F348223

General Info

Members Datasets Scaffolds Average Seq Length
235 138 470 259

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10156520|Ga0207689_101565202
Length 273
Sequence MPGSREVVLEDDATANRGAILGRRVAIAFSVLVFMNVLFGLYAIGFIGNFGVPSTLDGKPRGDLAAAFAIDAGLLALFAVQHSLMARKWFKQWWTKFVPQPIERSTYTLFSSVALILLFWQWRPMGGVVWSIEDPVVSTILRVLFAFGFGLVLVSTFLINHFDLFGLRQVWLYLLGKPYTMLHFGTPGPYRVVRHPLYVGWLFAFWATPTMTLAHLLFSILTTAYILLAIGWEEKDLASEHGASYENYRRSVPMLVPFTRRGKAEALSAPANK

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0.43
Rhizoplane 4.68
Rhizosphere 90.64
Stem 0
Stem Tuber 0
Unclassified 10.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10156520 3300025942 Bacteria 1878
2 Ga0065704_10018727 3300005289 Bacteria 2009
3 Ga0065715_10105261 3300005293 Bacteria 2905
4 Ga0070670_100052367 3300005331 Bacteria 3506
5 Ga0070677_10110504 3300005333 Bacteria 1226
6 Ga0068869_100067027 3300005334 Bacteria 2647
7 Ga0070680_100115553 3300005336 Bacteria 2236
8 Ga0070680_100369642 3300005336 Bacteria 1220
9 Ga0070682_100010010 3300005337 Bacteria 5370
10 Ga0070687_100031723 3300005343 Bacteria 2594
11 Ga0070687_100074393 3300005343 Bacteria 1834
12 Ga0070661_100002412 3300005344 Bacteria 12820
13 Ga0070692_10002697 3300005345 Bacteria 6958
14 Ga0070692_10101314 3300005345 Bacteria 1579
15 Ga0070669_100017612 3300005353 Bacteria 5096
16 Ga0070673_100565776 3300005364 Bacteria 1034
17 Ga0070667_100155288 3300005367 Bacteria 2012
18 Ga0070703_10005808 3300005406 Bacteria 3456
19 Ga0070705_100070561 3300005440 Bacteria 2110
20 Ga0070700_100036313 3300005441 Bacteria 2987
21 Ga0070700_100104838 3300005441 Bacteria 1869
22 Ga0070700_100199203 3300005441 Bacteria 1405
23 Ga0070700_100208505 3300005441 Bacteria 1377
24 Ga0070694_100128430 3300005444 Bacteria 1828
25 Ga0070662_100339621 3300005457 Bacteria 1228
26 Ga0070681_10030334 3300005458 Bacteria 5425
27 Ga0068867_100144781 3300005459 Bacteria 1861
28 Ga0070685_10048881 3300005466 Bacteria 2438
29 Ga0070698_100834384 3300005471 Bacteria 866
30 Ga0070699_100037232 3300005518 Bacteria 4209
31 Ga0070699_100077517 3300005518 Bacteria 2894
32 Ga0070679_100018314 3300005530 Bacteria 6794
33 Ga0070679_100051035 3300005530 Bacteria 4120
34 Ga0070684_100027219 3300005535 Bacteria 4823
35 Ga0070684_100305056 3300005535 Bacteria 1461
36 Ga0070697_100471803 3300005536 Bacteria 1095
37 Ga0070686_100195449 3300005544 Bacteria 1447
38 Ga0070695_100108803 3300005545 Bacteria 1877
39 Ga0070696_100000011 3300005546 Bacteria 82210
40 Ga0070696_100171293 3300005546 Bacteria 1605
41 Ga0070693_100108556 3300005547 Bacteria 1703
42 Ga0070665_100730548 3300005548 Bacteria 1003
43 Ga0070704_100002439 3300005549 Bacteria 10431
44 Ga0070704_100074388 3300005549 Bacteria 2478
45 Ga0070704_100121233 3300005549 Bacteria 2009
46 Ga0070704_100281060 3300005549 Bacteria 1379
47 Ga0070664_100039166 3300005564 Bacteria 3993
48 Ga0070664_100212894 3300005564 Bacteria 1727
49 Ga0068857_100015223 3300005577 Bacteria 6712
50 Ga0068854_100466383 3300005578 Bacteria 1058
51 Ga0070702_100008647 3300005615 Unclassified 4943
52 Ga0068852_100757630 3300005616 Unclassified 983
53 Ga0068859_100002448 3300005617 Bacteria 18902
