F348210
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 235 | 136 | 235 | 72 |
Family's Representative Sequence
| Representative Sequence | 3300025928|Ga0207700_11935541|Ga0207700_119355411 |
| Length | 81 |
| Sequence | MIAALGTLVFLVTLWMLVVVGAAVLEESGAKIAAALKGKPLTRQIVAPVRLRTRVRMQQPMRCGGGHRHSTWPRNVPANWA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 82 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 83 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 84 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 85 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 86 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 87 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 91 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 92 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 93 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 94 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 95 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 96 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 97 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 98 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 99 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 100 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 101 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 102 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 103 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 104 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 105 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 109 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 110 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 111 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 112 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 113 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 114 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 115 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 116 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 118 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 119 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 120 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 121 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 122 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 123 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 124 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 125 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 126 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 127 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 128 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 129 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 130 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 131 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 132 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 133 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 1.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 3.83 |
| Rhizosphere | 94.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10127400 | 3300003323 | Bacteria | 1264 |
| 2 | Ga0065715_10786395 | 3300005293 | Unclassified | 595 |
| 3 | Ga0070658_10047934 | 3300005327 | Bacteria | 3458 |
| 4 | Ga0070658_10130208 | 3300005327 | Bacteria | 2096 |
| 5 | Ga0070658_10228126 | 3300005327 | Bacteria | 1576 |
| 6 | Ga0070658_10702888 | 3300005327 | Bacteria | 877 |
| 7 | Ga0070658_11346833 | 3300005327 | Bacteria | 620 |
| 8 | Ga0070676_10342611 | 3300005328 | Bacteria | 1025 |
| 9 | Ga0070683_100173741 | 3300005329 | Bacteria | 2045 |
| 10 | Ga0070690_100728138 | 3300005330 | Bacteria | 764 |
| 11 | Ga0070690_101165172 | 3300005330 | Bacteria | 613 |
| 12 | Ga0070670_100053167 | 3300005331 | Bacteria | 3478 |
| 13 | Ga0070670_100653287 | 3300005331 | Bacteria | 943 |
| 14 | Ga0070670_101018465 | 3300005331 | Bacteria | 753 |
| 15 | Ga0068868_100294624 | 3300005338 | Bacteria | 1376 |
| 16 | Ga0070660_100106252 | 3300005339 | Bacteria | 2229 |
| 17 | Ga0070660_100164431 | 3300005339 | Bacteria | 1789 |
| 18 | Ga0070660_100719203 | 3300005339 | Bacteria | 838 |
| 19 | Ga0070661_100030524 | 3300005344 | Bacteria | 3894 |
