F348210

General Info

Members Datasets Scaffolds Average Seq Length
235 136 235 72

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_11935541|Ga0207700_119355411
Length 81
Sequence MIAALGTLVFLVTLWMLVVVGAAVLEESGAKIAAALKGKPLTRQIVAPVRLRTRVRMQQPMRCGGGHRHSTWPRNVPANWA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
99 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
100 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
118 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
119 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
120 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
121 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
122 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
123 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
124 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
125 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
126 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
127 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
128 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
129 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
130 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
131 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
132 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
133 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 3.83
Rhizosphere 94.89
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10127400 3300003323 Bacteria 1264
2 Ga0065715_10786395 3300005293 Unclassified 595
3 Ga0070658_10047934 3300005327 Bacteria 3458
4 Ga0070658_10130208 3300005327 Bacteria 2096
5 Ga0070658_10228126 3300005327 Bacteria 1576
6 Ga0070658_10702888 3300005327 Bacteria 877
7 Ga0070658_11346833 3300005327 Bacteria 620
8 Ga0070676_10342611 3300005328 Bacteria 1025
9 Ga0070683_100173741 3300005329 Bacteria 2045
10 Ga0070690_100728138 3300005330 Bacteria 764
11 Ga0070690_101165172 3300005330 Bacteria 613
12 Ga0070670_100053167 3300005331 Bacteria 3478
13 Ga0070670_100653287 3300005331 Bacteria 943
14 Ga0070670_101018465 3300005331 Bacteria 753
15 Ga0068868_100294624 3300005338 Bacteria 1376
16 Ga0070660_100106252 3300005339 Bacteria 2229
17 Ga0070660_100164431 3300005339 Bacteria 1789
18 Ga0070660_100719203 3300005339 Bacteria 838
19 Ga0070661_100030524 3300005344 Bacteria 3894
20 Ga0070661_100050308 3300005344 Bacteria 3049
21 Ga0070661_100291777 3300005344 Bacteria 1267
22 Ga0070661_100894803 3300005344 Bacteria 732
23 Ga0070661_101655483 3300005344 Bacteria 542
24 Ga0070692_10290793 3300005345 Bacteria 994
25 Ga0070674_100045758 3300005356 Bacteria 2990
26 Ga0070674_100651853 3300005356 Bacteria 895
27 Ga0070673_100319567 3300005364 Bacteria 1371
28 Ga0070673_100464468 3300005364 Unclassified 1140
29 Ga0070659_100024088 3300005366 Bacteria 4664
30 Ga0070659_101358187 3300005366 Unclassified 631
31 Ga0070667_100435148 3300005367 Bacteria 1197
32 Ga0070714_100050661 3300005435 Bacteria 3538
33 Ga0070714_100680682 3300005435 Unclassified 992
34 Ga0070713_100112607 3300005436 Bacteria 2374
35 Ga0070663_100097506 3300005455 Bacteria 2189
36 Ga0070663_100159368 3300005455 Bacteria 1736
37 Ga0070678_100178193 3300005456 Bacteria 1737
38 Ga0070678_101013734 3300005456 Bacteria 763
39 Ga0070662_100009053 3300005457 Bacteria 6497