54 Ga0068859_100034936 3300005617 Bacteria 5043
55 Ga0068859_100182136 3300005617 Bacteria 2184
56 Ga0068864_100172956 3300005618 Bacteria 1970
57 Ga0068864_100249186 3300005618 Unclassified 1648
58 Ga0068864_100287090 3300005618 Unclassified 1537
59 Ga0068864_100363727 3300005618 Bacteria 1368
60 Ga0068861_100012216 3300005719 Bacteria 5987
61 Ga0068861_100058250 3300005719 Bacteria 2954
62 Ga0068861_100078532 3300005719 Bacteria 2578
63 Ga0068851_10026842 3300005834 Bacteria 2833
64 Ga0068870_10008440 3300005840 Bacteria 4634
65 Ga0068870_10099299 3300005840 Bacteria 1642
66 Ga0068870_10372913 3300005840 Unclassified 922
67 Ga0068863_100037416 3300005841 Bacteria 4621
68 Ga0068858_100046734 3300005842 Bacteria 4012
69 Ga0068858_100183472 3300005842 Bacteria 1976
70 Ga0068858_100532466 3300005842 Bacteria 1137
71 Ga0068860_100275014 3300005843 Bacteria 1644
72 Ga0068862_100100188 3300005844 Bacteria 2533
73 Ga0068862_100209936 3300005844 Bacteria 1759
74 Ga0068862_100289453 3300005844 Bacteria 1504
75 Ga0081455_10002568 3300005937 Bacteria 21552
76 Ga0075364_10027462 3300006051 Bacteria 3636
77 Ga0075362_10051382 3300006177 Bacteria 1845
78 Ga0075366_10178684 3300006195 Bacteria 1289
79 Ga0097621_100063012 3300006237 Bacteria 3046
80 Ga0068871_100024639 3300006358 Bacteria 4668
81 Ga0075428_100013423 3300006844 Bacteria 9112
82 Ga0075428_100028168 3300006844 Bacteria 6214
83 Ga0075428_100107778 3300006844 Bacteria 3036
84 Ga0075428_100125278 3300006844 Bacteria 2796
85 Ga0075430_100132543 3300006846 Bacteria 2077
86 Ga0075430_100537347 3300006846 Bacteria 964
87 Ga0075431_100002465 3300006847 Bacteria 17827
88 Ga0075431_100040791 3300006847 Bacteria 4784
89 Ga0075431_100104665 3300006847 Bacteria 2920
90 Ga0075431_100112077 3300006847 Bacteria 2815
91 Ga0075433_10007772 3300006852 Bacteria 8520
92 Ga0075433_10092492 3300006852 Bacteria 2675
93 Ga0075433_10186473 3300006852 Bacteria 1846
94 Ga0075433_10559957 3300006852 Bacteria 1004
95 Ga0075434_100149478 3300006871 Bacteria 2356
96 Ga0075429_100004765 3300006880 Bacteria 11677
97 Ga0075429_100075462 3300006880 Unclassified 2937
98 Ga0075429_100135613 3300006880 Bacteria 2154
99 Ga0075436_100511979 3300006914 Bacteria 879
100 Ga0097620_100002448 3300006931 Bacteria 18902
101 Ga0097620_100034936 3300006931 Bacteria 5043
102 Ga0097620_100182138 3300006931 Bacteria 2184
103 Ga0097620_100691712 3300006931 Unclassified 1111
104 Ga0075435_100104533 3300007076 Bacteria 2350
105 Ga0075435_100271472 3300007076 Bacteria 1447
106 Ga0111539_10003695 3300009094 Bacteria 20132
107 Ga0111539_10074407 3300009094 Bacteria 4002
108 Ga0111539_10095655 3300009094 Bacteria 3489
109 Ga0105245_10453240 3300009098 Unclassified 1292
110 Ga0114129_10005639 3300009147 Bacteria 17714
111 Ga0114129_10020331 3300009147 Bacteria 9444
112 Ga0114129_10122670 3300009147 Unclassified 3575
113 Ga0114129_10178608 3300009147 Bacteria 2890
114 Ga0114129_10946363 3300009147 Unclassified 1088
115 Ga0105243_10225249 3300009148 Bacteria 1660
116 Ga0105242_10045680 3300009176 Bacteria 3550
117 Ga0105248_10014664 3300009177 Bacteria 8625
118 Ga0105248_10040603 3300009177 Bacteria 5216
119 Ga0105248_10190941 3300009177 Bacteria 2308