| 20 | Ga0070661_100050308 | 3300005344 | Bacteria | 3049 |
| 21 | Ga0070661_100291777 | 3300005344 | Bacteria | 1267 |
| 22 | Ga0070661_100894803 | 3300005344 | Bacteria | 732 |
| 23 | Ga0070661_101655483 | 3300005344 | Bacteria | 542 |
| 24 | Ga0070692_10290793 | 3300005345 | Bacteria | 994 |
| 25 | Ga0070674_100045758 | 3300005356 | Bacteria | 2990 |
| 26 | Ga0070674_100651853 | 3300005356 | Bacteria | 895 |
| 27 | Ga0070673_100319567 | 3300005364 | Bacteria | 1371 |
| 28 | Ga0070673_100464468 | 3300005364 | Unclassified | 1140 |
| 29 | Ga0070659_100024088 | 3300005366 | Bacteria | 4664 |
| 30 | Ga0070659_101358187 | 3300005366 | Unclassified | 631 |
| 31 | Ga0070667_100435148 | 3300005367 | Bacteria | 1197 |
| 32 | Ga0070714_100050661 | 3300005435 | Bacteria | 3538 |
| 33 | Ga0070714_100680682 | 3300005435 | Unclassified | 992 |
| 34 | Ga0070713_100112607 | 3300005436 | Bacteria | 2374 |
| 35 | Ga0070663_100097506 | 3300005455 | Bacteria | 2189 |
| 36 | Ga0070663_100159368 | 3300005455 | Bacteria | 1736 |
| 37 | Ga0070678_100178193 | 3300005456 | Bacteria | 1737 |
| 38 | Ga0070678_101013734 | 3300005456 | Bacteria | 763 |
| 39 | Ga0070662_100009053 | 3300005457 | Bacteria | 6497 |
| 40 | Ga0070662_100936947 | 3300005457 | Bacteria | 740 |
| 41 | Ga0070662_100953207 | 3300005457 | Bacteria | 733 |
| 42 | Ga0068867_100804414 | 3300005459 | Unclassified | 839 |
| 43 | Ga0070679_100207710 | 3300005530 | Bacteria | 1922 |
| 44 | Ga0068853_100127549 | 3300005539 | Bacteria | 2274 |
| 45 | Ga0070672_101681695 | 3300005543 | Bacteria | 570 |
| 46 | Ga0070672_102007493 | 3300005543 | Bacteria | 521 |
| 47 | Ga0070665_100536622 | 3300005548 | Bacteria | 1182 |
| 48 | Ga0070665_101728503 | 3300005548 | Unclassified | 633 |
| 49 | Ga0070664_100004709 | 3300005564 | Bacteria | 10941 |
| 50 | Ga0070664_100015923 | 3300005564 | Bacteria | 6157 |
| 51 | Ga0070664_100098885 | 3300005564 | Bacteria | 2535 |
| 52 | Ga0070664_100560038 | 3300005564 | Bacteria | 1057 |
| 53 | Ga0070664_101089522 | 3300005564 | Bacteria | 752 |
| 54 | Ga0070664_102095095 | 3300005564 | Unclassified | 537 |
| 55 | Ga0068857_100374306 | 3300005577 | Bacteria | 1321 |
| 56 | Ga0068854_100083893 | 3300005578 | Bacteria | 2356 |
| 57 | Ga0068854_101464986 | 3300005578 | Bacteria | 619 |
| 58 | Ga0068856_100784865 | 3300005614 | Bacteria | 972 |
| 59 | Ga0068856_102177275 | 3300005614 | Bacteria | 564 |
| 60 | Ga0068852_100062378 | 3300005616 | Bacteria | 3242 |
| 61 | Ga0068852_100094228 | 3300005616 | Bacteria | 2685 |
| 62 | Ga0068852_100251169 | 3300005616 | Bacteria | 1694 |
| 63 | Ga0068852_100391585 | 3300005616 | Bacteria | 1365 |
| 64 | Ga0068852_100412566 | 3300005616 | Bacteria | 1331 |
| 65 | Ga0068852_101225802 | 3300005616 | Bacteria | 771 |
| 66 | Ga0068864_100476478 | 3300005618 | Bacteria | 1197 |
| 67 | Ga0068866_10393861 | 3300005718 | Bacteria | 892 |
| 68 | Ga0068851_10029973 | 3300005834 | Bacteria | 2696 |
| 69 | Ga0068851_10126398 | 3300005834 | Unclassified | 1379 |
| 70 | Ga0068851_11109910 | 3300005834 | Unclassified | 502 |
| 71 | Ga0068863_100194923 | 3300005841 | Bacteria | 1947 |
| 72 | Ga0068858_100035844 | 3300005842 | Bacteria | 4601 |
| 73 | Ga0068860_100035287 | 3300005843 | Bacteria | 4798 |
| 74 | Ga0070717_10312199 | 3300006028 | Bacteria | 1399 |
| 75 | Ga0075364_10537713 | 3300006051 | Bacteria | 799 |
| 76 | Ga0097621_100910126 | 3300006237 | Bacteria | 820 |
| 77 | Ga0105248_10014966 | 3300009177 | Bacteria | 8540 |
| 78 | Ga0105248_11351164 | 3300009177 | Bacteria | 806 |
| 79 | Ga0157371_10553129 | 3300013102 | Bacteria | 853 |
| 80 | Ga0157369_10988144 | 3300013105 | Bacteria | 862 |
| 81 | Ga0157374_10259888 | 3300013296 | Bacteria | 1710 |
| 82 | Ga0157375_10307918 | 3300013308 | Bacteria | 1748 |
| 83 | Ga0163161_10459496 | 3300017792 | Bacteria | 1030 |
| 84 | Ga0207656_10057128 | 3300025321 | Bacteria | 1702 |
| 85 | Ga0207682_10188456 | 3300025893 | Bacteria | 944 |
| 86 | Ga0207642_10089780 | 3300025899 | Bacteria | 1515 |
| 87 | Ga0207645_10488635 | 3300025907 | Bacteria | 833 |
| 88 | Ga0207705_10013482 | 3300025909 | Bacteria | 5898 |
| 89 | Ga0207705_10240646 | 3300025909 | Bacteria | 1378 |
| 90 | Ga0207705_11017528 | 3300025909 | Bacteria | 640 |