40 Ga0070662_100936947 3300005457 Bacteria 740
41 Ga0070662_100953207 3300005457 Bacteria 733
42 Ga0068867_100804414 3300005459 Unclassified 839
43 Ga0070679_100207710 3300005530 Bacteria 1922
44 Ga0068853_100127549 3300005539 Bacteria 2274
45 Ga0070672_101681695 3300005543 Bacteria 570
46 Ga0070672_102007493 3300005543 Bacteria 521
47 Ga0070665_100536622 3300005548 Bacteria 1182
48 Ga0070665_101728503 3300005548 Unclassified 633
49 Ga0070664_100004709 3300005564 Bacteria 10941
50 Ga0070664_100015923 3300005564 Bacteria 6157
51 Ga0070664_100098885 3300005564 Bacteria 2535
52 Ga0070664_100560038 3300005564 Bacteria 1057
53 Ga0070664_101089522 3300005564 Bacteria 752
54 Ga0070664_102095095 3300005564 Unclassified 537
55 Ga0068857_100374306 3300005577 Bacteria 1321
56 Ga0068854_100083893 3300005578 Bacteria 2356
57 Ga0068854_101464986 3300005578 Bacteria 619
58 Ga0068856_100784865 3300005614 Bacteria 972
59 Ga0068856_102177275 3300005614 Bacteria 564
60 Ga0068852_100062378 3300005616 Bacteria 3242
61 Ga0068852_100094228 3300005616 Bacteria 2685
62 Ga0068852_100251169 3300005616 Bacteria 1694
63 Ga0068852_100391585 3300005616 Bacteria 1365
64 Ga0068852_100412566 3300005616 Bacteria 1331
65 Ga0068852_101225802 3300005616 Bacteria 771
66 Ga0068864_100476478 3300005618 Bacteria 1197
67 Ga0068866_10393861 3300005718 Bacteria 892
68 Ga0068851_10029973 3300005834 Bacteria 2696
69 Ga0068851_10126398 3300005834 Unclassified 1379
70 Ga0068851_11109910 3300005834 Unclassified 502
71 Ga0068863_100194923 3300005841 Bacteria 1947
72 Ga0068858_100035844 3300005842 Bacteria 4601
73 Ga0068860_100035287 3300005843 Bacteria 4798
74 Ga0070717_10312199 3300006028 Bacteria 1399
75 Ga0075364_10537713 3300006051 Bacteria 799
76 Ga0097621_100910126 3300006237 Bacteria 820
77 Ga0105248_10014966 3300009177 Bacteria 8540
78 Ga0105248_11351164 3300009177 Bacteria 806
79 Ga0157371_10553129 3300013102 Bacteria 853
80 Ga0157369_10988144 3300013105 Bacteria 862
81 Ga0157374_10259888 3300013296 Bacteria 1710
82 Ga0157375_10307918 3300013308 Bacteria 1748
83 Ga0163161_10459496 3300017792 Bacteria 1030
84 Ga0207656_10057128 3300025321 Bacteria 1702
85 Ga0207682_10188456 3300025893 Bacteria 944
86 Ga0207642_10089780 3300025899 Bacteria 1515
87 Ga0207645_10488635 3300025907 Bacteria 833
88 Ga0207705_10013482 3300025909 Bacteria 5898
89 Ga0207705_10240646 3300025909 Bacteria 1378
90 Ga0207705_11017528 3300025909 Bacteria 640
91 Ga0207705_11438747 3300025909 Unclassified 523
92 Ga0207660_10000409 3300025917 Bacteria 28305
93 Ga0207660_10512226 3300025917 Bacteria 974
94 Ga0207657_10101957 3300025919 Bacteria 2381
95 Ga0207657_10691033 3300025919 Bacteria 793
96 Ga0207657_11175030 3300025919 Bacteria 584
97 Ga0207657_11280384 3300025919 Unclassified 555
98 Ga0207649_10037332 3300025920 Bacteria 2934
99 Ga0207649_10220818 3300025920 Bacteria 1350
100 Ga0207649_10608212 3300025920 Bacteria 841
101 Ga0207649_10824119 3300025920 Bacteria 725
102 Ga0207652_10413735 3300025921 Bacteria 1216
103 Ga0207652_10747772 3300025921 Bacteria 870
104 Ga0207650_10045422 3300025925 Bacteria 3232
105 Ga0207650_10079035 3300025925 Bacteria 2490
106 Ga0207650_10179625 3300025925 Bacteria 1686
107 Ga0207650_11092359 3300025925 Bacteria 679
108 Ga0207659_10008061 3300025926 Bacteria 6520
109 Ga0207700_10290336 3300025928 Bacteria 1409