120 Ga0105248_10536300 3300009177 Bacteria 1320
121 Ga0105237_10001794 3300009545 Bacteria 27716
122 Ga0105238_10000777 3300009551 Bacteria 33195
123 Ga0105249_10009769 3300009553 Bacteria 8404
124 Ga0105249_10081767 3300009553 Bacteria 3004
125 Ga0157373_10004268 3300013100 Bacteria 10763
126 Ga0157373_10055142 3300013100 Bacteria 2823
127 Ga0157378_10001325 3300013297 Bacteria 22248
128 Ga0157378_10015478 3300013297 Bacteria 6682
129 Ga0157378_10056799 3300013297 Bacteria 3488
130 Ga0163162_10139748 3300013306 Bacteria 2534
131 Ga0163162_10428933 3300013306 Bacteria 1454
132 Ga0157372_10051073 3300013307 Unclassified 4600
133 Ga0157375_10383116 3300013308 Bacteria 1573
134 Ga0157375_10502897 3300013308 Unclassified 1376
135 Ga0163163_10030499 3300014325 Bacteria 5196
136 Ga0163163_10153367 3300014325 Bacteria 2347
137 Ga0163163_10938247 3300014325 Unclassified 929
138 Ga0157380_10040728 3300014326 Bacteria 3621
139 Ga0157380_10047769 3300014326 Bacteria 3368
140 Ga0157380_10225037 3300014326 Bacteria 1681
141 Ga0157379_10090033 3300014968 Bacteria 2753
142 Ga0213876_10000053 3300021384 Bacteria 142404
143 Ga0207647_10115605 3300025904 Bacteria 1584
144 Ga0207643_10005127 3300025908 Bacteria 7010
145 Ga0207643_10157724 3300025908 Bacteria 1364
146 Ga0207684_10031090 3300025910 Bacteria 4544
147 Ga0207671_10001931 3300025914 Bacteria 22991
148 Ga0207660_10170617 3300025917 Bacteria 1684
149 Ga0207662_10111257 3300025918 Bacteria 1708
150 Ga0207662_10265610 3300025918 Bacteria 1131
151 Ga0207681_10018067 3300025923 Bacteria 4438
152 Ga0207694_10006854 3300025924 Bacteria 8652
153 Ga0207650_10038440 3300025925 Bacteria 3495
154 Ga0207659_10395114 3300025926 Unclassified 1155
155 Ga0207686_10185256 3300025934 Bacteria 1479
156 Ga0207711_10003066 3300025941 Bacteria 14586
157 Ga0207689_10096564 3300025942 Bacteria 2427
158 Ga0207712_10133395 3300025961 Bacteria 1896
159 Ga0207703_10155689 3300026035 Bacteria 1997
160 Ga0207703_10216985 3300026035 Bacteria 1708
161 Ga0207703_10227369 3300026035 Bacteria 1671
162 Ga0207708_10030406 3300026075 Unclassified 4094
163 Ga0207708_10036568 3300026075 Bacteria 3739
164 Ga0207708_10042157 3300026075 Bacteria 3480
165 Ga0207708_10111752 3300026075 Bacteria 2121
166 Ga0207702_10566165 3300026078 Bacteria 1112
167 Ga0207641_10535920 3300026088 Unclassified 1140
168 Ga0207648_10047753 3300026089 Bacteria 3751
169 Ga0207676_10176656 3300026095 Unclassified 1866
170 Ga0207676_10341519 3300026095 Bacteria 1382
171 Ga0207675_100075679 3300026118 Bacteria 3152
172 Ga0207675_100098017 3300026118 Bacteria 2761
173 Ga0207675_100099438 3300026118 Bacteria 2740
174 Ga0207428_10005295 3300027907 Bacteria 12044
175 Ga0207428_10032948 3300027907 Bacteria 4259
176 Ga0207428_10068023 3300027907 Bacteria 2803
177 Ga0268265_10158449 3300028380 Bacteria 1919
178 Ga0268265_10449853 3300028380 Bacteria 1203
179 Ga0268265_10906930 3300028380 Bacteria 866
180 Ga0268264_10038988 3300028381 Bacteria 3924
181 Ga0268264_10745474 3300028381 Bacteria 975
182 Ga0307515_10302172 3300028794 Bacteria 1284
183 Ga0265327_10003998 3300031251 Bacteria 13439
184 Ga0395899_0152841 3300037312 Bacteria 1635
185 Ga0395900_0408419 3300037418 Bacteria 1321