| 91 | Ga0207705_11438747 | 3300025909 | Unclassified | 523 |
| 92 | Ga0207660_10000409 | 3300025917 | Bacteria | 28305 |
| 93 | Ga0207660_10512226 | 3300025917 | Bacteria | 974 |
| 94 | Ga0207657_10101957 | 3300025919 | Bacteria | 2381 |
| 95 | Ga0207657_10691033 | 3300025919 | Bacteria | 793 |
| 96 | Ga0207657_11175030 | 3300025919 | Bacteria | 584 |
| 97 | Ga0207657_11280384 | 3300025919 | Unclassified | 555 |
| 98 | Ga0207649_10037332 | 3300025920 | Bacteria | 2934 |
| 99 | Ga0207649_10220818 | 3300025920 | Bacteria | 1350 |
| 100 | Ga0207649_10608212 | 3300025920 | Bacteria | 841 |
| 101 | Ga0207649_10824119 | 3300025920 | Bacteria | 725 |
| 102 | Ga0207652_10413735 | 3300025921 | Bacteria | 1216 |
| 103 | Ga0207652_10747772 | 3300025921 | Bacteria | 870 |
| 104 | Ga0207650_10045422 | 3300025925 | Bacteria | 3232 |
| 105 | Ga0207650_10079035 | 3300025925 | Bacteria | 2490 |
| 106 | Ga0207650_10179625 | 3300025925 | Bacteria | 1686 |
| 107 | Ga0207650_11092359 | 3300025925 | Bacteria | 679 |
| 108 | Ga0207659_10008061 | 3300025926 | Bacteria | 6520 |
| 109 | Ga0207700_10290336 | 3300025928 | Bacteria | 1409 |
| 110 | Ga0207700_11935541 | 3300025928 | Unclassified | 516 |
| 111 | Ga0207664_10475384 | 3300025929 | Bacteria | 1117 |
| 112 | Ga0207664_10909167 | 3300025929 | Bacteria | 790 |
| 113 | Ga0207644_10001230 | 3300025931 | Bacteria | 16503 |
| 114 | Ga0207644_10331447 | 3300025931 | Bacteria | 1232 |
| 115 | Ga0207690_10065441 | 3300025932 | Bacteria | 2486 |
| 116 | Ga0207690_10648935 | 3300025932 | Bacteria | 865 |
| 117 | Ga0207706_10017460 | 3300025933 | Bacteria | 6465 |
| 118 | Ga0207706_10145248 | 3300025933 | Bacteria | 2086 |
| 119 | Ga0207706_10261027 | 3300025933 | Bacteria | 1512 |
| 120 | Ga0207706_10454784 | 3300025933 | Bacteria | 1107 |
| 121 | Ga0207706_10808644 | 3300025933 | Bacteria | 796 |
| 122 | Ga0207669_10032825 | 3300025937 | Bacteria | 2921 |
| 123 | Ga0207669_10394262 | 3300025937 | Unclassified | 1082 |
| 124 | Ga0207669_10468375 | 3300025937 | Bacteria | 1002 |
| 125 | Ga0207704_10062364 | 3300025938 | Bacteria | 2318 |
| 126 | Ga0207691_11201996 | 3300025940 | Bacteria | 628 |
| 127 | Ga0207711_10015535 | 3300025941 | Bacteria | 6319 |
| 128 | Ga0207679_10004383 | 3300025945 | Bacteria | 8787 |
| 129 | Ga0207679_10020172 | 3300025945 | Bacteria | 4494 |
| 130 | Ga0207679_10021897 | 3300025945 | Bacteria | 4343 |
| 131 | Ga0207679_10310546 | 3300025945 | Bacteria | 1362 |
| 132 | Ga0207679_10724610 | 3300025945 | Bacteria | 904 |
| 133 | Ga0207679_10972908 | 3300025945 | Bacteria | 778 |
| 134 | Ga0207679_11232852 | 3300025945 | Unclassified | 687 |
| 135 | Ga0207667_10506160 | 3300025949 | Bacteria | 1225 |
| 136 | Ga0207651_10211135 | 3300025960 | Bacteria | 1563 |
| 137 | Ga0207651_10267395 | 3300025960 | Bacteria | 1407 |
| 138 | Ga0207668_10562604 | 3300025972 | Unclassified | 989 |
| 139 | Ga0207640_10085421 | 3300025981 | Bacteria | 2170 |
| 140 | Ga0207658_10982459 | 3300025986 | Bacteria | 770 |
| 141 | Ga0207639_10054233 | 3300026041 | Bacteria | 3063 |
| 142 | Ga0207678_10000213 | 3300026067 | Bacteria | 51455 |
| 143 | Ga0207678_10016854 | 3300026067 | Bacteria | 6415 |
| 144 | Ga0207678_10919025 | 3300026067 | Bacteria | 774 |
| 145 | Ga0207702_10438530 | 3300026078 | Bacteria | 1265 |
| 146 | Ga0207702_12016189 | 3300026078 | Bacteria | 567 |
| 147 | Ga0207676_10260530 | 3300026095 | Bacteria | 1565 |
| 148 | Ga0207674_10639183 | 3300026116 | Unclassified | 1027 |
| 149 | Ga0207683_10183751 | 3300026121 | Bacteria | 1897 |
| 150 | Ga0207683_10916794 | 3300026121 | Bacteria | 814 |
| 151 | Ga0207698_10212329 | 3300026142 | Bacteria | 1742 |
| 152 | Ga0207698_10305271 | 3300026142 | Bacteria | 1483 |
| 153 | Ga0207698_10410110 | 3300026142 | Bacteria | 1297 |
| 154 | Ga0207698_10635277 | 3300026142 | Bacteria | 1056 |
| 155 | Ga0207698_11618792 | 3300026142 | Bacteria | 663 |
| 156 | Ga0268266_10000791 | 3300028379 | Bacteria | 42174 |
| 157 | Ga0268264_10079559 | 3300028381 | Bacteria | 2797 |
| 158 | Ga0307408_100730623 | 3300031548 | Unclassified | 892 |
| 159 | Ga0307408_101200882 | 3300031548 | Bacteria | 707 |
| 160 | Ga0307405_10420641 | 3300031731 | Bacteria | 1051 |