110 Ga0207700_11935541 3300025928 Unclassified 516
111 Ga0207664_10475384 3300025929 Bacteria 1117
112 Ga0207664_10909167 3300025929 Bacteria 790
113 Ga0207644_10001230 3300025931 Bacteria 16503
114 Ga0207644_10331447 3300025931 Bacteria 1232
115 Ga0207690_10065441 3300025932 Bacteria 2486
116 Ga0207690_10648935 3300025932 Bacteria 865
117 Ga0207706_10017460 3300025933 Bacteria 6465
118 Ga0207706_10145248 3300025933 Bacteria 2086
119 Ga0207706_10261027 3300025933 Bacteria 1512
120 Ga0207706_10454784 3300025933 Bacteria 1107
121 Ga0207706_10808644 3300025933 Bacteria 796
122 Ga0207669_10032825 3300025937 Bacteria 2921
123 Ga0207669_10394262 3300025937 Unclassified 1082
124 Ga0207669_10468375 3300025937 Bacteria 1002
125 Ga0207704_10062364 3300025938 Bacteria 2318
126 Ga0207691_11201996 3300025940 Bacteria 628
127 Ga0207711_10015535 3300025941 Bacteria 6319
128 Ga0207679_10004383 3300025945 Bacteria 8787
129 Ga0207679_10020172 3300025945 Bacteria 4494
130 Ga0207679_10021897 3300025945 Bacteria 4343
131 Ga0207679_10310546 3300025945 Bacteria 1362
132 Ga0207679_10724610 3300025945 Bacteria 904
133 Ga0207679_10972908 3300025945 Bacteria 778
134 Ga0207679_11232852 3300025945 Unclassified 687
135 Ga0207667_10506160 3300025949 Bacteria 1225
136 Ga0207651_10211135 3300025960 Bacteria 1563
137 Ga0207651_10267395 3300025960 Bacteria 1407
138 Ga0207668_10562604 3300025972 Unclassified 989
139 Ga0207640_10085421 3300025981 Bacteria 2170
140 Ga0207658_10982459 3300025986 Bacteria 770
141 Ga0207639_10054233 3300026041 Bacteria 3063
142 Ga0207678_10000213 3300026067 Bacteria 51455
143 Ga0207678_10016854 3300026067 Bacteria 6415
144 Ga0207678_10919025 3300026067 Bacteria 774
145 Ga0207702_10438530 3300026078 Bacteria 1265
146 Ga0207702_12016189 3300026078 Bacteria 567
147 Ga0207676_10260530 3300026095 Bacteria 1565
148 Ga0207674_10639183 3300026116 Unclassified 1027
149 Ga0207683_10183751 3300026121 Bacteria 1897
150 Ga0207683_10916794 3300026121 Bacteria 814
151 Ga0207698_10212329 3300026142 Bacteria 1742
152 Ga0207698_10305271 3300026142 Bacteria 1483
153 Ga0207698_10410110 3300026142 Bacteria 1297
154 Ga0207698_10635277 3300026142 Bacteria 1056
155 Ga0207698_11618792 3300026142 Bacteria 663
156 Ga0268266_10000791 3300028379 Bacteria 42174
157 Ga0268264_10079559 3300028381 Bacteria 2797
158 Ga0307408_100730623 3300031548 Unclassified 892
159 Ga0307408_101200882 3300031548 Bacteria 707
160 Ga0307405_10420641 3300031731 Bacteria 1051
161 Ga0307413_11363270 3300031824 Bacteria 622
162 Ga0307413_11643818 3300031824 Unclassified 571
163 Ga0307410_10117594 3300031852 Bacteria 1933
164 Ga0307410_10203942 3300031852 Bacteria 1511
165 Ga0307406_10097447 3300031901 Bacteria 1994
166 Ga0307407_10029673 3300031903 Bacteria 2941
167 Ga0307407_10240238 3300031903 Bacteria 1235
168 Ga0307412_11133241 3300031911 Bacteria 697
169 Ga0307409_100020685 3300031995 Bacteria 4491
170 Ga0307409_100037163 3300031995 Bacteria 3588
171 Ga0307416_100063801 3300032002 Bacteria 3018
172 Ga0307416_102181591 3300032002 Bacteria 655
173 Ga0307414_10499887 3300032004 Bacteria 1075
174 Ga0307411_10045029 3300032005 Bacteria 2835
175 Ga0307411_10070583 3300032005 Bacteria 2364
176 Ga0307415_100303528 3300032126 Bacteria 1323
177 Ga0395899_0068758 3300037312 Bacteria 2596
