F348202

General Info

Members Datasets Scaffolds Average Seq Length
235 121 470 182

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10151675|Ga0207646_101516752
Length 208
Sequence MRVLVPFVAVLAIAACSRGEATPAADPARFDPVASVVMHPRCTNCHQDQSPRQTDLKILHQPLVVRGKDGHGAPTQQCQTCHQATNTADGFVPGVATWGLAPLSMLWEGRTKGQICEQMKDPQRNGARRTGEEVIEHMKTDPLVLWAWTPGAGRTTPPLSHEKFVQALEAWVSAGMPCPPDERASRAKESPDSAITTKVTIRGGGSDG

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
4 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
31 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
37 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
38 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
39 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
40 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
41 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
42 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
43 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
44 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
45 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
46 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
47 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
48 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
49 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
50 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
51 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
52 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
53 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
54 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
55 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
56 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
57 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
58 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
59 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
60 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
64 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
67 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
68 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
69 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
70 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
71 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
72 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
73 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
74 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
75 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
82 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
83 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
84 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
85 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
86 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
87 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
88 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
89 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
92 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
96 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
106 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
107 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
108 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
109 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
110 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
111 2643221664 Massilia sp. Root418 Isolate Unclassified
112 2738541297 Duganella sp. GV083 Isolate Unclassified
113 2738541300 Massilia sp. GV016 Isolate Unclassified
114 2738541357 Duganella sp. GV053 Isolate Unclassified
115 2738543003 Duganella sp. GV066 Isolate Unclassified
116 2738543018 Massilia sp. GV045 Isolate Unclassified
117 2738543026 Duganella sp. GV089 Isolate Unclassified
118 2738543029 Duganella sp. GV039 Isolate Unclassified
119 2738543030 Massilia sp. GV097 Isolate Unclassified
120 2818991436 Collimonas arenae 515 Isolate Unclassified
121 2857564685 Duganella sp. R-74599 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 0
Rhizosphere 91.06
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10151675 3300025922 Bacteria 2090
2 JGI25404J52841_10001078 3300003659 Bacteria 4574
3 Ga0070703_10006301 3300005406 Bacteria 3324
4 Ga0070703_10018224 3300005406 Bacteria 2027
5 Ga0070705_100029682 3300005440 Bacteria 3011
6 Ga0070705_100226538 3300005440 Bacteria 1298
7 Ga0070694_100014811 3300005444 Bacteria 4885
8 Ga0070708_100001378 3300005445 Bacteria 18556
9 Ga0070708_100003005 3300005445 Bacteria 13102
10 Ga0070708_100117587 3300005445 Bacteria 2448
11 Ga0070708_100228295 3300005445 Bacteria 1747
12 Ga0070708_100751817 3300005445 Bacteria 917
13 Ga0070708_101054583 3300005445 Bacteria 762
14 Ga0070708_101242260 3300005445 Bacteria 696
15 Ga0070706_100009924 3300005467 Bacteria 8840
16 Ga0070706_100012793 3300005467 Bacteria 7767
17 Ga0070706_100036573 3300005467 Bacteria 4535
18 Ga0070706_100078285 3300005467 Bacteria 3061
19 Ga0070706_100082302 3300005467 Bacteria 2982
20 Ga0070706_100187780 3300005467 Bacteria 1931
21 Ga0070706_100226530 3300005467 Bacteria 1745
22 Ga0070706_100227460 3300005467 Bacteria 1741
23 Ga0070706_100245226 3300005467 Bacteria 1673
24 Ga0070706_100256476 3300005467 Unclassified 1633
25 Ga0070706_100329604 3300005467 Bacteria 1423
26 Ga0070706_100403307 3300005467 Bacteria 1273
27 Ga0070707_100006685 3300005468 Bacteria 10684
28 Ga0070707_100114617 3300005468 Bacteria 2615
29 Ga0070707_100115546 3300005468 Bacteria 2604
30 Ga0070707_100176963 3300005468 Bacteria 2080
31 Ga0070707_100207897 3300005468 Bacteria 1908
32 Ga0070707_100252149 3300005468 Bacteria 1717
33 Ga0070698_100004356 3300005471 Bacteria 15558
34 Ga0070698_100016683 3300005471 Bacteria 7749
35 Ga0070698_100036687 3300005471 Bacteria 5061
36 Ga0070698_100201414 3300005471 Bacteria 1926
37 Ga0070698_100313146 3300005471 Bacteria 1500
38 Ga0070699_100024004 3300005518 Bacteria 5256
39 Ga0070699_100082472 3300005518 Bacteria 2803
40 Ga0070699_100111452 3300005518 Bacteria 2402
41 Ga0070699_100116114 3300005518 Bacteria 2352
42 Ga0070699_100162164 3300005518 Bacteria 1979
43 Ga0070699_100390873 3300005518 Bacteria 1257
44 Ga0070699_100486339 3300005518 Unclassified 1120
45 Ga0070697_100044608 3300005536 Bacteria 3592
46 Ga0070697_100061367 3300005536 Bacteria 3066
47 Ga0070697_100068724 3300005536 Bacteria 2900