| 161 | Ga0307413_11363270 | 3300031824 | Bacteria | 622 |
| 162 | Ga0307413_11643818 | 3300031824 | Unclassified | 571 |
| 163 | Ga0307410_10117594 | 3300031852 | Bacteria | 1933 |
| 164 | Ga0307410_10203942 | 3300031852 | Bacteria | 1511 |
| 165 | Ga0307406_10097447 | 3300031901 | Bacteria | 1994 |
| 166 | Ga0307407_10029673 | 3300031903 | Bacteria | 2941 |
| 167 | Ga0307407_10240238 | 3300031903 | Bacteria | 1235 |
| 168 | Ga0307412_11133241 | 3300031911 | Bacteria | 697 |
| 169 | Ga0307409_100020685 | 3300031995 | Bacteria | 4491 |
| 170 | Ga0307409_100037163 | 3300031995 | Bacteria | 3588 |
| 171 | Ga0307416_100063801 | 3300032002 | Bacteria | 3018 |
| 172 | Ga0307416_102181591 | 3300032002 | Bacteria | 655 |
| 173 | Ga0307414_10499887 | 3300032004 | Bacteria | 1075 |
| 174 | Ga0307411_10045029 | 3300032005 | Bacteria | 2835 |
| 175 | Ga0307411_10070583 | 3300032005 | Bacteria | 2364 |
| 176 | Ga0307415_100303528 | 3300032126 | Bacteria | 1323 |
| 177 | Ga0395899_0068758 | 3300037312 | Bacteria | 2596 |
| 178 | Ga0395899_0239447 | 3300037312 | Bacteria | 1249 |
| 179 | Ga0395900_0010213 | 3300037418 | Bacteria | 9601 |
| 180 | Ga0395900_0075643 | 3300037418 | Bacteria | 3461 |
| 181 | Ga0395900_0622088 | 3300037418 | Bacteria | 1018 |
| 182 | Ga0395900_0911645 | 3300037418 | Bacteria | 802 |
| 183 | Ga0395900_1686752 | 3300037418 | Bacteria | 545 |
| 184 | Ga0395905_0002689 | 3300037471 | Bacteria | 19495 |
| 185 | Ga0395905_0116331 | 3300037471 | Bacteria | 2513 |
| 186 | Ga0395905_0728124 | 3300037471 | Bacteria | 894 |
| 187 | Ga0395905_1672714 | 3300037471 | Bacteria | 541 |
| 188 | Ga0395901_0030977 | 3300038443 | Bacteria | 5514 |
| 189 | Ga0395901_0517076 | 3300038443 | Bacteria | 1213 |
| 190 | Ga0395901_0578999 | 3300038443 | Bacteria | 1134 |
| 191 | Ga0395901_1671094 | 3300038443 | Bacteria | 589 |
| 192 | Ga0436365_1315373 | 3300039437 | Bacteria | 700 |
| 193 | Ga0439432_023528 | 3300042006 | Bacteria | 2029 |
| 194 | Ga0439452_050262 | 3300042010 | Bacteria | 957 |
| 195 | Ga0450898_109138 | 3300042134 | Bacteria | 584 |
| 196 | Ga0466964_0410411 | 3300044706 | Bacteria | 710 |
| 197 | Ga0466971_0251447 | 3300044719 | Bacteria | 842 |
| 198 | Ga0451576_2014326 | 3300045051 | Bacteria | 595 |
| 199 | Ga0466967_2607550 | 3300045976 | Bacteria | 500 |
| 200 | Ga0466967_2611402 | 3300045976 | Bacteria | 500 |
| 201 | Ga0495621_0051866 | 3300046539 | Bacteria | 1469 |
| 202 | Ga0495668_0080865 | 3300046616 | Bacteria | 1783 |
| 203 | Ga0495668_0548675 | 3300046616 | Unclassified | 638 |
| 204 | Ga0495669_0020798 | 3300046684 | Bacteria | 2843 |
| 205 | Ga0496107_0483426 | 3300048910 | Bacteria | 919 |
| 206 | Ga0496107_0847586 | 3300048910 | Unclassified | 668 |
| 207 | Ga0496108_0010149 | 3300048911 | Bacteria | 7644 |
| 208 | Ga0496109_0024065 | 3300048912 | Bacteria | 5410 |
| 209 | Ga0496109_0733108 | 3300048912 | Bacteria | 926 |
| 210 | Ga0496110_1216086 | 3300048913 | Bacteria | 662 |
| 211 | Ga0496111_0446418 | 3300048914 | Bacteria | 954 |
| 212 | Ga0496112_0025698 | 3300048915 | Bacteria | 5657 |
| 213 | Ga0496113_0018858 | 3300048916 | Bacteria | 4814 |
| 214 | Ga0501298_110904 | 3300049521 | Bacteria | 636 |
| 215 | Ga0501067_0790910 | 3300049583 | Bacteria | 534 |
| 216 | Ga0501202_049045 | 3300049652 | Bacteria | 931 |
| 217 | Ga0501216_121032 | 3300049660 | Bacteria | 597 |
| 218 | Ga0501217_079588 | 3300049661 | Bacteria | 905 |
| 219 | Ga0501224_023988 | 3300049664 | Bacteria | 911 |
| 220 | Ga0501233_024838 | 3300049668 | Bacteria | 1313 |
| 221 | Ga0501259_198146 | 3300049688 | Unclassified | 514 |
| 222 | Ga0501225_0041792 | 3300049705 | Bacteria | 1265 |
| 223 | Ga0501229_067782 | 3300049706 | Bacteria | 554 |
| 224 | Ga0501234_011983 | 3300049707 | Bacteria | 1357 |
| 225 | Ga0501262_029232 | 3300049759 | Bacteria | 788 |
| 226 | Ga0501268_007874 | 3300049765 | Bacteria | 1599 |
| 227 | Ga0501270_016295 | 3300049767 | Bacteria | 1072 |
| 228 | Ga0501273_003365 | 3300049770 | Bacteria | 1694 |
| 229 | Ga0501283_010776 | 3300049779 | Bacteria | 1350 |
| 230 | Ga0501204_022871 | 3300049850 | Bacteria | 827 |
| 231 | Ga0501212_028363 | 3300049851 | Bacteria | 894 |