178 Ga0395899_0239447 3300037312 Bacteria 1249
179 Ga0395900_0010213 3300037418 Bacteria 9601
180 Ga0395900_0075643 3300037418 Bacteria 3461
181 Ga0395900_0622088 3300037418 Bacteria 1018
182 Ga0395900_0911645 3300037418 Bacteria 802
183 Ga0395900_1686752 3300037418 Bacteria 545
184 Ga0395905_0002689 3300037471 Bacteria 19495
185 Ga0395905_0116331 3300037471 Bacteria 2513
186 Ga0395905_0728124 3300037471 Bacteria 894
187 Ga0395905_1672714 3300037471 Bacteria 541
188 Ga0395901_0030977 3300038443 Bacteria 5514
189 Ga0395901_0517076 3300038443 Bacteria 1213
190 Ga0395901_0578999 3300038443 Bacteria 1134
191 Ga0395901_1671094 3300038443 Bacteria 589
192 Ga0436365_1315373 3300039437 Bacteria 700
193 Ga0439432_023528 3300042006 Bacteria 2029
194 Ga0439452_050262 3300042010 Bacteria 957
195 Ga0450898_109138 3300042134 Bacteria 584
196 Ga0466964_0410411 3300044706 Bacteria 710
197 Ga0466971_0251447 3300044719 Bacteria 842
198 Ga0451576_2014326 3300045051 Bacteria 595
199 Ga0466967_2607550 3300045976 Bacteria 500
200 Ga0466967_2611402 3300045976 Bacteria 500
201 Ga0495621_0051866 3300046539 Bacteria 1469
202 Ga0495668_0080865 3300046616 Bacteria 1783
203 Ga0495668_0548675 3300046616 Unclassified 638
204 Ga0495669_0020798 3300046684 Bacteria 2843
205 Ga0496107_0483426 3300048910 Bacteria 919
206 Ga0496107_0847586 3300048910 Unclassified 668
207 Ga0496108_0010149 3300048911 Bacteria 7644
208 Ga0496109_0024065 3300048912 Bacteria 5410
209 Ga0496109_0733108 3300048912 Bacteria 926
210 Ga0496110_1216086 3300048913 Bacteria 662
211 Ga0496111_0446418 3300048914 Bacteria 954
212 Ga0496112_0025698 3300048915 Bacteria 5657
213 Ga0496113_0018858 3300048916 Bacteria 4814
214 Ga0501298_110904 3300049521 Bacteria 636
215 Ga0501067_0790910 3300049583 Bacteria 534
216 Ga0501202_049045 3300049652 Bacteria 931
217 Ga0501216_121032 3300049660 Bacteria 597
218 Ga0501217_079588 3300049661 Bacteria 905
219 Ga0501224_023988 3300049664 Bacteria 911
220 Ga0501233_024838 3300049668 Bacteria 1313
221 Ga0501259_198146 3300049688 Unclassified 514
222 Ga0501225_0041792 3300049705 Bacteria 1265
223 Ga0501229_067782 3300049706 Bacteria 554
224 Ga0501234_011983 3300049707 Bacteria 1357
225 Ga0501262_029232 3300049759 Bacteria 788
226 Ga0501268_007874 3300049765 Bacteria 1599
227 Ga0501270_016295 3300049767 Bacteria 1072
228 Ga0501273_003365 3300049770 Bacteria 1694
229 Ga0501283_010776 3300049779 Bacteria 1350
230 Ga0501204_022871 3300049850 Bacteria 827
231 Ga0501212_028363 3300049851 Bacteria 894
232 Ga0587090_101986 3300059510 Bacteria 602
233 Ga0587075_023519 3300059644 Bacteria 933
234 Ga0587078_051535 3300059646 Bacteria 605
235 Ga0466962_0438290 3300061719 Bacteria 657

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10537713 Ga0075364_105377132 65
2 3300025917 Ga0207660_10000409 Ga0207660_1000040914 65
3 3300025949 Ga0207667_10506160 Ga0207667_105061602 65
4 3300037418 Ga0395900_0010213 Ga0395900_0010213_435_650 65
5 3300037471 Ga0395905_0002689 Ga0395905_0002689_7198_7413 65
6 3300038443 Ga0395901_0030977 Ga0395901_0030977_467_682 65
7 3300025920 Ga0207649_10824119 Ga0207649_108241192 67
8 3300025917 Ga0207660_10512226 Ga0207660_105122261 68
9 3300025921 Ga0207652_10413735 Ga0207652_104137352 68
10 3300005293 Ga0065715_10786395 Ga0065715_107863952 71