48 Ga0070697_100168461 3300005536 Bacteria 1853
49 Ga0070697_100221000 3300005536 Bacteria 1614
50 Ga0070697_100229366 3300005536 Bacteria 1584
51 Ga0070697_100234032 3300005536 Bacteria 1567
52 Ga0070697_100250356 3300005536 Bacteria 1515
53 Ga0070695_100004712 3300005545 Bacteria 8020
54 Ga0070696_100020196 3300005546 Bacteria 4515
55 Ga0070704_100101252 3300005549 Bacteria 2171
56 Ga0081455_10184943 3300005937 Bacteria 1574
57 Ga0081540_1000425 3300005983 Bacteria 41644
58 Ga0081540_1001076 3300005983 Bacteria 24252
59 Ga0081540_1001489 3300005983 Bacteria 20223
60 Ga0081540_1011010 3300005983 Bacteria 6074
61 Ga0081540_1029643 3300005983 Bacteria 3044
62 Ga0070715_10063528 3300006163 Bacteria 1628
63 Ga0070716_100374303 3300006173 Bacteria 1016
64 Ga0075428_100756674 3300006844 Bacteria 1034
65 Ga0075430_100075904 3300006846 Bacteria 2817
66 Ga0075433_10060367 3300006852 Bacteria 3319
67 Ga0075433_10124580 3300006852 Bacteria 2289
68 Ga0075433_10236940 3300006852 Bacteria 1620
69 Ga0075434_100020019 3300006871 Bacteria 6481
70 Ga0075435_100068992 3300007076 Bacteria 2881
71 Ga0075435_100449158 3300007076 Bacteria 1112
72 Ga0099794_10000665 3300007265 Bacteria 11499
73 Ga0099794_10011588 3300007265 Bacteria 3779
74 Ga0099794_10014899 3300007265 Bacteria 3418
75 Ga0099794_10017525 3300007265 Bacteria 3194
76 Ga0099794_10054419 3300007265 Bacteria 1932
77 Ga0099794_10155108 3300007265 Bacteria 1163
78 Ga0099794_10233544 3300007265 Bacteria 946
79 Ga0105244_10001922 3300009036 Bacteria 16144
80 Ga0111539_10774111 3300009094 Bacteria 1117
81 Ga0114129_10011361 3300009147 Bacteria 12685
82 Ga0114129_10176377 3300009147 Bacteria 2911
83 Ga0114129_10204765 3300009147 Unclassified 2670
84 Ga0114129_10236285 3300009147 Bacteria 2459
85 Ga0114129_10351686 3300009147 Unclassified 1952
86 Ga0182006_1017966 3300015261 Bacteria 2995
87 Ga0182007_10004022 3300015262 Bacteria 6780
88 Ga0182005_1000072 3300015265 Bacteria 84500
89 Ga0207653_10006268 3300025885 Bacteria 3709
90 Ga0207685_10040731 3300025905 Bacteria 1733
91 Ga0207684_10005575 3300025910 Bacteria 11588
92 Ga0207684_10007868 3300025910 Bacteria 9535
93 Ga0207684_10027998 3300025910 Bacteria 4801
94 Ga0207684_10041752 3300025910 Bacteria 3889
95 Ga0207684_10050642 3300025910 Bacteria 3523
96 Ga0207684_10055335 3300025910 Bacteria 3366
97 Ga0207684_10063282 3300025910 Bacteria 3141
98 Ga0207684_10163423 3300025910 Bacteria 1918
99 Ga0207684_10252807 3300025910 Unclassified 1520
100 Ga0207684_10268440 3300025910 Bacteria 1472
101 Ga0207684_10272774 3300025910 Bacteria 1459
102 Ga0207684_10401516 3300025910 Bacteria 1178
103 Ga0207684_10624676 3300025910 Bacteria 919
104 Ga0207684_10631668 3300025910 Unclassified 913
105 Ga0207646_10007524 3300025922 Bacteria 11052
106 Ga0207646_10012094 3300025922 Bacteria 8309
107 Ga0207646_10029639 3300025922 Bacteria 4969
108 Ga0207646_10040061 3300025922 Bacteria 4214
109 Ga0207646_10115193 3300025922 Bacteria 2414
110 Ga0207646_10152946 3300025922 Bacteria 2081
111 Ga0207646_10661772 3300025922 Bacteria 935
112 Ga0207665_10391608 3300025939 Bacteria 1056
113 Ga0209588_1049318 3300027671 Bacteria 1363
114 Ga0209588_1055806 3300027671 Bacteria 1277