186 Ga0395898_0556384 3300037466 Bacteria 1089
187 Ga0395905_0191529 3300037471 Bacteria 1918
188 Ga0395901_0078420 3300038443 Bacteria 3449
189 Ga0395901_0221556 3300038443 Bacteria 1977
190 Ga0242420_012470 3300038996 Bacteria 1440
191 Ga0436365_0873465 3300039437 Bacteria 246686
192 Ga0451793_0199485 3300041452 Bacteria 1285
193 Ga0495580_0071019 3300046472 Bacteria 2432
194 Ga0495599_0120775 3300046678 Bacteria 1629
195 Ga0495674_0184530 3300047319 Unclassified 1736
196 Ga0496102_0055273 3300048905 Bacteria 3620
197 Ga0496104_0034439 3300048907 Bacteria 4723
198 Ga0496104_0050842 3300048907 Bacteria 3910
199 Ga0496106_0203799 3300048909 Bacteria 1575
200 Ga0496106_0498687 3300048909 Bacteria 978
201 Ga0496108_0526557 3300048911 Bacteria 1032
202 Ga0496109_0000118 3300048912 Bacteria 81929
203 Ga0496112_0017328 3300048915 Bacteria 6766
204 Ga0496112_0178102 3300048915 Bacteria 2090
205 Ga0496113_0117084 3300048916 Unclassified 2080
206 Ga0501047_0107981 3300049581 Bacteria 2665
207 Ga0501081_0056712 3300049743 Bacteria 2708
208 nmdc:mga00v17_116880_c1 3300050491 Bacteria 1696
209 nmdc:mga0k408_220558_c1 3300050493 Bacteria 1132
210 nmdc:mga05p37_1019_c1 3300050507 Bacteria 31878
211 nmdc:mga05p37_103992_c1 3300050507 Unclassified 3494
212 nmdc:mga05p37_117048_c1 3300050507 Bacteria 3275
213 nmdc:mga05p37_14450_c1 3300050507 Bacteria 9477
214 nmdc:mga05p37_211070_c1 3300050507 Bacteria 2347
215 nmdc:mga09592_159204_c1 3300050508 Bacteria 1950
216 nmdc:mga09592_165629_c1 3300050508 Unclassified 1910
217 nmdc:mga0qj67_111472_c1 3300050509 Bacteria 2209
218 nmdc:mga0qj67_477834_c1 3300050509 Bacteria 1003
219 nmdc:mga06r32_1059_c1 3300050510 Bacteria 24878
220 nmdc:mga06r32_24859_c1 3300050510 Bacteria 5566
221 nmdc:mga06r32_25643_c1 3300050510 Bacteria 5487
222 nmdc:mga06r32_91375_c1 3300050510 Bacteria 2975
223 nmdc:mga08y16_1526_c1 3300050511 Bacteria 23292
224 nmdc:mga08y16_186887_c1 3300050511 Bacteria 2150
225 nmdc:mga08y16_19814_c1 3300050511 Bacteria 7092
226 nmdc:mga0n895_151687_c1 3300050512 Unclassified 2348
227 nmdc:mga0n895_827872_c1 3300050512 Unclassified 914
228 nmdc:mga0rr50_13766_c1 3300050513 Bacteria 5280
229 nmdc:mga0rr50_32038_c1 3300050513 Bacteria 3740
230 nmdc:mga0a205_112617_c1 3300050515 Bacteria 2620
231 nmdc:mga0a205_179947_c1 3300050515 Unclassified 2009
232 nmdc:mga0a205_301645_c1 3300050515 Bacteria 1475
233 Ga0500641_0026491 3300053096 Bacteria 2251
234 Ga0500555_008459 3300053103 Bacteria 2934
235 643602650 643348564 Bacteria 8839022
236 Ga0207689_10156520
237 Ga0065704_10018727
238 Ga0065715_10105261
239 Ga0070670_100052367
240 Ga0070677_10110504
241 Ga0068869_100067027
242 Ga0070680_100115553
243 Ga0070680_100369642
244 Ga0070682_100010010
245 Ga0070687_100031723
246 Ga0070687_100074393
247 Ga0070661_100002412
248 Ga0070692_10002697
249 Ga0070692_10101314
250 Ga0070669_100017612
251 Ga0070673_100565776
252 Ga0070667_100155288
253 Ga0070703_10005808
254 Ga0070705_100070561
255 Ga0070700_100036313
256 Ga0070700_100104838
257 Ga0070700_100199203
258 Ga0070700_100208505
259 Ga0070694_100128430
260 Ga0070662_100339621
261 Ga0070681_10030334
262 Ga0068867_100144781