11 3300005327 Ga0070658_10047934 Ga0070658_100479344 71
12 3300005327 Ga0070658_10130208 Ga0070658_101302082 71
13 3300005327 Ga0070658_10228126 Ga0070658_102281263 71
14 3300005327 Ga0070658_10702888 Ga0070658_107028881 71
15 3300005329 Ga0070683_100173741 Ga0070683_1001737412 71
16 3300005330 Ga0070690_101165172 Ga0070690_1011651721 71
17 3300005331 Ga0070670_100053167 Ga0070670_1000531674 71
18 3300005331 Ga0070670_100653287 Ga0070670_1006532872 71
19 3300005331 Ga0070670_101018465 Ga0070670_1010184651 71
20 3300005339 Ga0070660_100106252 Ga0070660_1001062522 71
21 3300005339 Ga0070660_100164431 Ga0070660_1001644312 71
22 3300005339 Ga0070660_100719203 Ga0070660_1007192032 71
23 3300005344 Ga0070661_100030524 Ga0070661_1000305242 71
24 3300005344 Ga0070661_100050308 Ga0070661_1000503081 71
25 3300005344 Ga0070661_100291777 Ga0070661_1002917772 71
26 3300005344 Ga0070661_101655483 Ga0070661_1016554832 71
27 3300005345 Ga0070692_10290793 Ga0070692_102907933 71
28 3300005356 Ga0070674_100045758 Ga0070674_1000457584 71
29 3300005366 Ga0070659_100024088 Ga0070659_1000240882 71
30 3300005366 Ga0070659_101358187 Ga0070659_1013581872 71
31 3300005435 Ga0070714_100050661 Ga0070714_1000506614 71
32 3300005435 Ga0070714_100680682 Ga0070714_1006806822 71
33 3300005436 Ga0070713_100112607 Ga0070713_1001126071 71
34 3300005455 Ga0070663_100097506 Ga0070663_1000975063 71
35 3300005455 Ga0070663_100159368 Ga0070663_1001593682 71
36 3300005456 Ga0070678_100178193 Ga0070678_1001781931 71
37 3300005457 Ga0070662_100953207 Ga0070662_1009532072 71
38 3300005459 Ga0068867_100804414 Ga0068867_1008044141 71
39 3300005530 Ga0070679_100207710 Ga0070679_1002077103 71
40 3300005539 Ga0068853_100127549 Ga0068853_1001275494 71
41 3300005543 Ga0070672_102007493 Ga0070672_1020074932 71
42 3300005548 Ga0070665_100536622 Ga0070665_1005366222 71
43 3300005548 Ga0070665_101728503 Ga0070665_1017285032 71
44 3300005564 Ga0070664_100004709 Ga0070664_1000047093 71
45 3300005564 Ga0070664_100015923 Ga0070664_1000159236 71
46 3300005564 Ga0070664_100098885 Ga0070664_1000988854 71
47 3300005564 Ga0070664_102095095 Ga0070664_1020950952 71
48 3300005577 Ga0068857_100374306 Ga0068857_1003743062 71
49 3300005578 Ga0068854_100083893 Ga0068854_1000838934 71
50 3300005614 Ga0068856_100784865 Ga0068856_1007848651 71
51 3300005614 Ga0068856_102177275 Ga0068856_1021772752 71
52 3300005616 Ga0068852_100062378 Ga0068852_1000623783 71
53 3300005616 Ga0068852_100251169 Ga0068852_1002511691 71
54 3300005616 Ga0068852_100391585 Ga0068852_1003915853 71
55 3300005616 Ga0068852_100412566 Ga0068852_1004125662 71
56 3300005834 Ga0068851_10029973 Ga0068851_100299732 71
57 3300005834 Ga0068851_10126398 Ga0068851_101263981 71
58 3300006028 Ga0070717_10312199 Ga0070717_103121992 71
59 3300006237 Ga0097621_100910126 Ga0097621_1009101261 71
60 3300013102 Ga0157371_10553129 Ga0157371_105531292 71
61 3300013105 Ga0157369_10988144 Ga0157369_109881442 71
62 3300013296 Ga0157374_10259888 Ga0157374_102598883 71
63 3300017792 Ga0163161_10459496 Ga0163161_104594962 71
64 3300025321 Ga0207656_10057128 Ga0207656_100571282 71
65 3300025893 Ga0207682_10188456 Ga0207682_101884562 71
66 3300025909 Ga0207705_10013482 Ga0207705_100134822 71
67 3300025909 Ga0207705_10240646 Ga0207705_102406461 71
68 3300025909 Ga0207705_11017528 Ga0207705_110175282 71