115 Ga0209588_1093877 3300027671 Bacteria 966
116 Ga0436361_0584042 3300039447 Bacteria 3670
117 Ga0436363_0737720 3300039450 Unclassified 736
118 Ga0495617_000003 3300046452 Bacteria 541914
119 Ga0495592_0136996 3300046454 Bacteria 1706
120 Ga0495651_0022276 3300046462 Bacteria 4924
121 Ga0495653_0000002 3300046463 Bacteria 507262
122 Ga0495653_0016951 3300046463 Bacteria 5925
123 Ga0495650_0000457 3300046471 Bacteria 63668
124 Ga0495650_0000477 3300046471 Bacteria 61376
125 Ga0495580_0010743 3300046472 Bacteria 7111
126 Ga0495580_0036574 3300046472 Bacteria 3524
127 Ga0495580_0630376 3300046472 Unclassified 706
128 Ga0495605_0014598 3300046474 Bacteria 4296
129 Ga0495584_0010277 3300046491 Bacteria 4809
130 Ga0495585_0002817 3300046492 Bacteria 12126
131 Ga0495585_0041810 3300046492 Bacteria 2569
132 Ga0495596_0045969 3300046500 Bacteria 1715
133 Ga0495607_0000853 3300046501 Bacteria 28749
134 Ga0495607_0018121 3300046501 Bacteria 4497
135 Ga0495607_0018149 3300046501 Bacteria 4492
136 Ga0495583_0093407 3300046506 Bacteria 1292
137 Ga0495606_0000030 3300046507 Bacteria 249484
138 Ga0495606_0000066 3300046507 Bacteria 181028
139 Ga0495606_0034527 3300046507 Bacteria 3471
140 Ga0495608_0001602 3300046511 Bacteria 16212
141 Ga0495616_0002519 3300046513 Bacteria 12114
142 Ga0495618_0079283 3300046514 Bacteria 2094
143 Ga0495628_0011983 3300046516 Bacteria 7312
144 Ga0495631_0010340 3300046518 Bacteria 4619
145 Ga0495632_0005187 3300046519 Bacteria 8689
146 Ga0495637_0001375 3300046520 Bacteria 14567
147 Ga0495637_0007974 3300046520 Bacteria 5216
148 Ga0495644_0018605 3300046523 Bacteria 2653
149 Ga0495648_0000328 3300046524 Bacteria 52422
150 Ga0495648_0007815 3300046524 Bacteria 8508
151 Ga0495642_0002541 3300046528 Bacteria 7382
152 Ga0495652_0092697 3300046529 Bacteria 2467
153 Ga0495654_0016387 3300046530 Bacteria 3921
154 Ga0495654_0023372 3300046530 Bacteria 3202
155 Ga0495609_0008463 3300046538 Bacteria 5039
156 Ga0495597_0071461 3300046542 Bacteria 1494
157 Ga0495645_0124976 3300046543 Bacteria 1808
158 Ga0495633_0004661 3300046558 Bacteria 8632
159 Ga0495633_0052316 3300046558 Bacteria 1924
160 Ga0495668_0001136 3300046616 Bacteria 27262
161 Ga0495668_0003441 3300046616 Bacteria 11853
162 Ga0495611_0009809 3300046648 Bacteria 4048
163 Ga0495625_0006335 3300046660 Bacteria 10573
164 Ga0495625_0089891 3300046660 Bacteria 2125
165 Ga0495625_0275151 3300046660 Bacteria 1085
166 Ga0495661_0042670 3300046665 Bacteria 2794
167 Ga0495657_0019167 3300046675 Bacteria 4939
168 Ga0495599_0006643 3300046678 Bacteria 6980
169 Ga0495623_0126032 3300046679 Bacteria 1537
170 Ga0495646_0045412 3300046680 Bacteria 2683
171 Ga0495669_0020646 3300046684 Bacteria 2852
172 Ga0495624_0008672 3300046690 Bacteria 7079
173 Ga0495671_0000010 3300046692 Bacteria 368641
174 Ga0495671_0048020 3300046692 Bacteria 2130
175 Ga0495649_0250089 3300046694 Bacteria 911
176 Ga0495589_0014294 3300046794 Bacteria 4089
177 Ga0495600_0029188 3300046809 Bacteria 3570
178 Ga0495660_0001412 3300046810 Bacteria 16457
179 Ga0495660_0011587 3300046810 Bacteria 5114
180 Ga0495660_0016321 3300046810 Bacteria 4282
181 Ga0495660_0022297 3300046810 Bacteria 3616