263 Ga0070685_10048881
264 Ga0070698_100834384
265 Ga0070699_100037232
266 Ga0070699_100077517
267 Ga0070679_100018314
268 Ga0070679_100051035
269 Ga0070684_100027219
270 Ga0070684_100305056
271 Ga0070697_100471803
272 Ga0070686_100195449
273 Ga0070695_100108803
274 Ga0070696_100000011
275 Ga0070696_100171293
276 Ga0070693_100108556
277 Ga0070665_100730548
278 Ga0070704_100002439
279 Ga0070704_100074388
280 Ga0070704_100121233
281 Ga0070704_100281060
282 Ga0070664_100039166
283 Ga0070664_100212894
284 Ga0068857_100015223
285 Ga0068854_100466383
286 Ga0070702_100008647
287 Ga0068852_100757630
288 Ga0068859_100002448
289 Ga0068859_100034936
290 Ga0068859_100182136
291 Ga0068864_100172956
292 Ga0068864_100249186
293 Ga0068864_100287090
294 Ga0068864_100363727
295 Ga0068861_100012216
296 Ga0068861_100058250
297 Ga0068861_100078532
298 Ga0068851_10026842
299 Ga0068870_10008440
300 Ga0068870_10099299
301 Ga0068870_10372913
302 Ga0068863_100037416
303 Ga0068858_100046734
304 Ga0068858_100183472
305 Ga0068858_100532466
306 Ga0068860_100275014
307 Ga0068862_100100188
308 Ga0068862_100209936
309 Ga0068862_100289453
310 Ga0081455_10002568
311 Ga0075364_10027462
312 Ga0075362_10051382
313 Ga0075366_10178684
314 Ga0097621_100063012
315 Ga0068871_100024639
316 Ga0075428_100013423
317 Ga0075428_100028168
318 Ga0075428_100107778
319 Ga0075428_100125278
320 Ga0075430_100132543
321 Ga0075430_100537347
322 Ga0075431_100002465
323 Ga0075431_100040791
324 Ga0075431_100104665
325 Ga0075431_100112077
326 Ga0075433_10007772
327 Ga0075433_10092492
328 Ga0075433_10186473
329 Ga0075433_10559957
330 Ga0075434_100149478
331 Ga0075429_100004765
332 Ga0075429_100075462
333 Ga0075429_100135613
334 Ga0075436_100511979
335 Ga0097620_100002448
336 Ga0097620_100034936
337 Ga0097620_100182138
338 Ga0097620_100691712
339 Ga0075435_100104533
340 Ga0075435_100271472
341 Ga0111539_10003695
342 Ga0111539_10074407
343 Ga0111539_10095655
344 Ga0105245_10453240
345 Ga0114129_10005639
346 Ga0114129_10020331
347 Ga0114129_10122670
348 Ga0114129_10178608
349 Ga0114129_10946363
350 Ga0105243_10225249
351 Ga0105242_10045680
352 Ga0105248_10014664
353 Ga0105248_10040603
354 Ga0105248_10190941
355 Ga0105248_10536300
356 Ga0105237_10001794
357 Ga0105238_10000777
358 Ga0105249_10009769
359 Ga0105249_10081767
360 Ga0157373_10004268
361 Ga0157373_10055142
362 Ga0157378_10001325
363 Ga0157378_10015478
364 Ga0157378_10056799
365 Ga0163162_10139748
366 Ga0163162_10428933
367 Ga0157372_10051073
368 Ga0157375_10383116
369 Ga0157375_10502897
370 Ga0163163_10030499
371 Ga0163163_10153367
372 Ga0163163_10938247
373 Ga0157380_10040728
374 Ga0157380_10047769
375 Ga0157380_10225037
376 Ga0157379_10090033
377 Ga0213876_10000053
378 Ga0207647_10115605
379 Ga0207643_10005127
380 Ga0207643_10157724
381 Ga0207684_10031090
382 Ga0207671_10001931
383 Ga0207660_10170617
384 Ga0207662_10111257
385 Ga0207662_10265610
386 Ga0207681_10018067
387 Ga0207694_10006854
388 Ga0207650_10038440
389 Ga0207659_10395114
390 Ga0207686_10185256
391 Ga0207711_10003066
392 Ga0207689_10096564
393 Ga0207712_10133395
394 Ga0207703_10155689
395 Ga0207703_10216985
396 Ga0207703_10227369
397 Ga0207708_10030406
398 Ga0207708_10036568
