F348058

General Info

Members Datasets Scaffolds Average Seq Length
235 160 470 200

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10013416|Ga0111539_1001341611
Length 221
Sequence MAQKGEPIKTSYEAERLLIWAGEPGWAAGWRAEVAKVELGDGALCARGTQVATDPRPYRLDYRLDASAEDWVTRSLHVAAVGESWERRLRLERDPGGEWTADMDSEGELDLPAPGGGALDLGEALDCDLGFSPLTNTMPVLRHRLHRQPGRADFVMAWISVPDLAVHVSDQRYEHLGINSDGATVKYASVEDGRETFTADLEFDHDGLVRHYPGLARRVTA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
152 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
153 2643221714 Streptomyces sp. Root264 Isolate Unclassified
154 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
155 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
156 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
157 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
158 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
159 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
160 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 0
Isolates 4.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 3.4
Rhizosphere 91.49
Stem 0
Stem Tuber 0
Unclassified 8.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10013416 3300009094 Bacteria 10243
2 JGI24738J21930_10017570 3300002075 Bacteria 1502
3 rootH1_10109059 3300003323 Bacteria 1216
4 Ga0070670_100191988 3300005331 Bacteria 1774
5 Ga0070682_100142468 3300005337 Bacteria 1636
6 Ga0070689_100320257 3300005340 Bacteria 1295
7 Ga0070691_10062089 3300005341 Bacteria 1799
8 Ga0070674_100044322 3300005356 Bacteria 3032
9 Ga0070705_100003039 3300005440 Bacteria 8278
10 Ga0070705_100174559 3300005440 Bacteria 1450
11 Ga0070700_100048619 3300005441 Bacteria 2629
12 Ga0070708_100000174 3300005445 Bacteria 45818
13 Ga0070708_100004028 3300005445 Bacteria 11544
14 Ga0070708_100032468 3300005445 Bacteria 4529
15 Ga0070708_100036063 3300005445 Bacteria 4312
16 Ga0070708_100159635 3300005445 Bacteria 2101
17 Ga0070708_100455732 3300005445 Bacteria 1206
18 Ga0070708_100877650 3300005445 Bacteria 842
19 Ga0070663_100117916 3300005455 Bacteria 2002
20 Ga0070663_100716337 3300005455 Unclassified 852
21 Ga0070662_100338170 3300005457 Bacteria 1231
22 Ga0070706_100000186 3300005467 Bacteria 78421
23 Ga0070706_100031794 3300005467 Bacteria 4865
24 Ga0070706_100048997 3300005467 Unclassified 3898
25 Ga0070706_100448300 3300005467 Unclassified 1201
26 Ga0070707_100000101 3300005468 Bacteria 78421
27 Ga0070707_100020218 3300005468 Bacteria 6277
28 Ga0070707_100034555 3300005468 Bacteria 4822
29 Ga0070707_100075956 3300005468 Bacteria 3241
30 Ga0070707_100152837 3300005468 Bacteria 2247
31 Ga0070707_100597056 3300005468 Bacteria 1066
32 Ga0070707_100935266 3300005468 Bacteria 832
33 Ga0070698_100005988 3300005471 Bacteria 13257
34 Ga0070698_100066404 3300005471 Bacteria 3631
35 Ga0070698_100082259 3300005471 Bacteria 3212
36 Ga0070699_100000152 3300005518 Bacteria 65685
37 Ga0070699_100020405 3300005518 Bacteria 5715
38 Ga0070699_100337807 3300005518 Unclassified 1355
39 Ga0070684_100044625 3300005535 Bacteria 3835
40 Ga0070697_100012288 3300005536 Bacteria 6707
41 Ga0070697_100036618 3300005536 Bacteria 3963
42 Ga0070697_100046803 3300005536 Bacteria 3506
43 Ga0070697_100088467 3300005536 Bacteria 2558
44 Ga0070697_100098463 3300005536 Bacteria 2427
45 Ga0070697_100314258 3300005536 Unclassified 1348
46 Ga0070697_100512533 3300005536 Bacteria 1049
47 Ga0070695_100061577 3300005545 Bacteria 2435
48 Ga0070693_100049123 3300005547 Bacteria 2405
49 Ga0070704_100246988 3300005549 Bacteria 1463
50 Ga0070664_100395874 3300005564 Bacteria 1262
51 Ga0068856_100110984 3300005614 Bacteria 2739
52 Ga0068856_100632117 3300005614 Bacteria 1091
53 Ga0070702_100145482 3300005615 Bacteria 1515
54 Ga0068852_100089555 3300005616 Bacteria 2750
55 Ga0068859_100565807 3300005617 Bacteria 1231
56 Ga0068864_100018845 3300005618 Bacteria 5770
57 Ga0068866_10079535 3300005718 Bacteria 1757
58 Ga0081455_10199172 3300005937 Bacteria 1501
59 Ga0070717_10000002 3300006028 Bacteria 378525
60 Ga0070712_100247218 3300006175 Bacteria 1423
61 Ga0075370_10057461 3300006353 Bacteria 2211
62 Ga0075428_100467653 3300006844 Unclassified 1350
63 Ga0075431_100147778 3300006847 Bacteria 2421
64 Ga0075431_100335778 3300006847 Bacteria 1521
65 Ga0075433_10008212 3300006852 Bacteria 8317
66 Ga0075433_10266084 3300006852 Bacteria 1520
67 Ga0075434_100014942 3300006871 Bacteria 7428
68 Ga0075434_100018897 3300006871 Bacteria 6661
69 Ga0075434_100772734 3300006871 Bacteria 977
70 Ga0075436_100225016 3300006914 Bacteria 1332
71 Ga0075436_100346250 3300006914 Bacteria 1070
72 Ga0097620_100565770 3300006931 Bacteria 1231
73 Ga0075435_100077792 3300007076 Bacteria 2720
74 Ga0075435_100178199 3300007076 Bacteria 1796
75 Ga0075435_100181934 3300007076 Bacteria 1776
76 Ga0099794_10202084 3300007265 Bacteria 1018
77 Ga0111539_10004088 3300009094 Bacteria 19141
78 Ga0111539_10118781 3300009094 Bacteria 3099
79 Ga0105245_10009098 3300009098 Bacteria 8657
80 Ga0105245_10085435 3300009098 Unclassified 2892
81 Ga0105245_10551663 3300009098 Unclassified 1174
82 Ga0114129_10097278 3300009147 Bacteria 4075
83 Ga0114129_10176815 3300009147 Bacteria 2907
84 Ga0105248_10205419 3300009177 Bacteria 2220
85 Ga0105237_10057067 3300009545 Bacteria 3908
86 Ga0105238_10252823 3300009551 Bacteria 1741
87 Ga0105246_10010918 3300011119 Bacteria 5631
88 Ga0105246_10043530 3300011119 Bacteria 3047
89 Ga0105246_10093068 3300011119 Bacteria 2177
90 Ga0157371_10384534 3300013102 Bacteria 1025
91 Ga0157374_10012946 3300013296 Bacteria 7271
92 Ga0163162_10166435 3300013306 Bacteria 2329
93 Ga0157372_10122959 3300013307 Bacteria 2983
94 Ga0163163_10094869 3300014325 Bacteria 3002
95 Ga0163163_10149997 3300014325 Bacteria 2376
96 Ga0157380_10123727 3300014326 Bacteria 2195
97 Ga0157379_10396523 3300014968 Unclassified 1268
98 Ga0157376_11103304 3300014969 Bacteria 819
99 Ga0207688_10039216 3300025901 Bacteria 2631
100 Ga0207647_10033008 3300025904 Bacteria 3319
101 Ga0207684_10030472 3300025910 Unclassified 4591
102 Ga0207684_10033572 3300025910 Bacteria 4363
103 Ga0207684_10093472 3300025910 Bacteria 2564
104 Ga0207684_10250502 3300025910 Unclassified 1528
105 Ga0207693_10074509 3300025915 Bacteria 2658
106 Ga0207649_10153439 3300025920 Bacteria 1589
107 Ga0207646_10036982 3300025922 Bacteria 4403
108 Ga0207646_10050213 3300025922 Unclassified 3733
109 Ga0207646_10054404 3300025922 Bacteria 3580
110 Ga0207646_10661601 3300025922 Bacteria 935
111 Ga0207706_10170507 3300025933 Bacteria 1912
112 Ga0207686_10301622 3300025934 Bacteria 1190
113 Ga0207709_10185280 3300025935 Bacteria 1473
114 Ga0207661_10331770 3300025944 Bacteria 1369
115 Ga0207679_10363030 3300025945 Bacteria 1265
116 Ga0207651_10172373 3300025960 Bacteria 1708
117 Ga0207677_10027794 3300026023 Bacteria 3569
118 Ga0207708_10025086 3300026075 Bacteria 4509
119 Ga0207702_10199819 3300026078 Bacteria 1852
120 Ga0207702_10372878 3300026078 Bacteria 1371
121 Ga0207641_10234518 3300026088 Unclassified 1707
122 Ga0207674_10189237 3300026116 Bacteria 2008
123 Ga0207675_100043049 3300026118 Bacteria 4217
124 Ga0207683_10101074 3300026121 Bacteria 2574
125 Ga0268266_10377356 3300028379 Bacteria 1337
126 Ga0307512_10003527 3300030522 Bacteria 18086
127 Ga0307513_10220158 3300031456 Bacteria 1720
128 Ga0307508_10024873 3300031616 Bacteria 5432
129 Ga0307406_10275615 3300031901 Bacteria 1280
130 Ga0307412_10575661 3300031911 Bacteria 950
131 Ga0307415_100103446 3300032126 Bacteria 2095
132 Ga0373947_0112076 3300035725 Bacteria 1725
133 Ga0373925_0030991 3300037068 Bacteria 3928
134 Ga0395899_0019256 3300037312 Bacteria 5187
135 Ga0395900_0167241 3300037418 Bacteria 2240
136 Ga0395898_0106586 3300037466 Bacteria 2688
137 Ga0395898_0149227 3300037466 Bacteria 2237
138 Ga0395901_0112098 3300038443 Bacteria 2865
139 Ga0395901_1136873 3300038443 Bacteria 750
140 Ga0395901_1504977 3300038443 Unclassified 629
141 Ga0451853_0427054 3300041512 Bacteria 1326
142 Ga0451853_1471576 3300041512 Bacteria 1121
143 Ga0439449_0045885 3300042007 Bacteria 1619
144 Ga0439449_0104739 3300042007 Bacteria 1046
145 Ga0466969_0161895 3300044656 Bacteria 1028
146 Ga0466972_0039473 3300044658 Bacteria 2303
147 Ga0453683_0037141 3300044673 Bacteria 3065
148 Ga0466963_0024820 3300044694 Bacteria 3818
149 Ga0466964_0159686 3300044706 Bacteria 1052
150 Ga0466971_0095224 3300044719 Bacteria 1365
151 Ga0466970_0001147 3300044765 Bacteria 12846
152 Ga0466970_0065176 3300044765 Bacteria 1954
153 Ga0466960_0001047 3300044901 Bacteria 9910
154 Ga0466967_0076647 3300045976 Bacteria 3008
155 Ga0495603_0012448 3300046455 Bacteria 5150
156 Ga0495629_0110120 3300046459 Bacteria 1920
157 Ga0495638_0426093 3300046460 Bacteria 683
158 Ga0495651_0075166 3300046462 Bacteria 2562
159 Ga0495582_0261386 3300046473 Unclassified 993
160 Ga0495662_0220621 3300046476 Bacteria 934
161 Ga0495664_0184620 3300046477 Bacteria 1264
162 Ga0495608_0054480 3300046511 Bacteria 2644
163 Ga0495618_0439874 3300046514 Bacteria 792
164 Ga0495628_0214420 3300046516 Bacteria 1447
165 Ga0495630_0087507 3300046517 Bacteria 2353
166 Ga0495666_0260171 3300046526 Bacteria 789
167 Ga0495652_0396928 3300046529 Bacteria 977
168 Ga0495640_0042687 3300046533 Bacteria 3162
169 Ga0495634_0226637 3300046642 Bacteria 1151
170 Ga0495657_0124414 3300046675 Bacteria 1621
171 Ga0495657_0136128 3300046675 Bacteria 1534
172 Ga0495599_0262052 3300046678 Bacteria 1050
173 Ga0495646_0056402 3300046680 Bacteria 2355
174 Ga0495613_0044296 3300046689 Bacteria 3292
175 Ga0495613_0118998 3300046689 Bacteria 1898
176 Ga0495613_0453094 3300046689 Bacteria 869
177 Ga0495589_0206865 3300046794 Bacteria 925
178 Ga0495604_0078599 3300047317 Bacteria 2475
179 Ga0495604_0492093 3300047317 Bacteria 796
180 Ga0495676_0436867 3300047321 Bacteria 865
181 Ga0495676_0548329 3300047321 Bacteria 756
182 Ga0495680_0015374 3300047322 Bacteria 6604
183 Ga0495687_029894 3300047443 Bacteria 2514
184 Ga0495684_0129096 3300047471 Bacteria 1900
185 Ga0495593_0013770 3300047673 Bacteria 4606
186 Ga0495593_0214398 3300047673 Bacteria 966
187 Ga0495593_0251900 3300047673 Bacteria 884
188 Ga0496101_0064490 3300048904 Bacteria 2669
189 Ga0496104_0178024 3300048907 Bacteria 2037
190 Ga0496105_0159298 3300048908 Bacteria 1853
191 Ga0496108_0064223 3300048911 Bacteria 3092
192 Ga0496110_0052358 3300048913 Bacteria 3587
193 Ga0496111_0145787 3300048914 Bacteria 1755
194 Ga0496112_0319267 3300048915 Bacteria 1497
195 Ga0496113_0060002 3300048916 Bacteria 2866
196 Ga0501034_0146755 3300049571 Bacteria 2336
197 Ga0501036_0175631 3300049572 Bacteria 1804
198 Ga0501036_1280598 3300049572 Unclassified 596
199 Ga0501041_0551343 3300049577 Bacteria 735
200 Ga0501043_0150085 3300049579 Bacteria 1824
201 Ga0501047_0103275 3300049581 Bacteria 2730
202 Ga0501069_0452857 3300049585 Unclassified 763
203 Ga0501075_0163751 3300049591 Bacteria 1697
204 Ga0501079_0386095 3300049741 Bacteria 1098
205 Ga0501081_0362928 3300049743 Unclassified 1069
206 Ga0501044_0038877 3300049823 Bacteria 4968
207 Ga0501045_0186931 3300049824 Bacteria 1544
208 nmdc:mga05p37_141304_c1 3300050507 Bacteria 2950
209 nmdc:mga06r32_14430_c1 3300050510 Bacteria 7172
210 nmdc:mga06r32_473678_c1 3300050510 Unclassified 1231
211 nmdc:mga08y16_58590_c1 3300050511 Bacteria 4024
212 nmdc:mga08y16_9626_c1 3300050511 Bacteria 10145
213 nmdc:mga0n895_17849_c1 3300050512 Bacteria 6552
214 nmdc:mga0n895_193635_c1 3300050512 Bacteria 2064
215 nmdc:mga0n895_304986_c1 3300050512 Bacteria 1614
216 nmdc:mga0rr50_33886_c1 3300050513 Bacteria 3652
217 nmdc:mga0rr50_395008_c1 3300050513 Bacteria 1167
218 nmdc:mga0rr50_410526_c1 3300050513 Bacteria 1145
219 nmdc:mga08x19_15010_c1 3300050514 Bacteria 2328
220 nmdc:mga08x19_172378_c1 3300050514 Bacteria 1474
221 nmdc:mga08x19_203513_c1 3300050514 Bacteria 1358
222 nmdc:mga08x19_252141_c1 3300050514 Bacteria 1219
223 nmdc:mga08x19_455597_c1 3300050514 Bacteria 901
224 nmdc:mga0a205_115084_c1 3300050515 Bacteria 2588
225 nmdc:mga0a205_504980_c1 3300050515 Bacteria 1066
226 2585312043 2582581314 Bacteria 11452267
227 2616698989 2616644814 Bacteria 11555299
228 2644631861 2643221714 Bacteria 9015452
229 2811846577 2808606982 Bacteria 7791042
230 2812354430 2811994879 Bacteria 9313447
231 2812477407 2811994917 Bacteria 7761064
232 2873315746 2873314349 Bacteria 8512634
233 2877677763 2877676314 Bacteria 9512378
234 2912716050 2912715099 Bacteria 9460473
235 2946071272 2946064051 Bacteria 8957905
236 Ga0111539_10013416
237 JGI24738J21930_10017570
238 rootH1_10109059
239 Ga0070670_100191988
240 Ga0070682_100142468
241 Ga0070689_100320257
242 Ga0070691_10062089
243 Ga0070674_100044322
244 Ga0070705_100003039
245 Ga0070705_100174559
246 Ga0070700_100048619
247 Ga0070708_100000174
248 Ga0070708_100004028
249 Ga0070708_100032468
250 Ga0070708_100036063
251 Ga0070708_100159635
252 Ga0070708_100455732
253 Ga0070708_100877650
254 Ga0070663_100117916
255 Ga0070663_100716337
256 Ga0070662_100338170
257 Ga0070706_100000186
258 Ga0070706_100031794
259 Ga0070706_100048997
260 Ga0070706_100448300
261 Ga0070707_100000101
262 Ga0070707_100020218
263 Ga0070707_100034555
264 Ga0070707_100075956
265 Ga0070707_100152837
266 Ga0070707_100597056
267 Ga0070707_100935266
268 Ga0070698_100005988
269 Ga0070698_100066404
270 Ga0070698_100082259
271 Ga0070699_100000152
272 Ga0070699_100020405
273 Ga0070699_100337807
274 Ga0070684_100044625
275 Ga0070697_100012288
276 Ga0070697_100036618
277 Ga0070697_100046803
278 Ga0070697_100088467
279 Ga0070697_100098463
280 Ga0070697_100314258
281 Ga0070697_100512533
282 Ga0070695_100061577
283 Ga0070693_100049123
284 Ga0070704_100246988
285 Ga0070664_100395874
286 Ga0068856_100110984
287 Ga0068856_100632117
288 Ga0070702_100145482
289 Ga0068852_100089555
290 Ga0068859_100565807
291 Ga0068864_100018845
292 Ga0068866_10079535
293 Ga0081455_10199172
294 Ga0070717_10000002
295 Ga0070712_100247218
296 Ga0075370_10057461
297 Ga0075428_100467653
298 Ga0075431_100147778
299 Ga0075431_100335778
300 Ga0075433_10008212
301 Ga0075433_10266084
302 Ga0075434_100014942
303 Ga0075434_100018897
304 Ga0075434_100772734
305 Ga0075436_100225016
306 Ga0075436_100346250
307 Ga0097620_100565770
308 Ga0075435_100077792
309 Ga0075435_100178199
310 Ga0075435_100181934
311 Ga0099794_10202084
312 Ga0111539_10004088
313 Ga0111539_10118781
314 Ga0105245_10009098
315 Ga0105245_10085435
316 Ga0105245_10551663
317 Ga0114129_10097278
318 Ga0114129_10176815
319 Ga0105248_10205419
320 Ga0105237_10057067
321 Ga0105238_10252823
322 Ga0105246_10010918
323 Ga0105246_10043530
324 Ga0105246_10093068
325 Ga0157371_10384534
326 Ga0157374_10012946
327 Ga0163162_10166435
328 Ga0157372_10122959
329 Ga0163163_10094869
330 Ga0163163_10149997
331 Ga0157380_10123727
332 Ga0157379_10396523
333 Ga0157376_11103304
334 Ga0207688_10039216
335 Ga0207647_10033008
336 Ga0207684_10030472
337 Ga0207684_10033572
338 Ga0207684_10093472
339 Ga0207684_10250502
340 Ga0207693_10074509
341 Ga0207649_10153439
342 Ga0207646_10036982
343 Ga0207646_10050213
344 Ga0207646_10054404
345 Ga0207646_10661601
346 Ga0207706_10170507
347 Ga0207686_10301622
348 Ga0207709_10185280
349 Ga0207661_10331770
350 Ga0207679_10363030
351 Ga0207651_10172373
352 Ga0207677_10027794
353 Ga0207708_10025086
354 Ga0207702_10199819
355 Ga0207702_10372878
356 Ga0207641_10234518
357 Ga0207674_10189237
358 Ga0207675_100043049
359 Ga0207683_10101074
360 Ga0268266_10377356
361 Ga0307512_10003527
362 Ga0307513_10220158
363 Ga0307508_10024873
364 Ga0307406_10275615
365 Ga0307412_10575661
366 Ga0307415_100103446
367 Ga0373947_0112076
368 Ga0373925_0030991
369 Ga0395899_0019256
370 Ga0395900_0167241
371 Ga0395898_0106586
372 Ga0395898_0149227
373 Ga0395901_0112098
374 Ga0395901_1136873
375 Ga0395901_1504977
376 Ga0451853_0427054
377 Ga0451853_1471576
378 Ga0439449_0045885
379 Ga0439449_0104739
380 Ga0466969_0161895
381 Ga0466972_0039473
382 Ga0453683_0037141
383 Ga0466963_0024820
384 Ga0466964_0159686
385 Ga0466971_0095224
386 Ga0466970_0001147
387 Ga0466970_0065176
388 Ga0466960_0001047
389 Ga0466967_0076647
390 Ga0495603_0012448
391 Ga0495629_0110120
392 Ga0495638_0426093
393 Ga0495651_0075166
394 Ga0495582_0261386
395 Ga0495662_0220621
396 Ga0495664_0184620
397 Ga0495608_0054480
398 Ga0495618_0439874
399 Ga0495628_0214420
400 Ga0495630_0087507
401 Ga0495666_0260171
402 Ga0495652_0396928
403 Ga0495640_0042687
404 Ga0495634_0226637
405 Ga0495657_0124414
406 Ga0495657_0136128
407 Ga0495599_0262052
408 Ga0495646_0056402
409 Ga0495613_0044296
410 Ga0495613_0118998
411 Ga0495613_0453094
412 Ga0495589_0206865
413 Ga0495604_0078599
414 Ga0495604_0492093
415 Ga0495676_0436867
416 Ga0495676_0548329
417 Ga0495680_0015374
418 Ga0495687_029894
419 Ga0495684_0129096
420 Ga0495593_0013770
421 Ga0495593_0214398
422 Ga0495593_0251900
423 Ga0496101_0064490
424 Ga0496104_0178024
425 Ga0496105_0159298
426 Ga0496108_0064223
427 Ga0496110_0052358
428 Ga0496111_0145787
429 Ga0496112_0319267
430 Ga0496113_0060002
431 Ga0501034_0146755
432 Ga0501036_0175631
433 Ga0501036_1280598
434 Ga0501041_0551343
435 Ga0501043_0150085
436 Ga0501047_0103275
437 Ga0501069_0452857
438 Ga0501075_0163751
439 Ga0501079_0386095
440 Ga0501081_0362928
441 Ga0501044_0038877
442 Ga0501045_0186931
443 nmdc:mga05p37_141304_c1
444 nmdc:mga06r32_14430_c1
445 nmdc:mga06r32_473678_c1
446 nmdc:mga08y16_58590_c1
447 nmdc:mga08y16_9626_c1
448 nmdc:mga0n895_17849_c1
449 nmdc:mga0n895_193635_c1
450 nmdc:mga0n895_304986_c1
451 nmdc:mga0rr50_33886_c1
452 nmdc:mga0rr50_395008_c1
453 nmdc:mga0rr50_410526_c1
454 nmdc:mga08x19_15010_c1
455 nmdc:mga08x19_172378_c1
456 nmdc:mga08x19_203513_c1
457 nmdc:mga08x19_252141_c1
458 nmdc:mga08x19_455597_c1
459 nmdc:mga0a205_115084_c1
460 nmdc:mga0a205_504980_c1
461 2585312043
462 2616698989
463 2644631861
464 2811846577
465 2812354430
466 2812477407
467 2873315746
468 2877677763
469 2912716050
470 2946071272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06475

Glycolipid_bind

Putative glycolipid-binding

18

218

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1t-assembly1.cif.gz_B crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution 0.8214 18 186
2h1t-assembly1.cif.gz_B crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution 0.7559 18 186
8atk-assembly1.cif.gz_A the sh2 domain of mouse sh2b1 0.6056 59 93
6wax-assembly2.cif.gz_B c-terminal sh2 domain of p120rasgap 0.6019 57 88
5w3r-assembly1.cif.gz_A sh2b1 sh2 domain 0.5762 59 93
ID Description Score Start End Superfamily
3sluA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7679 46 85 3.10.450.350
af_Q86AT9_168_273_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6221 111 157 3.30.450.20
af_Q6ZV89_281_393_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.6211 58 90 3.30.505.10
af_F1QIJ5_899_993_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.6193 59 88 3.30.505.10
af_O45539_112_230_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.6096 59 84 3.30.505.10
ID Description Score Start End GO Terms
AF-A0A7M3P4L6-F1-model_v4 Transcriptional regulator 0.9936 1 187
AF-A0A2G7ADX0-F1-model_v4 deleted 0.9931 1 187
AF-A0A7M3P4L6-F1-model_v4 Transcriptional regulator 0.9882 1 187
AF-A0A372ZLF5-F1-model_v4 Glycolipid-binding domain-containing protein 0.9879 1 187
AF-A0A2G7ADX0-F1-model_v4 deleted 0.9878 1 187

Map