F347886

General Info

Members Datasets Scaffolds Average Seq Length
235 161 227 438

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100000233|Ga0070662_10000023326
Length 467
Sequence MLMFREKLRPAPPDAGAGDAPEGEHPERGWRRSRVAPSLADVYRSIPVTGNTPWRKFLAFLGPGYLVAVGYMDPGNWATDLAGGSAFGYTLLSVVLLSNMMAVLLQGLASKLGIVTGRDLAQACRDHYSRPVGYVLWILCELAIAACDLAEVIGSAIALNLLFGIPLAVGVVLTALDVLLVLLLQKKGFRVLEALVISLVAMIGGCFLFEILIARPEFAALASGFIPRAEVVRNPQMLYIAMGILGATVMPHNLYLHSSIVQTRRYETNAAGKREAVRYAFIDSTVALTFALFINAAILIVAAATFHRTGNTGVAEIQDAYKLLTPLLGVTGASAVFAFALLASGQNSTLTGTLAGQIVMEGFLDLRMRPWMRRLLTRAIAIIPAVIVAVLYGESGTARLLVLSQVILSLQLSFAVFPLVRFTSDRTKMGDFVNPWWLKTLAYSVAVLIAGLNAYLLAQTLRGWLGG

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
3 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
4 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
5 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
6 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
7 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
8 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
77 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
120 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.6
Metatranscriptomes 0
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 0.85
Rhizosphere 94.04
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10074532 3300005289 Bacteria 6203
2 Ga0070683_100001215 3300005329 Bacteria 19570
3 Ga0070683_100014585 3300005329 Bacteria 6881
4 Ga0070666_10003165 3300005335 Bacteria 10001
5 Ga0070680_100002404 3300005336 Bacteria 13861
6 Ga0070680_100218560 3300005336 Bacteria 1608
7 Ga0070671_100010041 3300005355 Bacteria 7604
8 Ga0070705_100001011 3300005440 Bacteria 15664
9 Ga0070694_100001915 3300005444 Bacteria 12311
10 Ga0070694_100005936 3300005444 Bacteria 7401
11 Ga0070708_100003798 3300005445 Bacteria 11849
12 Ga0070708_100094282 3300005445 Bacteria 2730
13 Ga0070662_100000233 3300005457 Bacteria 32774
14 Ga0070681_10032262 3300005458 Bacteria 5256
15 Ga0070685_10001492 3300005466 Bacteria 12323
16 Ga0070707_100131644 3300005468 Bacteria 2432
17 Ga0070698_100064285 3300005471 Bacteria 3697
18 Ga0070679_100004192 3300005530 Bacteria 13296
19 Ga0070684_100037557 3300005535 Bacteria 4156
20 Ga0070697_100157523 3300005536 Bacteria 1917
21 Ga0070686_100000029 3300005544 Bacteria 123581
22 Ga0070695_100000002 3300005545 Bacteria 128335
23 Ga0070695_100012958 3300005545 Bacteria 5006
24 Ga0070696_100000949 3300005546 Bacteria 18816
25 Ga0070696_100001429 3300005546 Bacteria 15613
26 Ga0070696_100001832 3300005546 Bacteria 13956
27 Ga0070696_100134819 3300005546 Bacteria 1799
28 Ga0070665_100000219 3300005548 Bacteria 95548
29 Ga0070665_100264779 3300005548 Bacteria 1720
30 Ga0070704_100001398 3300005549 Bacteria 12848
31 Ga0070704_100003926 3300005549 Bacteria 8561
32 Ga0068852_100005700 3300005616 Bacteria 8934