182 Ga0495660_0213382 3300046810 Bacteria 914
183 Ga0495636_0071941 3300047318 Bacteria 1477
184 Ga0495683_0009642 3300047323 Bacteria 5140
185 Ga0495683_0027821 3300047323 Bacteria 2890
186 Ga0495687_001492 3300047443 Bacteria 21373
187 Ga0495677_0019398 3300047445 Bacteria 2466
188 Ga0495679_012758 3300047446 Bacteria 3183
189 Ga0495679_047064 3300047446 Bacteria 1309
190 Ga0495685_000553 3300047447 Bacteria 11583
191 Ga0495673_0000012 3300047469 Bacteria 656908
192 Ga0495673_0000016 3300047469 Bacteria 580643
193 Ga0495681_0183920 3300047470 Bacteria 857
194 Ga0495686_0010987 3300047472 Bacteria 6405
195 Ga0495686_0058385 3300047472 Bacteria 2405
196 Ga0495626_0006337 3300048091 Bacteria 6747
197 Ga0496116_0287388 3300048919 Bacteria 792
198 Ga0496121_0102358 3300048924 Bacteria 2207
199 Ga0496124_0061901 3300048927 Bacteria 3135
200 Ga0496124_0074991 3300048927 Bacteria 2795
201 Ga0495678_044958 3300049459 Bacteria 1744
202 Ga0495682_0003743 3300049460 Bacteria 6693
203 nmdc:mga05p37_111310_c1 3300050507 Bacteria 3368
204 nmdc:mga05p37_1468_c1 3300050507 Bacteria 27377
205 nmdc:mga05p37_299401_c1 3300050507 Bacteria 1912
206 nmdc:mga05p37_932_c1 3300050507 Bacteria 32971
207 nmdc:mga09592_66140_c1 3300050508 Bacteria 3064
208 nmdc:mga0qj67_237805_c1 3300050509 Bacteria 1478
209 nmdc:mga06r32_144794_c1 3300050510 Bacteria 2354
210 nmdc:mga0n895_3448_c1 3300050512 Bacteria 12768
211 nmdc:mga0n895_80199_c1 3300050512 Bacteria 3252
212 nmdc:mga0rr50_111785_c1 3300050513 Bacteria 2163
213 nmdc:mga08x19_125622_c1 3300050514 Bacteria 1723
214 nmdc:mga08x19_273680_c1 3300050514 Bacteria 1169
215 nmdc:mga08x19_644078_c1 3300050514 Bacteria 752
216 nmdc:mga0a205_103711_c1 3300050515 Bacteria 2743
217 nmdc:mga0a205_23635_c1 3300050515 Bacteria 5829
218 nmdc:mga0a205_55059_c1 3300050515 Bacteria 3842
219 Ga0495601_0038057 3300053077 Bacteria 3007
220 Ga0500595_000754 3300053119 Bacteria 19014
221 Ga0500607_298238 3300053121 Bacteria 598
222 Ga0500574_003797 3300053141 Bacteria 2728
223 Ga0500586_000428 3300053145 Bacteria 8435
224 Ga0500619_001191 3300053154 Bacteria 4528
225 2644357630 2643221664 Bacteria 7272945
226 2738829767 2738541297 Bacteria 6549566
227 2738844045 2738541300 Bacteria 6675882
228 2739153563 2738541357 Bacteria 6549408
229 2739195483 2738543003 Bacteria 6549560
230 2739274391 2738543018 Bacteria 6718814
231 2739321959 2738543026 Bacteria 6549408
232 2739340200 2738543029 Bacteria 6549249
233 2739343435 2738543030 Bacteria 6719714
234 2819543710 2818991436 Bacteria 5376622
235 2857566216 2857564685 Bacteria 6290584
236 Ga0207646_10151675
237 JGI25404J52841_10001078
238 Ga0070703_10006301
239 Ga0070703_10018224
240 Ga0070705_100029682
241 Ga0070705_100226538
242 Ga0070694_100014811
243 Ga0070708_100001378
244 Ga0070708_100003005
245 Ga0070708_100117587
246 Ga0070708_100228295
247 Ga0070708_100751817
248 Ga0070708_101054583
249 Ga0070708_101242260
250 Ga0070706_100009924
251 Ga0070706_100012793
252 Ga0070706_100036573
253 Ga0070706_100078285
254 Ga0070706_100082302
255 Ga0070706_100187780
256 Ga0070706_100226530
257 Ga0070706_100227460
258 Ga0070706_100245226
259 Ga0070706_100256476
260 Ga0070706_100329604