399 Ga0207708_10042157
400 Ga0207708_10111752
401 Ga0207702_10566165
402 Ga0207641_10535920
403 Ga0207648_10047753
404 Ga0207676_10176656
405 Ga0207676_10341519
406 Ga0207675_100075679
407 Ga0207675_100098017
408 Ga0207675_100099438
409 Ga0207428_10005295
410 Ga0207428_10032948
411 Ga0207428_10068023
412 Ga0268265_10158449
413 Ga0268265_10449853
414 Ga0268265_10906930
415 Ga0268264_10038988
416 Ga0268264_10745474
417 Ga0307515_10302172
418 Ga0265327_10003998
419 Ga0395899_0152841
420 Ga0395900_0408419
421 Ga0395898_0556384
422 Ga0395905_0191529
423 Ga0395901_0078420
424 Ga0395901_0221556
425 Ga0242420_012470
426 Ga0436365_0873465
427 Ga0451793_0199485
428 Ga0495580_0071019
429 Ga0495599_0120775
430 Ga0495674_0184530
431 Ga0496102_0055273
432 Ga0496104_0034439
433 Ga0496104_0050842
434 Ga0496106_0203799
435 Ga0496106_0498687
436 Ga0496108_0526557
437 Ga0496109_0000118
438 Ga0496112_0017328
439 Ga0496112_0178102
440 Ga0496113_0117084
441 Ga0501047_0107981
442 Ga0501081_0056712
443 nmdc:mga00v17_116880_c1
444 nmdc:mga0k408_220558_c1
445 nmdc:mga05p37_1019_c1
446 nmdc:mga05p37_103992_c1
447 nmdc:mga05p37_117048_c1
448 nmdc:mga05p37_14450_c1
449 nmdc:mga05p37_211070_c1
450 nmdc:mga09592_159204_c1
451 nmdc:mga09592_165629_c1
452 nmdc:mga0qj67_111472_c1
453 nmdc:mga0qj67_477834_c1
454 nmdc:mga06r32_1059_c1
455 nmdc:mga06r32_24859_c1
456 nmdc:mga06r32_25643_c1
457 nmdc:mga06r32_91375_c1
458 nmdc:mga08y16_1526_c1
459 nmdc:mga08y16_186887_c1
460 nmdc:mga08y16_19814_c1
461 nmdc:mga0n895_151687_c1
462 nmdc:mga0n895_827872_c1
463 nmdc:mga0rr50_13766_c1
464 nmdc:mga0rr50_32038_c1
465 nmdc:mga0a205_112617_c1
466 nmdc:mga0a205_179947_c1
467 nmdc:mga0a205_301645_c1
468 Ga0500641_0026491
469 Ga0500555_008459
470 643602650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07298

NnrU

NnrU protein

72

234

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.3868 2 242
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.373 2 242
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.3706 4 242
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.3581 4 242
5d8s-assembly1.cif.gz_B-2 2.55a resolution structure of bfrb (e85a) from pseudomonas aeruginosa 0.2855 43 158
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9917 49 240 1.20.120.1630
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9815 49 240 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8261 51 210 1.20.120.1630
af_Q54JG5_70_234_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8029 52 209 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7811 51 210 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A3M9Z1B1-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9965 3 244 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A357EYR7-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9933 18 239 GO:0008168
GO:0016020
GO:0032259
AF-A0A2E7EH00-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9933 2 239 GO:0008168
GO:0016020
GO:0032259
AF-A0A1Q4R7G2-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9906 2 241 GO:0008168
GO:0016020
GO:0032259
AF-A0A1A3CI96-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9905 3 239 GO:0008168
GO:0016020
GO:0032259

Map