33 Ga0068863_100001774 3300005841 Bacteria 21408
34 Ga0081539_10005731 3300005985 Bacteria 12421
35 Ga0097621_100035659 3300006237 Bacteria 3977
36 Ga0075428_100181769 3300006844 Bacteria 2276
37 Ga0075434_100000633 3300006871 Bacteria 27175
38 Ga0075434_100019399 3300006871 Bacteria 6581
39 Ga0075434_100032428 3300006871 Bacteria 5151
40 Ga0075434_100035602 3300006871 Bacteria 4922
41 Ga0075434_100133044 3300006871 Bacteria 2506
42 Ga0075434_100343371 3300006871 Bacteria 1514
43 Ga0075436_100001697 3300006914 Bacteria 15078
44 Ga0075436_100015173 3300006914 Bacteria 5279
45 Ga0075435_100000285 3300007076 Bacteria 31543
46 Ga0075435_100027945 3300007076 Bacteria 4419
47 Ga0075435_100052718 3300007076 Bacteria 3278
48 Ga0075435_100067692 3300007076 Bacteria 2908
49 Ga0099794_10000109 3300007265 Bacteria 30197
50 Ga0105240_10075659 3300009093 Bacteria 4152
51 Ga0105245_10112523 3300009098 Bacteria 2533
52 Ga0114129_10001968 3300009147 Bacteria 28100
53 Ga0114129_10021102 3300009147 Bacteria 9248
54 Ga0105241_10000185 3300009174 Bacteria 46915
55 Ga0105248_10000004 3300009177 Bacteria 695244
56 Ga0105248_10039840 3300009177 Bacteria 5266
57 Ga0105238_10194211 3300009551 Bacteria 2006
58 Ga0157371_10000096 3300013102 Bacteria 135954
59 Ga0157370_10104381 3300013104 Bacteria 2653
60 Ga0157369_10009389 3300013105 Bacteria 11185
61 Ga0157369_10032228 3300013105 Bacteria 5764
62 Ga0157378_10138479 3300013297 Bacteria 2258
63 Ga0163162_10004761 3300013306 Bacteria 13096
64 Ga0157372_10020138 3300013307 Bacteria 7194
65 Ga0157372_10110886 3300013307 Bacteria 3142
66 Ga0163163_10110063 3300014325 Bacteria 2782
67 Ga0157379_10083144 3300014968 Bacteria 2869
68 Ga0157376_10021255 3300014969 Bacteria 5039
69 Ga0207654_10000103 3300025911 Bacteria 55909
70 Ga0207654_10053273 3300025911 Bacteria 2335
71 Ga0207695_10105820 3300025913 Bacteria 2800
72 Ga0207695_10238869 3300025913 Bacteria 1719
73 Ga0207660_10005075 3300025917 Bacteria 8571
74 Ga0207652_10010143 3300025921 Bacteria 7589
75 Ga0207652_10010561 3300025921 Bacteria 7432
76 Ga0207644_10011584 3300025931 Bacteria 5839
77 Ga0207706_10000157 3300025933 Bacteria 75435
78 Ga0207670_10127504 3300025936 Bacteria 1859
79 Ga0207711_10000008 3300025941 Bacteria 597686
80 Ga0207711_10000010 3300025941 Bacteria 557970
81 Ga0207711_10034141 3300025941 Bacteria 4308
82 Ga0207661_10004398 3300025944 Bacteria 9880
83 Ga0207702_10065381 3300026078 Bacteria 3115
84 Ga0207676_10058350 3300026095 Bacteria 3044
85 Ga0209588_1000152 3300027671 Bacteria 19783
86 Ga0207428_10068383 3300027907 Bacteria 2794
87 Ga0268266_10000087 3300028379 Bacteria 199089
88 Ga0268266_10003495 3300028379 Bacteria 15629
89 Ga0268266_10004776 3300028379 Bacteria 12885
90 Ga0268266_10039188 3300028379 Bacteria 4035
91 Ga0307413_10033982 3300031824 Bacteria 2910
92 Ga0307410_10169330 3300031852 Bacteria 1644
93 Ga0307409_100049017 3300031995 Bacteria 3218