261 Ga0070706_100403307
262 Ga0070707_100006685
263 Ga0070707_100114617
264 Ga0070707_100115546
265 Ga0070707_100176963
266 Ga0070707_100207897
267 Ga0070707_100252149
268 Ga0070698_100004356
269 Ga0070698_100016683
270 Ga0070698_100036687
271 Ga0070698_100201414
272 Ga0070698_100313146
273 Ga0070699_100024004
274 Ga0070699_100082472
275 Ga0070699_100111452
276 Ga0070699_100116114
277 Ga0070699_100162164
278 Ga0070699_100390873
279 Ga0070699_100486339
280 Ga0070697_100044608
281 Ga0070697_100061367
282 Ga0070697_100068724
283 Ga0070697_100168461
284 Ga0070697_100221000
285 Ga0070697_100229366
286 Ga0070697_100234032
287 Ga0070697_100250356
288 Ga0070695_100004712
289 Ga0070696_100020196
290 Ga0070704_100101252
291 Ga0081455_10184943
292 Ga0081540_1000425
293 Ga0081540_1001076
294 Ga0081540_1001489
295 Ga0081540_1011010
296 Ga0081540_1029643
297 Ga0070715_10063528
298 Ga0070716_100374303
299 Ga0075428_100756674
300 Ga0075430_100075904
301 Ga0075433_10060367
302 Ga0075433_10124580
303 Ga0075433_10236940
304 Ga0075434_100020019
305 Ga0075435_100068992
306 Ga0075435_100449158
307 Ga0099794_10000665
308 Ga0099794_10011588
309 Ga0099794_10014899
310 Ga0099794_10017525
311 Ga0099794_10054419
312 Ga0099794_10155108
313 Ga0099794_10233544
314 Ga0105244_10001922
315 Ga0111539_10774111
316 Ga0114129_10011361
317 Ga0114129_10176377
318 Ga0114129_10204765
319 Ga0114129_10236285
320 Ga0114129_10351686
321 Ga0182006_1017966
322 Ga0182007_10004022
323 Ga0182005_1000072
324 Ga0207653_10006268
325 Ga0207685_10040731
326 Ga0207684_10005575
327 Ga0207684_10007868
328 Ga0207684_10027998
329 Ga0207684_10041752
330 Ga0207684_10050642
331 Ga0207684_10055335
332 Ga0207684_10063282
333 Ga0207684_10163423
334 Ga0207684_10252807
335 Ga0207684_10268440
336 Ga0207684_10272774
337 Ga0207684_10401516
338 Ga0207684_10624676
339 Ga0207684_10631668
340 Ga0207646_10007524
341 Ga0207646_10012094
342 Ga0207646_10029639
343 Ga0207646_10040061
344 Ga0207646_10115193
345 Ga0207646_10152946
346 Ga0207646_10661772
347 Ga0207665_10391608
348 Ga0209588_1049318
349 Ga0209588_1055806
350 Ga0209588_1093877
351 Ga0436361_0584042
352 Ga0436363_0737720
353 Ga0495617_000003
354 Ga0495592_0136996
355 Ga0495651_0022276
356 Ga0495653_0000002
357 Ga0495653_0016951
358 Ga0495650_0000457
359 Ga0495650_0000477
360 Ga0495580_0010743
361 Ga0495580_0036574
362 Ga0495580_0630376
363 Ga0495605_0014598
364 Ga0495584_0010277
365 Ga0495585_0002817
366 Ga0495585_0041810
367 Ga0495596_0045969
368 Ga0495607_0000853
369 Ga0495607_0018121
370 Ga0495607_0018149
371 Ga0495583_0093407
372 Ga0495606_0000030
373 Ga0495606_0000066
374 Ga0495606_0034527
375 Ga0495608_0001602
376 Ga0495616_0002519
377 Ga0495618_0079283
378 Ga0495628_0011983
379 Ga0495631_0010340
380 Ga0495632_0005187
381 Ga0495637_0001375
382 Ga0495637_0007974
383 Ga0495644_0018605
384 Ga0495648_0000328
385 Ga0495648_0007815
386 Ga0495642_0002541
387 Ga0495652_0092697
388 Ga0495654_0016387
389 Ga0495654_0023372
390 Ga0495609_0008463
391 Ga0495597_0071461
392 Ga0495645_0124976
393 Ga0495633_0004661
394 Ga0495633_0052316
395 Ga0495668_0001136
396 Ga0495668_0003441
397 Ga0495611_0009809
398 Ga0495625_0006335
399 Ga0495625_0089891