| 232 | Ga0587090_101986 | 3300059510 | Bacteria | 602 |
| 233 | Ga0587075_023519 | 3300059644 | Bacteria | 933 |
| 234 | Ga0587078_051535 | 3300059646 | Bacteria | 605 |
| 235 | Ga0466962_0438290 | 3300061719 | Bacteria | 657 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006051 | Ga0075364_10537713 | Ga0075364_105377132 | 65 |
| 2 | 3300025917 | Ga0207660_10000409 | Ga0207660_1000040914 | 65 |
| 3 | 3300025949 | Ga0207667_10506160 | Ga0207667_105061602 | 65 |
| 4 | 3300037418 | Ga0395900_0010213 | Ga0395900_0010213_435_650 | 65 |
| 5 | 3300037471 | Ga0395905_0002689 | Ga0395905_0002689_7198_7413 | 65 |
| 6 | 3300038443 | Ga0395901_0030977 | Ga0395901_0030977_467_682 | 65 |
| 7 | 3300025920 | Ga0207649_10824119 | Ga0207649_108241192 | 67 |
| 8 | 3300025917 | Ga0207660_10512226 | Ga0207660_105122261 | 68 |
| 9 | 3300025921 | Ga0207652_10413735 | Ga0207652_104137352 | 68 |
| 10 | 3300005293 | Ga0065715_10786395 | Ga0065715_107863952 | 71 |
| 11 | 3300005327 | Ga0070658_10047934 | Ga0070658_100479344 | 71 |
| 12 | 3300005327 | Ga0070658_10130208 | Ga0070658_101302082 | 71 |
| 13 | 3300005327 | Ga0070658_10228126 | Ga0070658_102281263 | 71 |
| 14 | 3300005327 | Ga0070658_10702888 | Ga0070658_107028881 | 71 |
| 15 | 3300005329 | Ga0070683_100173741 | Ga0070683_1001737412 | 71 |
| 16 | 3300005330 | Ga0070690_101165172 | Ga0070690_1011651721 | 71 |
| 17 | 3300005331 | Ga0070670_100053167 | Ga0070670_1000531674 | 71 |
| 18 | 3300005331 | Ga0070670_100653287 | Ga0070670_1006532872 | 71 |
| 19 | 3300005331 | Ga0070670_101018465 | Ga0070670_1010184651 | 71 |
| 20 | 3300005339 | Ga0070660_100106252 | Ga0070660_1001062522 | 71 |
| 21 | 3300005339 | Ga0070660_100164431 | Ga0070660_1001644312 | 71 |
| 22 | 3300005339 | Ga0070660_100719203 | Ga0070660_1007192032 | 71 |
| 23 | 3300005344 | Ga0070661_100030524 | Ga0070661_1000305242 | 71 |
| 24 | 3300005344 | Ga0070661_100050308 | Ga0070661_1000503081 | 71 |
| 25 | 3300005344 | Ga0070661_100291777 | Ga0070661_1002917772 | 71 |
| 26 | 3300005344 | Ga0070661_101655483 | Ga0070661_1016554832 | 71 |
| 27 | 3300005345 | Ga0070692_10290793 | Ga0070692_102907933 | 71 |
| 28 | 3300005356 | Ga0070674_100045758 | Ga0070674_1000457584 | 71 |
| 29 | 3300005366 | Ga0070659_100024088 | Ga0070659_1000240882 | 71 |
| 30 | 3300005366 | Ga0070659_101358187 | Ga0070659_1013581872 | 71 |
| 31 | 3300005435 | Ga0070714_100050661 | Ga0070714_1000506614 | 71 |
| 32 | 3300005435 | Ga0070714_100680682 | Ga0070714_1006806822 | 71 |
| 33 | 3300005436 | Ga0070713_100112607 | Ga0070713_1001126071 | 71 |
| 34 | 3300005455 | Ga0070663_100097506 | Ga0070663_1000975063 | 71 |
| 35 | 3300005455 | Ga0070663_100159368 | Ga0070663_1001593682 | 71 |
| 36 | 3300005456 | Ga0070678_100178193 | Ga0070678_1001781931 | 71 |
| 37 | 3300005457 | Ga0070662_100953207 | Ga0070662_1009532072 | 71 |
| 38 | 3300005459 | Ga0068867_100804414 | Ga0068867_1008044141 | 71 |
| 39 | 3300005530 | Ga0070679_100207710 | Ga0070679_1002077103 | 71 |
| 40 | 3300005539 | Ga0068853_100127549 | Ga0068853_1001275494 | 71 |
| 41 | 3300005543 | Ga0070672_102007493 | Ga0070672_1020074932 | 71 |
| 42 | 3300005548 | Ga0070665_100536622 | Ga0070665_1005366222 | 71 |
| 43 | 3300005548 | Ga0070665_101728503 | Ga0070665_1017285032 | 71 |
| 44 | 3300005564 | Ga0070664_100004709 | Ga0070664_1000047093 | 71 |
| 45 | 3300005564 | Ga0070664_100015923 | Ga0070664_1000159236 | 71 |
| 46 | 3300005564 | Ga0070664_100098885 | Ga0070664_1000988854 | 71 |
| 47 | 3300005564 | Ga0070664_102095095 | Ga0070664_1020950952 | 71 |
| 48 | 3300005577 | Ga0068857_100374306 | Ga0068857_1003743062 | 71 |
| 49 | 3300005578 | Ga0068854_100083893 | Ga0068854_1000838934 | 71 |
| 50 | 3300005614 | Ga0068856_100784865 | Ga0068856_1007848651 | 71 |
| 51 | 3300005614 | Ga0068856_102177275 | Ga0068856_1021772752 | 71 |
| 52 | 3300005616 | Ga0068852_100062378 | Ga0068852_1000623783 | 71 |
| 53 | 3300005616 | Ga0068852_100251169 | Ga0068852_1002511691 | 71 |
| 54 | 3300005616 | Ga0068852_100391585 | Ga0068852_1003915853 | 71 |
| 55 | 3300005616 | Ga0068852_100412566 | Ga0068852_1004125662 | 71 |
| 56 | 3300005834 | Ga0068851_10029973 | Ga0068851_100299732 | 71 |
| 57 | 3300005834 | Ga0068851_10126398 | Ga0068851_101263981 | 71 |