69 3300025909 Ga0207705_11438747 Ga0207705_114387472 71
70 3300025919 Ga0207657_10101957 Ga0207657_101019572 71
71 3300025919 Ga0207657_10691033 Ga0207657_106910332 71
72 3300025919 Ga0207657_11175030 Ga0207657_111750301 71
73 3300025920 Ga0207649_10037332 Ga0207649_100373323 71
74 3300025920 Ga0207649_10220818 Ga0207649_102208183 71
75 3300025920 Ga0207649_10608212 Ga0207649_106082122 71
76 3300025921 Ga0207652_10747772 Ga0207652_107477721 71
77 3300025925 Ga0207650_10045422 Ga0207650_100454224 71
78 3300025925 Ga0207650_10079035 Ga0207650_100790352 71
79 3300025925 Ga0207650_10179625 Ga0207650_101796252 71
80 3300025925 Ga0207650_11092359 Ga0207650_110923592 71
81 3300025926 Ga0207659_10008061 Ga0207659_100080611 71
82 3300025928 Ga0207700_10290336 Ga0207700_102903362 71
83 3300025928 Ga0207700_11935541 Ga0207700_119355411 71
84 3300025929 Ga0207664_10475384 Ga0207664_104753841 71
85 3300025929 Ga0207664_10909167 Ga0207664_109091672 71
86 3300025932 Ga0207690_10065441 Ga0207690_100654413 71
87 3300025932 Ga0207690_10648935 Ga0207690_106489352 71
88 3300025933 Ga0207706_10145248 Ga0207706_101452484 71
89 3300025933 Ga0207706_10454784 Ga0207706_104547842 71
90 3300025937 Ga0207669_10032825 Ga0207669_100328254 71
91 3300025937 Ga0207669_10394262 Ga0207669_103942622 71
92 3300025945 Ga0207679_10004383 Ga0207679_100043838 71
93 3300025945 Ga0207679_10020172 Ga0207679_100201722 71
94 3300025945 Ga0207679_10021897 Ga0207679_100218972 71
95 3300025945 Ga0207679_11232852 Ga0207679_112328522 71
96 3300025960 Ga0207651_10211135 Ga0207651_102111351 71
97 3300025972 Ga0207668_10562604 Ga0207668_105626042 71
98 3300025981 Ga0207640_10085421 Ga0207640_100854213 71
99 3300025986 Ga0207658_10982459 Ga0207658_109824592 71
100 3300026041 Ga0207639_10054233 Ga0207639_100542334 71
101 3300026067 Ga0207678_10000213 Ga0207678_1000021345 71
102 3300026067 Ga0207678_10016854 Ga0207678_100168543 71
103 3300026078 Ga0207702_10438530 Ga0207702_104385302 71
104 3300026078 Ga0207702_12016189 Ga0207702_120161891 71
105 3300026116 Ga0207674_10639183 Ga0207674_106391832 71
106 3300026121 Ga0207683_10183751 Ga0207683_101837511 71
107 3300026142 Ga0207698_10212329 Ga0207698_102123293 71
108 3300026142 Ga0207698_10305271 Ga0207698_103052712 71
109 3300026142 Ga0207698_10410110 Ga0207698_104101102 71
110 3300026142 Ga0207698_10635277 Ga0207698_106352772 71
111 3300026142 Ga0207698_11618792 Ga0207698_116187922 71
112 3300031548 Ga0307408_100730623 Ga0307408_1007306232 71
113 3300031824 Ga0307413_11643818 Ga0307413_116438182 71
114 3300031852 Ga0307410_10117594 Ga0307410_101175943 71
115 3300031903 Ga0307407_10240238 Ga0307407_102402383 71
116 3300031995 Ga0307409_100037163 Ga0307409_1000371632 71
117 3300032002 Ga0307416_102181591 Ga0307416_1021815912 71
118 3300032005 Ga0307411_10070583 Ga0307411_100705833 71
119 3300037312 Ga0395899_0068758 Ga0395899_0068758_1789_2004 71
120 3300037418 Ga0395900_0622088 Ga0395900_0622088_278_493 71
121 3300037418 Ga0395900_0911645 Ga0395900_0911645_464_679 71
122 3300037418 Ga0395900_1686752 Ga0395900_1686752_52_267 71
123 3300037471 Ga0395905_0116331 Ga0395905_0116331_2041_2256 71
124 3300037471 Ga0395905_1672714 Ga0395905_1672714_113_328 71
125 3300038443 Ga0395901_0578999 Ga0395901_0578999_243_458 71
