000087 Ga0496118_0000087_144139_144933 264
180 3300048921 Ga0496118_0101864 Ga0496118_0101864_107_940 264
181 3300048922 Ga0496119_0015291 Ga0496119_0015291_1129_1923 264
182 3300048922 Ga0496119_0090748 Ga0496119_0090748_52_846 264
183 3300048922 Ga0496119_0097266 Ga0496119_0097266_30_863 264
184 3300048923 Ga0496120_0000180 Ga0496120_0000180_56479_57273 264
185 3300048923 Ga0496120_0012345 Ga0496120_0012345_251_1084 264
186 3300048924 Ga0496121_0020069 Ga0496121_0020069_1182_2015 264
187 3300048925 Ga0496122_0000004 Ga0496122_0000004_56484_57278 264
188 3300048925 Ga0496122_0008984 Ga0496122_0008984_9156_9950 264
189 3300048925 Ga0496122_0029402 Ga0496122_0029402_1434_2267 264
190 3300048926 Ga0496123_0000007 Ga0496123_0000007_56484_57278 264
191 3300048927 Ga0496124_0224383 Ga0496124_0224383_275_1108 264
192 3300048928 Ga0496125_0000412 Ga0496125_0000412_58648_59481 264
193 3300048928 Ga0496125_0201207 Ga0496125_0201207_54_848 264
194 3300048928 Ga0496125_0314070 Ga0496125_0314070_106_900 264
195 3300048929 Ga0496126_0011232 Ga0496126_0011232_5411_6244 264
196 3300048929 Ga0496126_0267507 Ga0496126_0267507_424_1218 264
197 3300049568 Ga0501031_0008597 Ga0501031_0008597_1022_1816 264
198 3300049568 Ga0501031_0146336 Ga0501031_0146336_668_1462 264
199 3300049569 Ga0501032_0053699 Ga0501032_0053699_299_1093 264
200 3300049569 Ga0501032_0082177 Ga0501032_0082177_385_1179 264
201 3300049570 Ga0501033_0090261 Ga0501033_0090261_1049_1843 264
202 3300049571 Ga0501034_0018054 Ga0501034_0018054_4436_5230 264
203 3300049574 Ga0501038_0008714 Ga0501038_0008714_5156_5950 264
204 3300049574 Ga0501038_0199043 Ga0501038_0199043_739_1533 264
205 3300049575 Ga0501039_0238933 Ga0501039_0238933_248_1042 264
206 3300049579 Ga0501043_0106562 Ga0501043_0106562_997_1791 264
207 3300049579 Ga0501043_0183870 Ga0501043_0183870_500_1342 264
208 3300049580 Ga0501046_0005153 Ga0501046_0005153_3060_3854 264
209 3300049581 Ga0501047_0503707 Ga0501047_0503707_196_990 264
210 3300049586 Ga0501070_0015026 Ga0501070_0015026_4024_4866 264
211 3300049586 Ga0501070_0019669 Ga0501070_0019669_4486_5280 264
212 3300049586 Ga0501070_0036125 Ga0501070_0036125_1967_2920 264
213 3300049590 Ga0501074_0017584 Ga0501074_0017584_2217_3059 264
214 3300049590 Ga0501074_0043816 Ga0501074_0043816_2226_3020 264
215 3300049669 Ga0501235_004215 Ga0501235_004215_1936_2730 264
216 3300049741 Ga0501079_0160831 Ga0501079_0160831_348_1190 264
217 3300049742 Ga0501080_0000611 Ga0501080_0000611_8201_9046 264
218 3300049822 Ga0501035_0098191 Ga0501035_0098191_223_1017 264
219 3300049822 Ga0501035_0223351 Ga0501035_0223351_723_1517 264
220 3300049823 Ga0501044_0131586 Ga0501044_0131586_982_1776 264
221 3300049823 Ga0501044_0206611 Ga0501044_0206611_963_1757 264
222 3300049823 Ga0501044_0362680 Ga0501044_0362680_158_1003 264
223 3300050489 nmdc:mga03683_103743_c1 nmdc:mga03683_103743_c1_417_1211 264
224 3300050491 nmdc:mga00v17_12_c1 nmdc:mga00v17_12_c1_79339_80133 264
225 3300050492 nmdc:mga0yw44_2944_c1 nmdc:mga0yw44_2944_c1_412_1206 264
226 3300050493 nmdc:mga0k408_41193_c1 nmdc:mga0k408_41193_c1_1776_2570 264
227 3300050494 nmdc:mga06z11_31333_c1 nmdc:mga06z11_31333_c1_142_936 264
228 3300050496 nmdc:mga07m45_171076_c1 nmdc:mga07m45_171076_c1_83_877 264
229 3300050510 nmdc:mga06r32_46368_c1 nmdc:mga06r32_46368_c1_1860_2654 264
230 3300050516 nmdc:mga0sz30_234_c1 nmdc:mga0sz30_234_c1_4167_4961 264
231 3300053085 Ga0495619_0025327 Ga0495619_0025327_494_1288 264
232 3300053137 Ga0500561_0000158 Ga0500561_0000158_1406_2200 264
233 3300053139 Ga0500568_0140107 Ga0500568_0140107_59_853 264
234 3300053161 Ga0500634_0010642 Ga0500634_0010642_2413_3207 264
235 3300053730 Ga0500645_030759 Ga0500645_030759_490_1284 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

2

266

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b5b-assembly1.cif.gz_B crystal structure of the thymidylate synthase k48q 0.9854 1 264
1fwm-assembly1.cif.gz_B crystal structure of the thymidylate synthase r166q mutant 0.9846 3 264
4fog-assembly2.cif.gz_B crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid 0.9842 1 261
3bfi-assembly1.cif.gz_A-2 e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump 0.9838 3 264
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.9836 3 262
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9743 2 250 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9701 2 264 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9629 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.96 2 262 3.30.572.10
af_P06785_1_304_3.30.572.10 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9528 3 264 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A2H6J9D6-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.994 141 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A352HMS8-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.993 151 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A2E8YSB0-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9918 145 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A3B8HDY4-F1-model_v4 deleted 0.9915 119 249
AF-A0A355SVW1-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.991 163 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.54 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map