| 58 | 3300006028 | Ga0070717_10312199 | Ga0070717_103121992 | 71 |
| 59 | 3300006237 | Ga0097621_100910126 | Ga0097621_1009101261 | 71 |
| 60 | 3300013102 | Ga0157371_10553129 | Ga0157371_105531292 | 71 |
| 61 | 3300013105 | Ga0157369_10988144 | Ga0157369_109881442 | 71 |
| 62 | 3300013296 | Ga0157374_10259888 | Ga0157374_102598883 | 71 |
| 63 | 3300017792 | Ga0163161_10459496 | Ga0163161_104594962 | 71 |
| 64 | 3300025321 | Ga0207656_10057128 | Ga0207656_100571282 | 71 |
| 65 | 3300025893 | Ga0207682_10188456 | Ga0207682_101884562 | 71 |
| 66 | 3300025909 | Ga0207705_10013482 | Ga0207705_100134822 | 71 |
| 67 | 3300025909 | Ga0207705_10240646 | Ga0207705_102406461 | 71 |
| 68 | 3300025909 | Ga0207705_11017528 | Ga0207705_110175282 | 71 |
| 69 | 3300025909 | Ga0207705_11438747 | Ga0207705_114387472 | 71 |
| 70 | 3300025919 | Ga0207657_10101957 | Ga0207657_101019572 | 71 |
| 71 | 3300025919 | Ga0207657_10691033 | Ga0207657_106910332 | 71 |
| 72 | 3300025919 | Ga0207657_11175030 | Ga0207657_111750301 | 71 |
| 73 | 3300025920 | Ga0207649_10037332 | Ga0207649_100373323 | 71 |
| 74 | 3300025920 | Ga0207649_10220818 | Ga0207649_102208183 | 71 |
| 75 | 3300025920 | Ga0207649_10608212 | Ga0207649_106082122 | 71 |
| 76 | 3300025921 | Ga0207652_10747772 | Ga0207652_107477721 | 71 |
| 77 | 3300025925 | Ga0207650_10045422 | Ga0207650_100454224 | 71 |
| 78 | 3300025925 | Ga0207650_10079035 | Ga0207650_100790352 | 71 |
| 79 | 3300025925 | Ga0207650_10179625 | Ga0207650_101796252 | 71 |
| 80 | 3300025925 | Ga0207650_11092359 | Ga0207650_110923592 | 71 |
| 81 | 3300025926 | Ga0207659_10008061 | Ga0207659_100080611 | 71 |
| 82 | 3300025928 | Ga0207700_10290336 | Ga0207700_102903362 | 71 |
| 83 | 3300025928 | Ga0207700_11935541 | Ga0207700_119355411 | 71 |
| 84 | 3300025929 | Ga0207664_10475384 | Ga0207664_104753841 | 71 |
| 85 | 3300025929 | Ga0207664_10909167 | Ga0207664_109091672 | 71 |
| 86 | 3300025932 | Ga0207690_10065441 | Ga0207690_100654413 | 71 |
| 87 | 3300025932 | Ga0207690_10648935 | Ga0207690_106489352 | 71 |
| 88 | 3300025933 | Ga0207706_10145248 | Ga0207706_101452484 | 71 |
| 89 | 3300025933 | Ga0207706_10454784 | Ga0207706_104547842 | 71 |
| 90 | 3300025937 | Ga0207669_10032825 | Ga0207669_100328254 | 71 |
| 91 | 3300025937 | Ga0207669_10394262 | Ga0207669_103942622 | 71 |
| 92 | 3300025945 | Ga0207679_10004383 | Ga0207679_100043838 | 71 |
| 93 | 3300025945 | Ga0207679_10020172 | Ga0207679_100201722 | 71 |
| 94 | 3300025945 | Ga0207679_10021897 | Ga0207679_100218972 | 71 |
| 95 | 3300025945 | Ga0207679_11232852 | Ga0207679_112328522 | 71 |
| 96 | 3300025960 | Ga0207651_10211135 | Ga0207651_102111351 | 71 |
| 97 | 3300025972 | Ga0207668_10562604 | Ga0207668_105626042 | 71 |
| 98 | 3300025981 | Ga0207640_10085421 | Ga0207640_100854213 | 71 |
| 99 | 3300025986 | Ga0207658_10982459 | Ga0207658_109824592 | 71 |
| 100 | 3300026041 | Ga0207639_10054233 | Ga0207639_100542334 | 71 |
| 101 | 3300026067 | Ga0207678_10000213 | Ga0207678_1000021345 | 71 |
| 102 | 3300026067 | Ga0207678_10016854 | Ga0207678_100168543 | 71 |
| 103 | 3300026078 | Ga0207702_10438530 | Ga0207702_104385302 | 71 |
| 104 | 3300026078 | Ga0207702_12016189 | Ga0207702_120161891 | 71 |
| 105 | 3300026116 | Ga0207674_10639183 | Ga0207674_106391832 | 71 |
| 106 | 3300026121 | Ga0207683_10183751 | Ga0207683_101837511 | 71 |
| 107 | 3300026142 | Ga0207698_10212329 | Ga0207698_102123293 | 71 |
| 108 | 3300026142 | Ga0207698_10305271 | Ga0207698_103052712 | 71 |
| 109 | 3300026142 | Ga0207698_10410110 | Ga0207698_104101102 | 71 |
| 110 | 3300026142 | Ga0207698_10635277 | Ga0207698_106352772 | 71 |
| 111 | 3300026142 | Ga0207698_11618792 | Ga0207698_116187922 | 71 |
| 112 | 3300031548 | Ga0307408_100730623 | Ga0307408_1007306232 | 71 |
| 113 | 3300031824 | Ga0307413_11643818 | Ga0307413_116438182 | 71 |
| 114 | 3300031852 | Ga0307410_10117594 | Ga0307410_101175943 | 71 |
| 115 | 3300031903 | Ga0307407_10240238 | Ga0307407_102402383 | 71 |
| 116 | 3300031995 | Ga0307409_100037163 | Ga0307409_1000371632 | 71 |
| 117 | 3300032002 | Ga0307416_102181591 | Ga0307416_1021815912 | 71 |
| 118 | 3300032005 | Ga0307411_10070583 | Ga0307411_100705833 | 71 |