126 3300044706 Ga0466964_0410411 Ga0466964_0410411_397_612 71
127 3300044719 Ga0466971_0251447 Ga0466971_0251447_380_595 71
128 3300045051 Ga0451576_2014326 Ga0451576_2014326_17_232 71
129 3300045976 Ga0466967_2607550 Ga0466967_2607550_151_366 71
130 3300045976 Ga0466967_2611402 Ga0466967_2611402_256_471 71
131 3300046684 Ga0495669_0020798 Ga0495669_0020798_280_495 71
132 3300048914 Ga0496111_0446418 Ga0496111_0446418_657_872 71
133 3300059510 Ga0587090_101986 Ga0587090_101986_89_304 71
134 3300059644 Ga0587075_023519 Ga0587075_023519_158_373 71
135 3300059646 Ga0587078_051535 Ga0587078_051535_67_282 71
136 3300061719 Ga0466962_0438290 Ga0466962_0438290_390_605 71
137 3300005327 Ga0070658_11346833 Ga0070658_113468331 72
138 3300005338 Ga0068868_100294624 Ga0068868_1002946241 72
139 3300005356 Ga0070674_100651853 Ga0070674_1006518531 72
140 3300005367 Ga0070667_100435148 Ga0070667_1004351481 72
141 3300005456 Ga0070678_101013734 Ga0070678_1010137341 72
142 3300005457 Ga0070662_100009053 Ga0070662_1000090531 72
143 3300005457 Ga0070662_100936947 Ga0070662_1009369472 72
144 3300005578 Ga0068854_101464986 Ga0068854_1014649861 72
145 3300005616 Ga0068852_101225802 Ga0068852_1012258022 72
146 3300005718 Ga0068866_10393861 Ga0068866_103938612 72
147 3300025899 Ga0207642_10089780 Ga0207642_100897802 72
148 3300025919 Ga0207657_11280384 Ga0207657_112803842 72
149 3300025933 Ga0207706_10017460 Ga0207706_100174607 72
150 3300025933 Ga0207706_10261027 Ga0207706_102610271 72
151 3300025937 Ga0207669_10468375 Ga0207669_104683752 72
152 3300025938 Ga0207704_10062364 Ga0207704_100623642 72
153 3300025940 Ga0207691_11201996 Ga0207691_112019961 72
154 3300025945 Ga0207679_10310546 Ga0207679_103105462 72
155 3300026067 Ga0207678_10919025 Ga0207678_109190252 72
156 3300026121 Ga0207683_10916794 Ga0207683_109167942 72
157 3300028379 Ga0268266_10000791 Ga0268266_1000079137 72
158 3300031548 Ga0307408_101200882 Ga0307408_1012008821 72
159 3300031731 Ga0307405_10420641 Ga0307405_104206412 72
160 3300031824 Ga0307413_11363270 Ga0307413_113632701 72
161 3300031852 Ga0307410_10203942 Ga0307410_102039421 72
162 3300031901 Ga0307406_10097447 Ga0307406_100974471 72
163 3300031903 Ga0307407_10029673 Ga0307407_100296733 72
164 3300031911 Ga0307412_11133241 Ga0307412_111332411 72
165 3300031995 Ga0307409_100020685 Ga0307409_1000206854 72
166 3300032002 Ga0307416_100063801 Ga0307416_1000638014 72
167 3300032004 Ga0307414_10499887 Ga0307414_104998872 72
168 3300032005 Ga0307411_10045029 Ga0307411_100450292 72
169 3300032126 Ga0307415_100303528 Ga0307415_1003035281 72
170 3300037471 Ga0395905_0728124 Ga0395905_0728124_51_269 72
171 3300039437 Ga0436365_1315373 Ga0436365_1315373_60_278 72
172 3300042006 Ga0439432_023528 Ga0439432_023528_236_454 72
173 3300042010 Ga0439452_050262 Ga0439452_050262_112_330 72
174 3300042134 Ga0450898_109138 Ga0450898_109138_33_251 72
175 3300046539 Ga0495621_0051866 Ga0495621_0051866_1219_1440 72
176 3300046616 Ga0495668_0080865 Ga0495668_0080865_1199_1417 72
177 3300048910 Ga0496107_0483426 Ga0496107_0483426_632_850 72
178 3300048912 Ga0496109_0733108 Ga0496109_0733108_285_503 72
179 3300049521 Ga0501298_110904 Ga0501298_110904_264_482 72
180 3300049583 Ga0501067_0790910 Ga0501067_0790910_300_521 72
181 3300049652 Ga0501202_049045 Ga0501202_049045_187_405 72