400 Ga0495625_0275151
401 Ga0495661_0042670
402 Ga0495657_0019167
403 Ga0495599_0006643
404 Ga0495623_0126032
405 Ga0495646_0045412
406 Ga0495669_0020646
407 Ga0495624_0008672
408 Ga0495671_0000010
409 Ga0495671_0048020
410 Ga0495649_0250089
411 Ga0495589_0014294
412 Ga0495600_0029188
413 Ga0495660_0001412
414 Ga0495660_0011587
415 Ga0495660_0016321
416 Ga0495660_0022297
417 Ga0495660_0213382
418 Ga0495636_0071941
419 Ga0495683_0009642
420 Ga0495683_0027821
421 Ga0495687_001492
422 Ga0495677_0019398
423 Ga0495679_012758
424 Ga0495679_047064
425 Ga0495685_000553
426 Ga0495673_0000012
427 Ga0495673_0000016
428 Ga0495681_0183920
429 Ga0495686_0010987
430 Ga0495686_0058385
431 Ga0495626_0006337
432 Ga0496116_0287388
433 Ga0496121_0102358
434 Ga0496124_0061901
435 Ga0496124_0074991
436 Ga0495678_044958
437 Ga0495682_0003743
438 nmdc:mga05p37_111310_c1
439 nmdc:mga05p37_1468_c1
440 nmdc:mga05p37_299401_c1
441 nmdc:mga05p37_932_c1
442 nmdc:mga09592_66140_c1
443 nmdc:mga0qj67_237805_c1
444 nmdc:mga06r32_144794_c1
445 nmdc:mga0n895_3448_c1
446 nmdc:mga0n895_80199_c1
447 nmdc:mga0rr50_111785_c1
448 nmdc:mga08x19_125622_c1
449 nmdc:mga08x19_273680_c1
450 nmdc:mga08x19_644078_c1
451 nmdc:mga0a205_103711_c1
452 nmdc:mga0a205_23635_c1
453 nmdc:mga0a205_55059_c1
454 Ga0495601_0038057
455 Ga0500595_000754
456 Ga0500607_298238
457 Ga0500574_003797
458 Ga0500586_000428
459 Ga0500619_001191
460 2644357630
461 2738829767
462 2738844045
463 2739153563
464 2739195483
465 2739274391
466 2739321959
467 2739340200
468 2739343435
469 2819543710
470 2857566216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v59-assembly2.cif.gz_B crystal structure of the diheme peroxidase btha y463m variant from burkholderia thailandensis e264 0.3982 117 179
6nx0-assembly1.cif.gz_A crystal structure of the diheme peroxidase btha from burkholderia thailandensis e264 0.3982 117 179
4y5r-assembly1.cif.gz_A crystal structure of a t67a maug/pre-methylamine dehydrogenase complex 0.3776 117 179
4l3h-assembly1.cif.gz_A crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide 0.3679 117 179
3rn0-assembly1.cif.gz_A crystal structure of the w199k-maug/pre-methylamine dehydrogenase complex 0.3544 117 180
ID Description Score Start End Superfamily
2yu2A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4714 128 183 1.20.58.1360
af_Q92794_92_180_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4392 117 178 1.10.10.10
2w2dB00 "Mainly Alpha;Up-down Bundle;Clostridium botulinum neurotoxin B, ""coiled-coil"" domain;Clostridium botulinum neurotoxin b, ""coiled-coil"" domain" 0.4384 115 179 1.20.1120.10
1xg1A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.4213 117 180 1.10.10.60
af_P51979_527_615_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4159 117 179 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q6BSQ1-F1-model_v4 Isoquinoline 1-oxidoreductase subunit 0.866 118 185
AF-A0A355QMK2-F1-model_v4 deleted 0.8593 116 184
AF-A0A537SER1-F1-model_v4 Isoquinoline 1-oxidoreductase subunit 0.8572 104 182
AF-A0A4Q6BSQ1-F1-model_v4 Isoquinoline 1-oxidoreductase subunit 0.8547 118 185
AF-A0A401TWP6-F1-model_v4 Uncharacterized protein 0.8542 110 182

Map