| 119 | 3300037312 | Ga0395899_0068758 | Ga0395899_0068758_1789_2004 | 71 |
| 120 | 3300037418 | Ga0395900_0622088 | Ga0395900_0622088_278_493 | 71 |
| 121 | 3300037418 | Ga0395900_0911645 | Ga0395900_0911645_464_679 | 71 |
| 122 | 3300037418 | Ga0395900_1686752 | Ga0395900_1686752_52_267 | 71 |
| 123 | 3300037471 | Ga0395905_0116331 | Ga0395905_0116331_2041_2256 | 71 |
| 124 | 3300037471 | Ga0395905_1672714 | Ga0395905_1672714_113_328 | 71 |
| 125 | 3300038443 | Ga0395901_0578999 | Ga0395901_0578999_243_458 | 71 |
| 126 | 3300044706 | Ga0466964_0410411 | Ga0466964_0410411_397_612 | 71 |
| 127 | 3300044719 | Ga0466971_0251447 | Ga0466971_0251447_380_595 | 71 |
| 128 | 3300045051 | Ga0451576_2014326 | Ga0451576_2014326_17_232 | 71 |
| 129 | 3300045976 | Ga0466967_2607550 | Ga0466967_2607550_151_366 | 71 |
| 130 | 3300045976 | Ga0466967_2611402 | Ga0466967_2611402_256_471 | 71 |
| 131 | 3300046684 | Ga0495669_0020798 | Ga0495669_0020798_280_495 | 71 |
| 132 | 3300048914 | Ga0496111_0446418 | Ga0496111_0446418_657_872 | 71 |
| 133 | 3300059510 | Ga0587090_101986 | Ga0587090_101986_89_304 | 71 |
| 134 | 3300059644 | Ga0587075_023519 | Ga0587075_023519_158_373 | 71 |
| 135 | 3300059646 | Ga0587078_051535 | Ga0587078_051535_67_282 | 71 |
| 136 | 3300061719 | Ga0466962_0438290 | Ga0466962_0438290_390_605 | 71 |
| 137 | 3300005327 | Ga0070658_11346833 | Ga0070658_113468331 | 72 |
| 138 | 3300005338 | Ga0068868_100294624 | Ga0068868_1002946241 | 72 |
| 139 | 3300005356 | Ga0070674_100651853 | Ga0070674_1006518531 | 72 |
| 140 | 3300005367 | Ga0070667_100435148 | Ga0070667_1004351481 | 72 |
| 141 | 3300005456 | Ga0070678_101013734 | Ga0070678_1010137341 | 72 |
| 142 | 3300005457 | Ga0070662_100009053 | Ga0070662_1000090531 | 72 |
| 143 | 3300005457 | Ga0070662_100936947 | Ga0070662_1009369472 | 72 |
| 144 | 3300005578 | Ga0068854_101464986 | Ga0068854_1014649861 | 72 |
| 145 | 3300005616 | Ga0068852_101225802 | Ga0068852_1012258022 | 72 |
| 146 | 3300005718 | Ga0068866_10393861 | Ga0068866_103938612 | 72 |
| 147 | 3300025899 | Ga0207642_10089780 | Ga0207642_100897802 | 72 |
| 148 | 3300025919 | Ga0207657_11280384 | Ga0207657_112803842 | 72 |
| 149 | 3300025933 | Ga0207706_10017460 | Ga0207706_100174607 | 72 |
| 150 | 3300025933 | Ga0207706_10261027 | Ga0207706_102610271 | 72 |
| 151 | 3300025937 | Ga0207669_10468375 | Ga0207669_104683752 | 72 |
| 152 | 3300025938 | Ga0207704_10062364 | Ga0207704_100623642 | 72 |
| 153 | 3300025940 | Ga0207691_11201996 | Ga0207691_112019961 | 72 |
| 154 | 3300025945 | Ga0207679_10310546 | Ga0207679_103105462 | 72 |
| 155 | 3300026067 | Ga0207678_10919025 | Ga0207678_109190252 | 72 |
| 156 | 3300026121 | Ga0207683_10916794 | Ga0207683_109167942 | 72 |
| 157 | 3300028379 | Ga0268266_10000791 | Ga0268266_1000079137 | 72 |
| 158 | 3300031548 | Ga0307408_101200882 | Ga0307408_1012008821 | 72 |
| 159 | 3300031731 | Ga0307405_10420641 | Ga0307405_104206412 | 72 |
| 160 | 3300031824 | Ga0307413_11363270 | Ga0307413_113632701 | 72 |
| 161 | 3300031852 | Ga0307410_10203942 | Ga0307410_102039421 | 72 |
| 162 | 3300031901 | Ga0307406_10097447 | Ga0307406_100974471 | 72 |
| 163 | 3300031903 | Ga0307407_10029673 | Ga0307407_100296733 | 72 |
| 164 | 3300031911 | Ga0307412_11133241 | Ga0307412_111332411 | 72 |
| 165 | 3300031995 | Ga0307409_100020685 | Ga0307409_1000206854 | 72 |
| 166 | 3300032002 | Ga0307416_100063801 | Ga0307416_1000638014 | 72 |
| 167 | 3300032004 | Ga0307414_10499887 | Ga0307414_104998872 | 72 |
| 168 | 3300032005 | Ga0307411_10045029 | Ga0307411_100450292 | 72 |
| 169 | 3300032126 | Ga0307415_100303528 | Ga0307415_1003035281 | 72 |
| 170 | 3300037471 | Ga0395905_0728124 | Ga0395905_0728124_51_269 | 72 |
| 171 | 3300039437 | Ga0436365_1315373 | Ga0436365_1315373_60_278 | 72 |
| 172 | 3300042006 | Ga0439432_023528 | Ga0439432_023528_236_454 | 72 |
| 173 | 3300042010 | Ga0439452_050262 | Ga0439452_050262_112_330 | 72 |
| 174 | 3300042134 | Ga0450898_109138 | Ga0450898_109138_33_251 | 72 |
| 175 | 3300046539 | Ga0495621_0051866 | Ga0495621_0051866_1219_1440 | 72 |
| 176 | 3300046616 | Ga0495668_0080865 | Ga0495668_0080865_1199_1417 | 72 |
| 177 | 3300048910 | Ga0496107_0483426 | Ga0496107_0483426_632_850 | 72 |