182 3300049660 Ga0501216_121032 Ga0501216_121032_288_506 72
183 3300049661 Ga0501217_079588 Ga0501217_079588_248_466 72
184 3300049664 Ga0501224_023988 Ga0501224_023988_67_285 72
185 3300049668 Ga0501233_024838 Ga0501233_024838_300_518 72
186 3300049688 Ga0501259_198146 Ga0501259_198146_193_411 72
187 3300049705 Ga0501225_0041792 Ga0501225_0041792_801_1019 72
188 3300049706 Ga0501229_067782 Ga0501229_067782_84_302 72
189 3300049707 Ga0501234_011983 Ga0501234_011983_714_932 72
190 3300049759 Ga0501262_029232 Ga0501262_029232_401_619 72
191 3300049765 Ga0501268_007874 Ga0501268_007874_305_523 72
192 3300049767 Ga0501270_016295 Ga0501270_016295_763_981 72
193 3300049770 Ga0501273_003365 Ga0501273_003365_1224_1442 72
194 3300049779 Ga0501283_010776 Ga0501283_010776_493_711 72
195 3300049850 Ga0501204_022871 Ga0501204_022871_124_342 72
196 3300049851 Ga0501212_028363 Ga0501212_028363_513_731 72
197 3300003323 rootH1_10127400 rootH1_101274004 73
198 3300005328 Ga0070676_10342611 Ga0070676_103426112 73
199 3300005330 Ga0070690_100728138 Ga0070690_1007281382 73
200 3300005344 Ga0070661_100894803 Ga0070661_1008948032 73
201 3300005364 Ga0070673_100319567 Ga0070673_1003195671 73
202 3300005364 Ga0070673_100464468 Ga0070673_1004644682 73
203 3300005543 Ga0070672_101681695 Ga0070672_1016816952 73
204 3300005564 Ga0070664_100560038 Ga0070664_1005600382 73
205 3300005564 Ga0070664_101089522 Ga0070664_1010895222 73
206 3300005616 Ga0068852_100094228 Ga0068852_1000942283 73
207 3300005618 Ga0068864_100476478 Ga0068864_1004764781 73
208 3300005834 Ga0068851_11109910 Ga0068851_111099102 73
209 3300005841 Ga0068863_100194923 Ga0068863_1001949232 73
210 3300005842 Ga0068858_100035844 Ga0068858_1000358446 73
211 3300005843 Ga0068860_100035287 Ga0068860_1000352874 73
212 3300009177 Ga0105248_10014966 Ga0105248_1001496610 73
213 3300009177 Ga0105248_11351164 Ga0105248_113511641 73
214 3300013308 Ga0157375_10307918 Ga0157375_103079182 73
215 3300025907 Ga0207645_10488635 Ga0207645_104886352 73
216 3300025931 Ga0207644_10001230 Ga0207644_1000123012 73
217 3300025931 Ga0207644_10331447 Ga0207644_103314471 73
218 3300025933 Ga0207706_10808644 Ga0207706_108086441 73
219 3300025941 Ga0207711_10015535 Ga0207711_100155354 73
220 3300025945 Ga0207679_10724610 Ga0207679_107246102 73
221 3300025945 Ga0207679_10972908 Ga0207679_109729082 73
222 3300025960 Ga0207651_10267395 Ga0207651_102673951 73
223 3300026095 Ga0207676_10260530 Ga0207676_102605302 73
224 3300028381 Ga0268264_10079559 Ga0268264_100795593 73
225 3300037312 Ga0395899_0239447 Ga0395899_0239447_785_1006 73
226 3300037418 Ga0395900_0075643 Ga0395900_0075643_2996_3217 73
227 3300038443 Ga0395901_0517076 Ga0395901_0517076_208_429 73
228 3300038443 Ga0395901_1671094 Ga0395901_1671094_162_383 73
229 3300046616 Ga0495668_0548675 Ga0495668_0548675_247_468 73
230 3300048910 Ga0496107_0847586 Ga0496107_0847586_432_653 73
231 3300048911 Ga0496108_0010149 Ga0496108_0010149_6776_6997 73
232 3300048912 Ga0496109_0024065 Ga0496109_0024065_4145_4366 73
233 3300048913 Ga0496110_1216086 Ga0496110_1216086_352_573 73
234 3300048915 Ga0496112_0025698 Ga0496112_0025698_57_278 73
235 3300048916 Ga0496113_0018858 Ga0496113_0018858_4516_4737 73

Feature Viewer

pLDDT pTM Quality
71.42 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map