94 Ga0373959_0000357 3300034820 Bacteria 9168
95 Ga0373946_0044281 3300035171 Bacteria 1837
96 Ga0395900_0217240 3300037418 Bacteria 1929
97 Ga0436364_0383098 3300037853 Bacteria 4286
98 Ga0395901_0014474 3300038443 Bacteria 8024
99 Ga0439455_0012172 3300042012 Bacteria 1927
100 Ga0439434_0013061 3300042435 Bacteria 2463
101 Ga0451577_0070091 3300042876 Bacteria 3127
102 Ga0466966_0053510 3300044684 Bacteria 2561
103 Ga0495603_0001833 3300046455 Bacteria 12526
104 Ga0495603_0069588 3300046455 Bacteria 2070
105 Ga0495629_0015339 3300046459 Bacteria 5503
106 Ga0495638_0080977 3300046460 Bacteria 1972
107 Ga0495651_0062615 3300046462 Bacteria 2846
108 Ga0495650_0000009 3300046471 Bacteria 653845
109 Ga0495580_0056966 3300046472 Bacteria 2751
110 Ga0495639_0002824 3300046475 Bacteria 7557
111 Ga0495664_0022846 3300046477 Bacteria 3628
112 Ga0495584_0065990 3300046491 Bacteria 1820
113 Ga0495594_0000992 3300046499 Bacteria 14761
114 Ga0495594_0008385 3300046499 Bacteria 5325
115 Ga0495583_0018266 3300046506 Bacteria 3695
116 Ga0495583_0040969 3300046506 Bacteria 2172
117 Ga0495628_0045110 3300046516 Bacteria 3506
118 Ga0495643_0052135 3300046522 Bacteria 2198
119 Ga0495644_0000101 3300046523 Bacteria 41293
120 Ga0495648_0126933 3300046524 Bacteria 1362
121 Ga0495666_0024887 3300046526 Bacteria 2957
122 Ga0495652_0036364 3300046529 Bacteria 4283
123 Ga0495652_0109816 3300046529 Bacteria 2220
124 Ga0495665_0002281 3300046531 Bacteria 10366
125 Ga0495640_0004823 3300046533 Bacteria 10738
126 Ga0495586_0028349 3300046535 Bacteria 2996
127 Ga0495587_0023822 3300046536 Bacteria 3759
128 Ga0495621_0010317 3300046539 Bacteria 2853
129 Ga0495667_0049199 3300046559 Bacteria 2782
130 Ga0495634_0060691 3300046642 Bacteria 2515
131 Ga0495625_0001099 3300046660 Bacteria 35115
132 Ga0495625_0079316 3300046660 Bacteria 2290
133 Ga0495635_0037919 3300046663 Bacteria 3336
134 Ga0495661_0076146 3300046665 Bacteria 1948
135 Ga0495599_0008483 3300046678 Bacteria 6248
136 Ga0495623_0078377 3300046679 Bacteria 2048
137 Ga0495669_0064584 3300046684 Bacteria 1661
138 Ga0495613_0035190 3300046689 Bacteria 3717
139 Ga0495624_0008805 3300046690 Bacteria 7017
140 Ga0495670_0033804 3300046691 Bacteria 2545
141 Ga0495600_0126280 3300046809 Bacteria 1664
142 Ga0495674_0004059 3300047319 Bacteria 14164
143 Ga0495674_0034758 3300047319 Bacteria 4554
144 Ga0495674_0086693 3300047319 Bacteria 2680
145 Ga0495676_0003782 3300047321 Bacteria 13755
146 Ga0495680_0164174 3300047322 Bacteria 1611
147 Ga0495675_0038387 3300047444 Bacteria 3049
148 Ga0495673_0031995 3300047469 Bacteria 2458
149 Ga0495614_0002452 3300048089 Bacteria 8242
150 Ga0495626_0044552 3300048091 Bacteria 2075
151 Ga0495626_0075604 3300048091 Bacteria 1505
152 Ga0496104_0080830 3300048907 Bacteria 3099
153 Ga0496105_0036751 3300048908 Bacteria 4036
154 Ga0496124_0008383 3300048927 Bacteria 10814
155 Ga0496124_0089915 3300048927 Bacteria 2506
156 Ga0495682_0019313 3300049460 Bacteria 2564
157 Ga0501033_0000043 3300049570 Bacteria 135426
158 Ga0501033_0003903 3300049570 Bacteria 12121
159 Ga0501033_0004315 3300049570 Bacteria 11415
160 Ga0501033_0043976 3300049570 Bacteria 3325
161 Ga0501034_0006723 3300049571 Bacteria 12322
162 Ga0501034_0054094 3300049571 Bacteria 4041
163 Ga0501034_0097170 3300049571 Bacteria 2941
164 Ga0501036_0007337 3300049572 Bacteria 8982
165 Ga0501037_0004493 3300049573 Bacteria 10137
166 Ga0501038_0000420 3300049574 Bacteria 36894
167 Ga0501038_0024795 3300049574 Bacteria 5346
168 Ga0501043_0000504 3300049579 Bacteria 35125
169 Ga0501043_0002781 3300049579 Bacteria 14621
170 Ga0501046_0000183 3300049580 Bacteria 63582
171 Ga0501046_0020626 3300049580 Bacteria 5448
172 Ga0501047_0012162 3300049581 Bacteria 8146
173 Ga0501067_0000325 3300049583 Bacteria 26128
174 Ga0501067_0004771 3300049583 Bacteria 7512
175 Ga0501067_0030379 3300049583 Bacteria 2997
176 Ga0501068_0000367 3300049584 Bacteria 22701
177 Ga0501069_0035935 3300049585 Bacteria 2730
178 Ga0501070_0006151 3300049586 Bacteria 10237
179 Ga0501071_0027341 3300049587 Bacteria 4012
180 Ga0501071_0142147 3300049587 Bacteria 1787
181 Ga0501073_0009851 3300049589 Bacteria 7031
182 Ga0501073_0016270 3300049589 Bacteria 5390
183 Ga0501073_0090330 3300049589 Bacteria 2129
184 Ga0501073_0174545 3300049589 Bacteria 1487
185 Ga0501074_0000355 3300049590 Bacteria 26861
186 Ga0501074_0138246 3300049590 Bacteria 1742
187 Ga0501076_0112742 3300049592 Bacteria 2200
188 Ga0501077_0077885 3300049593 Bacteria 2100
189 Ga0501079_0040167 3300049741 Bacteria 3609
190 Ga0501080_0018975 3300049742 Bacteria 6369
191 Ga0501080_0027795 3300049742 Bacteria 5259
192 Ga0501080_0170438 3300049742 Bacteria 2008
193 Ga0501081_0050026 3300049743 Bacteria 2879
194 Ga0501083_0002548 3300049744 Bacteria 12518
195 Ga0501083_0058560 3300049744 Bacteria 2577
196 Ga0501035_0007041 3300049822 Bacteria 10509
197 Ga0501044_0016212 3300049823 Bacteria 8010
198 Ga0501044_0272902 3300049823 Bacteria 1626
199 nmdc:mga05p37_260248_c1 3300050507 Bacteria 2077
200 nmdc:mga05p37_36484_c1 3300050507 Bacteria 6031
201 nmdc:mga08y16_40044_c1 3300050511 Bacteria 4914
202 nmdc:mga0n895_105367_c1 3300050512 Bacteria 2832
203 nmdc:mga0n895_11_c1 3300050512 Bacteria 112540
204 nmdc:mga0n895_21131_c1 3300050512 Bacteria 6082
205 nmdc:mga0n895_41906_c1 3300050512 Bacteria 4452
206 nmdc:mga0n895_6925_c1 3300050512 Bacteria 9686
207 nmdc:mga0rr50_101474_c1 3300050513 Bacteria 2262
208 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
209 nmdc:mga0rr50_36027_c1 3300050513 Bacteria 3559
210 nmdc:mga0rr50_41702_c1 3300050513 Bacteria 3347
211 nmdc:mga08x19_11469_c1 3300050514 Bacteria 5334
212 nmdc:mga08x19_1370_c1 3300050514 Bacteria 15085