| 178 | 3300048912 | Ga0496109_0733108 | Ga0496109_0733108_285_503 | 72 |
| 179 | 3300049521 | Ga0501298_110904 | Ga0501298_110904_264_482 | 72 |
| 180 | 3300049583 | Ga0501067_0790910 | Ga0501067_0790910_300_521 | 72 |
| 181 | 3300049652 | Ga0501202_049045 | Ga0501202_049045_187_405 | 72 |
| 182 | 3300049660 | Ga0501216_121032 | Ga0501216_121032_288_506 | 72 |
| 183 | 3300049661 | Ga0501217_079588 | Ga0501217_079588_248_466 | 72 |
| 184 | 3300049664 | Ga0501224_023988 | Ga0501224_023988_67_285 | 72 |
| 185 | 3300049668 | Ga0501233_024838 | Ga0501233_024838_300_518 | 72 |
| 186 | 3300049688 | Ga0501259_198146 | Ga0501259_198146_193_411 | 72 |
| 187 | 3300049705 | Ga0501225_0041792 | Ga0501225_0041792_801_1019 | 72 |
| 188 | 3300049706 | Ga0501229_067782 | Ga0501229_067782_84_302 | 72 |
| 189 | 3300049707 | Ga0501234_011983 | Ga0501234_011983_714_932 | 72 |
| 190 | 3300049759 | Ga0501262_029232 | Ga0501262_029232_401_619 | 72 |
| 191 | 3300049765 | Ga0501268_007874 | Ga0501268_007874_305_523 | 72 |
| 192 | 3300049767 | Ga0501270_016295 | Ga0501270_016295_763_981 | 72 |
| 193 | 3300049770 | Ga0501273_003365 | Ga0501273_003365_1224_1442 | 72 |
| 194 | 3300049779 | Ga0501283_010776 | Ga0501283_010776_493_711 | 72 |
| 195 | 3300049850 | Ga0501204_022871 | Ga0501204_022871_124_342 | 72 |
| 196 | 3300049851 | Ga0501212_028363 | Ga0501212_028363_513_731 | 72 |
| 197 | 3300003323 | rootH1_10127400 | rootH1_101274004 | 73 |
| 198 | 3300005328 | Ga0070676_10342611 | Ga0070676_103426112 | 73 |
| 199 | 3300005330 | Ga0070690_100728138 | Ga0070690_1007281382 | 73 |
| 200 | 3300005344 | Ga0070661_100894803 | Ga0070661_1008948032 | 73 |
| 201 | 3300005364 | Ga0070673_100319567 | Ga0070673_1003195671 | 73 |
| 202 | 3300005364 | Ga0070673_100464468 | Ga0070673_1004644682 | 73 |
| 203 | 3300005543 | Ga0070672_101681695 | Ga0070672_1016816952 | 73 |
| 204 | 3300005564 | Ga0070664_100560038 | Ga0070664_1005600382 | 73 |
| 205 | 3300005564 | Ga0070664_101089522 | Ga0070664_1010895222 | 73 |
| 206 | 3300005616 | Ga0068852_100094228 | Ga0068852_1000942283 | 73 |
| 207 | 3300005618 | Ga0068864_100476478 | Ga0068864_1004764781 | 73 |
| 208 | 3300005834 | Ga0068851_11109910 | Ga0068851_111099102 | 73 |
| 209 | 3300005841 | Ga0068863_100194923 | Ga0068863_1001949232 | 73 |
| 210 | 3300005842 | Ga0068858_100035844 | Ga0068858_1000358446 | 73 |
| 211 | 3300005843 | Ga0068860_100035287 | Ga0068860_1000352874 | 73 |
| 212 | 3300009177 | Ga0105248_10014966 | Ga0105248_1001496610 | 73 |
| 213 | 3300009177 | Ga0105248_11351164 | Ga0105248_113511641 | 73 |
| 214 | 3300013308 | Ga0157375_10307918 | Ga0157375_103079182 | 73 |
| 215 | 3300025907 | Ga0207645_10488635 | Ga0207645_104886352 | 73 |
| 216 | 3300025931 | Ga0207644_10001230 | Ga0207644_1000123012 | 73 |
| 217 | 3300025931 | Ga0207644_10331447 | Ga0207644_103314471 | 73 |
| 218 | 3300025933 | Ga0207706_10808644 | Ga0207706_108086441 | 73 |
| 219 | 3300025941 | Ga0207711_10015535 | Ga0207711_100155354 | 73 |
| 220 | 3300025945 | Ga0207679_10724610 | Ga0207679_107246102 | 73 |
| 221 | 3300025945 | Ga0207679_10972908 | Ga0207679_109729082 | 73 |
| 222 | 3300025960 | Ga0207651_10267395 | Ga0207651_102673951 | 73 |
| 223 | 3300026095 | Ga0207676_10260530 | Ga0207676_102605302 | 73 |
| 224 | 3300028381 | Ga0268264_10079559 | Ga0268264_100795593 | 73 |
| 225 | 3300037312 | Ga0395899_0239447 | Ga0395899_0239447_785_1006 | 73 |
| 226 | 3300037418 | Ga0395900_0075643 | Ga0395900_0075643_2996_3217 | 73 |
| 227 | 3300038443 | Ga0395901_0517076 | Ga0395901_0517076_208_429 | 73 |
| 228 | 3300038443 | Ga0395901_1671094 | Ga0395901_1671094_162_383 | 73 |
| 229 | 3300046616 | Ga0495668_0548675 | Ga0495668_0548675_247_468 | 73 |
| 230 | 3300048910 | Ga0496107_0847586 | Ga0496107_0847586_432_653 | 73 |
| 231 | 3300048911 | Ga0496108_0010149 | Ga0496108_0010149_6776_6997 | 73 |
| 232 | 3300048912 | Ga0496109_0024065 | Ga0496109_0024065_4145_4366 | 73 |
| 233 | 3300048913 | Ga0496110_1216086 | Ga0496110_1216086_352_573 | 73 |
| 234 | 3300048915 | Ga0496112_0025698 | Ga0496112_0025698_57_278 | 73 |
| 235 | 3300048916 | Ga0496113_0018858 | Ga0496113_0018858_4516_4737 | 73 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar