F347939

General Info

Members Datasets Scaffolds Average Seq Length
235 124 470 494

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100071848|Ga0068856_1000718482
Length 504
Sequence VNKQISQIAVVSLLLLAGLVVATTYWQSWAAPGLAAKQDNAIQRVAQFRIRRGLIYAADGKTVLAANRAVKRGGETLYFRRYPTHGLASQVVGYSTQGRSRAGIERDQNAYLTASNANVGTIISKLTDNLKGATVTGNNLVLNIRPGAQFLAEKALRGKCGAAVVLNPQTGEVYVMASSPGYDPNKIESGKGYASILHSPSACPGSSSPLFNRATQGLYPPGSTFKTVTAAEALDSGVYTPDSKFYDPGYCTEYGKRVSNAGNPEAPETFGHVNFLQAYQHSINAVFCDIGMKLGARRVIDRAKDFGFYSRPPIELPSDTVSPSGEFDFGKHRFFSDPGLMDPGRLAFGQDKLLVTPLQMALVAAAVANGGTIMEPHLVKKVTAPGGGTVVKVKPQVWKHAMKPSTAASLNEMMQAVVTGGTGTAAQIPGIKVAGKTGTAETGNNPYYDAWFIFFAPADDPQVAGAVVVEHSANGFGGAVSAPIAKELMQAILPAASKQQAGSP

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 18.72
Rhizosphere 80.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100071848 3300005614 Bacteria 3426
2 Ga0070658_10014154 3300005327 Bacteria 6402
3 Ga0070658_10040257 3300005327 Bacteria 3770
4 Ga0070658_10053816 3300005327 Bacteria 3268
5 Ga0070683_100002248 3300005329 Bacteria 15316
6 Ga0070683_100004556 3300005329 Bacteria 11440
7 Ga0070683_100093329 3300005329 Bacteria 2827
8 Ga0070683_100138932 3300005329 Bacteria 2301
9 Ga0070680_100007923 3300005336 Bacteria 8103
10 Ga0070680_100070123 3300005336 Bacteria 2879
11 Ga0070682_100029226 3300005337 Bacteria 3318
12 Ga0070660_100018385 3300005339 Bacteria 5108
13 Ga0070660_100059119 3300005339 Bacteria 2972
14 Ga0070660_100094479 3300005339 Bacteria 2362
15 Ga0070671_100090961 3300005355 Bacteria 2555
16 Ga0070714_100027797 3300005435 Bacteria 4686
17 Ga0070713_100050608 3300005436 Bacteria 3432
18 Ga0070663_100067715 3300005455 Bacteria 2591
19 Ga0070678_100027028 3300005456 Bacteria 3889
20 Ga0070681_10006134 3300005458 Bacteria 11669
21 Ga0070681_10029947 3300005458 Bacteria 5463
22 Ga0070681_10031133 3300005458 Bacteria 5355
23 Ga0070681_10218841 3300005458 Bacteria 1820
24 Ga0070707_100156626 3300005468 Bacteria 2219
25 Ga0070699_100187363 3300005518 Bacteria 1837
26 Ga0070679_100002180 3300005530 Bacteria 17674
27 Ga0070679_100014876 3300005530 Bacteria 7475
28 Ga0070679_100067054 3300005530 Bacteria 3578
29 Ga0070679_100127756 3300005530 Bacteria 2524
30 Ga0070684_100012295 3300005535 Bacteria 6855
31 Ga0070684_100030820 3300005535 Bacteria 4561
32 Ga0070665_100012722 3300005548 Bacteria 8476
33 Ga0070704_100142433 3300005549 Bacteria 1874
34 Ga0068855_100008345 3300005563 Bacteria 12524
35 Ga0068855_100029353 3300005563 Bacteria 6576
36 Ga0068855_100041912 3300005563 Bacteria 5425
37 Ga0068855_100172645 3300005563 Bacteria 2448
38 Ga0068857_100025710 3300005577 Bacteria 5184
39 Ga0068857_100037948 3300005577 Bacteria 4268
40 Ga0068856_100073895 3300005614 Bacteria 3375
41 Ga0068852_100068496 3300005616 Bacteria 3106
42 Ga0068852_100258574 3300005616 Bacteria 1671
43 Ga0081455_10021121 3300005937 Bacteria 6113
44 Ga0081539_10001337 3300005985 Bacteria 42952
45 Ga0081539_10002381 3300005985 Bacteria 26854
46 Ga0070717_10073854 3300006028 Bacteria 2851
47 Ga0070712_100018474 3300006175 Bacteria 4530
48 Ga0097621_100071920 3300006237 Bacteria 2860
49 Ga0068871_100139521 3300006358 Bacteria 2061
50 Ga0075433_10158196 3300006852 Bacteria 2016
51 Ga0075434_100106190 3300006871 Bacteria 2818
52 Ga0075434_100238660 3300006871 Bacteria 1838
53 Ga0075435_100057542 3300007076 Bacteria 3146
54 Ga0105240_10017224 3300009093 Bacteria 9746
55 Ga0105240_10060776 3300009093 Bacteria 4710
56 Ga0105245_10132586 3300009098 Bacteria 2338
57 Ga0105245_10213018 3300009098 Bacteria 1860
58 Ga0105237_10014709 3300009545 Bacteria 8171
59 Ga0105237_10049026 3300009545 Bacteria 4246
60 Ga0105238_10022452 3300009551 Bacteria 6431
61 Ga0105238_10090272 3300009551 Bacteria 3052
62 Ga0105239_10047566 3300010375 Bacteria 4701
63 Ga0157373_10030943 3300013100 Bacteria 3851
64 Ga0157370_10114081 3300013104 Bacteria 2525
65 Ga0157369_10002057 3300013105 Bacteria 24274
66 Ga0157369_10253865 3300013105 Bacteria 1835
67 Ga0157374_10039019 3300013296 Bacteria 4369
68 Ga0157372_10128209 3300013307 Bacteria 2918
69 Ga0157372_10408728 3300013307 Bacteria 1582
70 Ga0157372_10417740 3300013307 Bacteria 1563
71 Ga0157375_10155227 3300013308 Bacteria 2427
72 Ga0182008_10043625 3300014497 Bacteria 2232
73 Ga0206356_11686586 3300020070 Bacteria 5881
74 Ga0207688_10069914 3300025901 Bacteria 1990
75 Ga0207705_10011144 3300025909 Bacteria 6516
76 Ga0207705_10019657 3300025909 Bacteria 4829
77 Ga0207707_10005223 3300025912 Bacteria 11380
78 Ga0207707_10024504 3300025912 Bacteria 5280
79 Ga0207707_10029204 3300025912 Bacteria 4820
80 Ga0207707_10119933 3300025912 Bacteria 2299
81 Ga0207657_10001668 3300025919 Bacteria 23957
82 Ga0207657_10002384 3300025919 Bacteria 20331
83 Ga0207657_10114067 3300025919 Bacteria 2229
84 Ga0207652_10001617 3300025921 Bacteria 19799
85 Ga0207652_10027051 3300025921 Bacteria 4779
86 Ga0207652_10056997 3300025921 Bacteria 3364
87 Ga0207687_10036775 3300025927 Bacteria 3336
88 Ga0207687_10114135 3300025927 Bacteria 2010
89 Ga0207709_10056259 3300025935 Bacteria 2434
90 Ga0207665_10001466 3300025939 Bacteria 15877
91 Ga0207661_10002185 3300025944 Bacteria 13496
92 Ga0207661_10035095 3300025944 Bacteria 3905
93 Ga0207667_10032218 3300025949 Bacteria 5650
94 Ga0207667_10058864 3300025949 Bacteria 4028
95 Ga0207667_10129357 3300025949 Bacteria 2600
96 Ga0207667_10201667 3300025949 Bacteria 2041
97 Ga0207640_10073877 3300025981 Bacteria 2306
98 Ga0207702_10034405 3300026078 Bacteria 4235
99 Ga0207702_10199875 3300026078 Bacteria 1852
100 Ga0207702_10201801 3300026078 Bacteria 1844
101 Ga0207674_10038790 3300026116 Bacteria 4941
102 Ga0207674_10052760 3300026116 Bacteria 4146
103 Ga0207683_10113085 3300026121 Bacteria 2431
104 Ga0207698_10018770 3300026142 Bacteria 4720
105 Ga0265319_1009285 3300028563 Bacteria 4207
106 Ga0265327_10052470 3300031251 Bacteria 2123
107 Ga0307408_100098492 3300031548 Bacteria 2223
108 Ga0265314_10069527 3300031711 Bacteria 2362
109 Ga0373936_0015938 3300035113 Bacteria 2884
110 Ga0373945_0000955 3300035116 Bacteria 8620
111 Ga0373947_0050876 3300035725 Bacteria 2491
112 Ga0373925_0002821 3300037068 Bacteria 13702
113 Ga0395899_0007546 3300037312 Bacteria 8399
114 Ga0395899_0010429 3300037312 Bacteria 7117
115 Ga0395899_0020026 3300037312 Bacteria 5075
116 Ga0395900_0008797 3300037418 Bacteria 10374
117 Ga0395900_0011485 3300037418 Bacteria 9066
118 Ga0395900_0012690 3300037418 Bacteria 8612
119 Ga0395900_0021297 3300037418 Bacteria 6628
120 Ga0395900_0041483 3300037418 Bacteria 4744
121 Ga0395900_0098313 3300037418 Bacteria 3007
122 Ga0395898_0003109 3300037466 Bacteria 18756
123 Ga0395898_0011696 3300037466 Bacteria 9101
124 Ga0395898_0016736 3300037466 Bacteria 7492
125 Ga0395898_0028228 3300037466 Bacteria 5626
126 Ga0395898_0058989 3300037466 Bacteria 3735
127 Ga0395898_0089084 3300037466 Bacteria 2970
128 Ga0395905_0005791 3300037471 Bacteria 12554
129 Ga0395905_0020782 3300037471 Bacteria 6216
130 Ga0395905_0056900 3300037471 Bacteria 3657
131 Ga0395901_0002904 3300038443 Bacteria 17304
132 Ga0395901_0003483 3300038443 Bacteria 15858
133 Ga0395901_0008512 3300038443 Bacteria 10367
134 Ga0395901_0009264 3300038443 Bacteria 9984
135 Ga0395901_0028546 3300038443 Bacteria 5738
136 Ga0395901_0064979 3300038443 Bacteria 3798
137 Ga0395901_0218067 3300038443 Bacteria 1994
138 Ga0436365_0591622 3300039437 Bacteria 1955
139 Ga0466966_0002893 3300044684 Bacteria 11315
140 Ga0466966_0006580 3300044684 Bacteria 7694
141 Ga0466961_0002195 3300044693 Bacteria 12141
142 Ga0466961_0109921 3300044693 Bacteria 1735
143 Ga0466963_0001990 3300044694 Bacteria 11210
144 Ga0466963_0011400 3300044694 Bacteria 5413
145 Ga0466963_0015678 3300044694 Bacteria 4700
146 Ga0466963_0077011 3300044694 Bacteria 2253
147 Ga0466964_0004338 3300044706 Bacteria 5226
148 Ga0466971_0018675 3300044719 Bacteria 3073
149 Ga0466970_0056791 3300044765 Bacteria 2092
150 Ga0466970_0070215 3300044765 Bacteria 1883
151 Ga0466957_0000172 3300044842 Bacteria 28816
152 Ga0466957_0139692 3300044842 Bacteria 1560
153 Ga0466959_0017044 3300045049 Bacteria 5318
154 Ga0466959_0079442 3300045049 Bacteria 2365
155 Ga0466958_0001003 3300045836 Bacteria 12788
156 Ga0466958_0002341 3300045836 Bacteria 9473
157 Ga0466967_0000346 3300045976 Bacteria 21412
158 Ga0466967_0001217 3300045976 Bacteria 14516
159 Ga0466967_0010551 3300045976 Bacteria 6938
160 Ga0466967_0017085 3300045976 Bacteria 5746
161 Ga0466967_0021603 3300045976 Bacteria 5232
162 Ga0466967_0027061 3300045976 Bacteria 4764
163 Ga0495629_0015116 3300046459 Bacteria 5549
164 Ga0495629_0091253 3300046459 Bacteria 2126
165 Ga0495651_0019750 3300046462 Bacteria 5224
166 Ga0495651_0037553 3300046462 Bacteria 3771
167 Ga0495653_0081780 3300046463 Bacteria 2386
168 Ga0495628_0090553 3300046516 Bacteria 2368
169 Ga0495630_0073910 3300046517 Bacteria 2567
170 Ga0495652_0064183 3300046529 Bacteria 3089
171 Ga0495640_0006896 3300046533 Bacteria 8948
172 Ga0495667_0026394 3300046559 Bacteria 3915
173 Ga0495667_0108685 3300046559 Bacteria 1792
174 Ga0495658_0035708 3300046683 Bacteria 2737
175 Ga0495613_0019091 3300046689 Bacteria 5109
176 Ga0495674_0002203 3300047319 Bacteria 19160
177 Ga0495680_0008191 3300047322 Bacteria 9530
178 Ga0496100_0002322 3300048903 Bacteria 9618
179 Ga0496100_0042111 3300048903 Bacteria 2915
180 Ga0496101_0004200 3300048904 Bacteria 9024
181 Ga0496101_0009224 3300048904 Bacteria 6479
182 Ga0496101_0014266 3300048904 Bacteria 5339
183 Ga0496101_0089101 3300048904 Bacteria 2292
184 Ga0496102_0004412 3300048905 Bacteria 11885
185 Ga0496102_0025990 3300048905 Bacteria 5218
186 Ga0496102_0130193 3300048905 Bacteria 2354
187 Ga0496102_0182985 3300048905 Bacteria 1974
188 Ga0496103_0010143 3300048906 Bacteria 5570
189 Ga0496103_0032969 3300048906 Bacteria 3163
190 Ga0496104_0001424 3300048907 Bacteria 20702
191 Ga0496104_0005135 3300048907 Bacteria 11432
192 Ga0496104_0142718 3300048907 Bacteria 2300
193 Ga0496104_0247009 3300048907 Bacteria 1697
194 Ga0496105_0000102 3300048908 Bacteria 57870
195 Ga0496105_0022705 3300048908 Bacteria 5084
196 Ga0496105_0090889 3300048908 Bacteria 2521
197 Ga0496106_0001942 3300048909 Bacteria 15504
198 Ga0496107_0001428 3300048910 Bacteria 14757
199 Ga0496107_0002415 3300048910 Bacteria 12097
200 Ga0496108_0003291 3300048911 Bacteria 12982
201 Ga0496108_0045530 3300048911 Bacteria 3664
202 Ga0496109_0001163 3300048912 Bacteria 21902
203 Ga0496109_0013997 3300048912 Bacteria 6973
204 Ga0496109_0267878 3300048912 Bacteria 1609
205 Ga0496110_0000129 3300048913 Bacteria 43131
206 Ga0496110_0015777 3300048913 Bacteria 6297
207 Ga0496110_0166190 3300048913 Bacteria 2001
208 Ga0496111_0002496 3300048914 Bacteria 11096
209 Ga0496111_0041059 3300048914 Bacteria 3319
210 Ga0496111_0047321 3300048914 Bacteria 3097
211 Ga0496112_0000296 3300048915 Bacteria 32168
212 Ga0496112_0098058 3300048915 Bacteria 2901
213 Ga0496113_0028427 3300048916 Bacteria 4022
214 Ga0496113_0095159 3300048916 Bacteria 2302
215 Ga0496114_0003703 3300048917 Bacteria 11766
216 Ga0496114_0003720 3300048917 Bacteria 11746
217 Ga0496114_0003994 3300048917 Bacteria 11391
218 Ga0496114_0009165 3300048917 Bacteria 7846
219 Ga0496114_0025498 3300048917 Bacteria 4833
220 Ga0496115_0087308 3300048918 Bacteria 2545
221 Ga0496115_0094224 3300048918 Bacteria 2450
222 Ga0501036_0219092 3300049572 Bacteria 1598
223 Ga0501067_0016306 3300049583 Bacteria 4105
224 Ga0501068_0170068 3300049584 Bacteria 1375
225 Ga0501069_0001301 3300049585 Bacteria 12241
226 Ga0501070_0020089 3300049586 Bacteria 5601
227 Ga0501074_0084205 3300049590 Bacteria 2279
228 Ga0501079_0049857 3300049741 Bacteria 3232
229 Ga0501080_0154784 3300049742 Bacteria 2118
230 nmdc:mga05p37_219343_c1 3300050507 Bacteria 2296
231 nmdc:mga06r32_234610_c1 3300050510 Bacteria 1822
232 nmdc:mga0n895_85162_c1 3300050512 Bacteria 3155
233 nmdc:mga0rr50_45469_c1 3300050513 Bacteria 3227
234 Ga0501084_0118667 3300054114 Bacteria 2224
235 Ga0466962_0002953 3300061719 Bacteria 8114
236 Ga0068856_100071848
237 Ga0070658_10014154
238 Ga0070658_10040257
239 Ga0070658_10053816
240 Ga0070683_100002248
241 Ga0070683_100004556
242 Ga0070683_100093329
243 Ga0070683_100138932
244 Ga0070680_100007923
245 Ga0070680_100070123
246 Ga0070682_100029226
247 Ga0070660_100018385
248 Ga0070660_100059119
249 Ga0070660_100094479
250 Ga0070671_100090961
251 Ga0070714_100027797
252 Ga0070713_100050608
253 Ga0070663_100067715
254 Ga0070678_100027028
255 Ga0070681_10006134
256 Ga0070681_10029947
257 Ga0070681_10031133
258 Ga0070681_10218841
259 Ga0070707_100156626
260 Ga0070699_100187363
261 Ga0070679_100002180
262 Ga0070679_100014876
263 Ga0070679_100067054
264 Ga0070679_100127756
265 Ga0070684_100012295
266 Ga0070684_100030820
267 Ga0070665_100012722
268 Ga0070704_100142433
269 Ga0068855_100008345
270 Ga0068855_100029353
271 Ga0068855_100041912
272 Ga0068855_100172645
273 Ga0068857_100025710
274 Ga0068857_100037948
275 Ga0068856_100073895
276 Ga0068852_100068496
277 Ga0068852_100258574
278 Ga0081455_10021121
279 Ga0081539_10001337
280 Ga0081539_10002381
281 Ga0070717_10073854
282 Ga0070712_100018474
283 Ga0097621_100071920
284 Ga0068871_100139521
285 Ga0075433_10158196
286 Ga0075434_100106190
287 Ga0075434_100238660
288 Ga0075435_100057542
289 Ga0105240_10017224
290 Ga0105240_10060776
291 Ga0105245_10132586
292 Ga0105245_10213018
293 Ga0105237_10014709
294 Ga0105237_10049026
295 Ga0105238_10022452
296 Ga0105238_10090272
297 Ga0105239_10047566
298 Ga0157373_10030943
299 Ga0157370_10114081
300 Ga0157369_10002057
301 Ga0157369_10253865
302 Ga0157374_10039019
303 Ga0157372_10128209
304 Ga0157372_10408728
305 Ga0157372_10417740
306 Ga0157375_10155227
307 Ga0182008_10043625
308 Ga0206356_11686586
309 Ga0207688_10069914
310 Ga0207705_10011144
311 Ga0207705_10019657
312 Ga0207707_10005223
313 Ga0207707_10024504
314 Ga0207707_10029204
315 Ga0207707_10119933
316 Ga0207657_10001668
317 Ga0207657_10002384
318 Ga0207657_10114067
319 Ga0207652_10001617
320 Ga0207652_10027051
321 Ga0207652_10056997
322 Ga0207687_10036775
323 Ga0207687_10114135
324 Ga0207709_10056259
325 Ga0207665_10001466
326 Ga0207661_10002185
327 Ga0207661_10035095
328 Ga0207667_10032218
329 Ga0207667_10058864
330 Ga0207667_10129357
331 Ga0207667_10201667
332 Ga0207640_10073877
333 Ga0207702_10034405
334 Ga0207702_10199875
335 Ga0207702_10201801
336 Ga0207674_10038790
337 Ga0207674_10052760
338 Ga0207683_10113085
339 Ga0207698_10018770
340 Ga0265319_1009285
341 Ga0265327_10052470
342 Ga0307408_100098492
343 Ga0265314_10069527
344 Ga0373936_0015938
345 Ga0373945_0000955
346 Ga0373947_0050876
347 Ga0373925_0002821
348 Ga0395899_0007546
349 Ga0395899_0010429
350 Ga0395899_0020026
351 Ga0395900_0008797
352 Ga0395900_0011485
353 Ga0395900_0012690
354 Ga0395900_0021297
355 Ga0395900_0041483
356 Ga0395900_0098313
357 Ga0395898_0003109
358 Ga0395898_0011696
359 Ga0395898_0016736
360 Ga0395898_0028228
361 Ga0395898_0058989
362 Ga0395898_0089084
363 Ga0395905_0005791
364 Ga0395905_0020782
365 Ga0395905_0056900
366 Ga0395901_0002904
367 Ga0395901_0003483
368 Ga0395901_0008512
369 Ga0395901_0009264
370 Ga0395901_0028546
371 Ga0395901_0064979
372 Ga0395901_0218067
373 Ga0436365_0591622
374 Ga0466966_0002893
375 Ga0466966_0006580
376 Ga0466961_0002195
377 Ga0466961_0109921
378 Ga0466963_0001990
379 Ga0466963_0011400
380 Ga0466963_0015678
381 Ga0466963_0077011
382 Ga0466964_0004338
383 Ga0466971_0018675
384 Ga0466970_0056791
385 Ga0466970_0070215
386 Ga0466957_0000172
387 Ga0466957_0139692
388 Ga0466959_0017044
389 Ga0466959_0079442
390 Ga0466958_0001003
391 Ga0466958_0002341
392 Ga0466967_0000346
393 Ga0466967_0001217
394 Ga0466967_0010551
395 Ga0466967_0017085
396 Ga0466967_0021603
397 Ga0466967_0027061
398 Ga0495629_0015116
399 Ga0495629_0091253
400 Ga0495651_0019750
401 Ga0495651_0037553
402 Ga0495653_0081780
403 Ga0495628_0090553
404 Ga0495630_0073910
405 Ga0495652_0064183
406 Ga0495640_0006896
407 Ga0495667_0026394
408 Ga0495667_0108685
409 Ga0495658_0035708
410 Ga0495613_0019091
411 Ga0495674_0002203
412 Ga0495680_0008191
413 Ga0496100_0002322
414 Ga0496100_0042111
415 Ga0496101_0004200
416 Ga0496101_0009224
417 Ga0496101_0014266
418 Ga0496101_0089101
419 Ga0496102_0004412
420 Ga0496102_0025990
421 Ga0496102_0130193
422 Ga0496102_0182985
423 Ga0496103_0010143
424 Ga0496103_0032969
425 Ga0496104_0001424
426 Ga0496104_0005135
427 Ga0496104_0142718
428 Ga0496104_0247009
429 Ga0496105_0000102
430 Ga0496105_0022705
431 Ga0496105_0090889
432 Ga0496106_0001942
433 Ga0496107_0001428
434 Ga0496107_0002415
435 Ga0496108_0003291
436 Ga0496108_0045530
437 Ga0496109_0001163
438 Ga0496109_0013997
439 Ga0496109_0267878
440 Ga0496110_0000129
441 Ga0496110_0015777
442 Ga0496110_0166190
443 Ga0496111_0002496
444 Ga0496111_0041059
445 Ga0496111_0047321
446 Ga0496112_0000296
447 Ga0496112_0098058
448 Ga0496113_0028427
449 Ga0496113_0095159
450 Ga0496114_0003703
451 Ga0496114_0003720
452 Ga0496114_0003994
453 Ga0496114_0009165
454 Ga0496114_0025498
455 Ga0496115_0087308
456 Ga0496115_0094224
457 Ga0501036_0219092
458 Ga0501067_0016306
459 Ga0501068_0170068
460 Ga0501069_0001301
461 Ga0501070_0020089
462 Ga0501074_0084205
463 Ga0501079_0049857
464 Ga0501080_0154784
465 nmdc:mga05p37_219343_c1
466 nmdc:mga06r32_234610_c1
467 nmdc:mga0n895_85162_c1
468 nmdc:mga0rr50_45469_c1
469 Ga0501084_0118667
470 Ga0466962_0002953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00905

Transpeptidase

Penicillin binding protein transpeptidase domain

161

490

0.93

PF21922

PBP_dimer_2

Penicillin binding protein A dimerisation domain

52

140

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r0q-assembly2.cif.gz_B structure of a putative peptidoglycan glycosyltransferase from atopobium parvulum in complex with cephalothin 0.9047 50 491
4jbf-assembly1.cif.gz_A crystal structure of peptidoglycan glycosyltransferase from atopobium parvulum dsm 20469. 0.9036 49 490
4r3j-assembly2.cif.gz_B structure of a putative peptidoglycan glycosyltransferase from atopobium parvulum in complex with cefapirin 0.8975 50 491
4r3j-assembly1.cif.gz_A structure of a putative peptidoglycan glycosyltransferase from atopobium parvulum in complex with cefapirin 0.8959 50 491
4qjg-assembly1.cif.gz_A structure of a putative peptidoglycan glycosyltransferase from atopobium parvulum in complex with penicillin v 0.894 49 490
ID Description Score Start End Superfamily
3oc2A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8853 424 489 3.30.450.330
4r0qA02 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8803 144 491 3.40.710.10
4r0qA02 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8662 144 491 3.40.710.10
4mnrA02 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8604 144 490 3.40.710.10
3ue3A01 Alpha Beta;Alpha-Beta Complex;Penicillin-binding protein 2a (Domain 2);Penicillin-binding protein 2a (Domain 2) 0.8572 50 113 3.90.1310.10
ID Description Score Start End GO Terms
AF-A0A7V5UI45-F1-model_v4 deleted 0.9745 355 491
AF-A0A833G1U9-F1-model_v4 Penicillin-binding protein 2 0.9594 83 497 GO:0005886
GO:0008658
GO:0071555
GO:0071972
AF-A0A833G1U9-F1-model_v4 Penicillin-binding protein 2 0.9501 83 497 GO:0005886
GO:0008658
GO:0071555
GO:0071972
AF-A0A3M0ZNP8-F1-model_v4 PASTA domain-containing protein 0.9342 355 492 GO:0005886
GO:0008658
GO:0071555
AF-A0A847X4V7-F1-model_v4 Penicillin-binding protein 2 0.9258 86 491 GO:0005886
GO:0008658
GO:0071555
GO:0071972

Map