213 nmdc:mga08x19_44984_c1 3300050514 Bacteria 2820
214 nmdc:mga0a205_175614_c1 3300050515 Bacteria 2038
215 nmdc:mga0a205_196074_c1 3300050515 Bacteria 1910
216 nmdc:mga0a205_3889_c1 3300050515 Bacteria 13373
217 Ga0495601_0008477 3300053077 Bacteria 6073
218 Ga0500644_0031027 3300053088 Bacteria 1696
219 Ga0500583_0000763 3300053092 Bacteria 9336
220 Ga0500641_0000001 3300053096 Bacteria 1115973
221 Ga0500595_000007 3300053119 Bacteria 289461
222 Ga0500595_009887 3300053119 Bacteria 3822
223 Ga0500652_000001 3300053131 Bacteria 946868
224 Ga0501084_0000520 3300054114 Bacteria 29425
225 Ga0501084_0002596 3300054114 Bacteria 14557
226 Ga0501084_0142436 3300054114 Bacteria 2019
227 Ga0501082_0010465 3300060353 Bacteria 7980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046665 Ga0495661_0076146 Ga0495661_0076146_25_1131 367
2 3300048927 Ga0496124_0089915 Ga0496124_0089915_1004_2188 381
3 3300047319 Ga0495674_0004059 Ga0495674_0004059_4994_6289 383
4 3300035171 Ga0373946_0044281 Ga0373946_0044281_609_1793 390
5 3300013297 Ga0157378_10138479 Ga0157378_101384791 391
6 3300042435 Ga0439434_0013061 Ga0439434_0013061_179_1366 391
7 3300047322 Ga0495680_0164174 Ga0495680_0164174_406_1584 391
8 3300050513 nmdc:mga0rr50_101474_c1 nmdc:mga0rr50_101474_c1_41_1219 391
9 3300053088 Ga0500644_0031027 Ga0500644_0031027_23_1201 391
10 3300006871 Ga0075434_100343371 Ga0075434_1003433711 393
11 3300044684 Ga0466966_0053510 Ga0466966_0053510_848_2212 394
12 3300006871 Ga0075434_100133044 Ga0075434_1001330442 396
13 3300014325 Ga0163163_10110063 Ga0163163_101100633 397
14 3300037853 Ga0436364_0383098 Ga0436364_0383098_2946_4151 397
15 3300046460 Ga0495638_0080977 Ga0495638_0080977_255_1454 397
16 3300046524 Ga0495648_0126933 Ga0495648_0126933_80_1276 397
17 3300049460 Ga0495682_0019313 Ga0495682_0019313_1235_2431 397
18 3300049570 Ga0501033_0003903 Ga0501033_0003903_1601_2797 397
19 3300049571 Ga0501034_0054094 Ga0501034_0054094_1281_2477 397
20 3300049572 Ga0501036_0007337 Ga0501036_0007337_3145_4341 397
21 3300049573 Ga0501037_0004493 Ga0501037_0004493_4396_5592 397
22 3300049574 Ga0501038_0024795 Ga0501038_0024795_1198_2394 397
23 3300049579 Ga0501043_0002781 Ga0501043_0002781_2992_4188 397
24 3300049580 Ga0501046_0000183 Ga0501046_0000183_5864_7060 397
25 3300049581 Ga0501047_0012162 Ga0501047_0012162_3502_4698 397
26 3300049589 Ga0501073_0016270 Ga0501073_0016270_1757_2953 397
27 3300049822 Ga0501035_0007041 Ga0501035_0007041_5864_7060 397
28 3300049823 Ga0501044_0016212 Ga0501044_0016212_3081_4277 397
29 3300049823 Ga0501044_0272902 Ga0501044_0272902_355_1551 397
30 3300053119 Ga0500595_000007 Ga0500595_000007_26857_28053 397
31 3300005329 Ga0070683_100014585 Ga0070683_1000145854 398
32 3300009147 Ga0114129_10021102 Ga0114129_100211024 405
33 3300050512 nmdc:mga0n895_6925_c1 nmdc:mga0n895_6925_c1_3717_4940 406
34 3300050515 nmdc:mga0a205_3889_c1 nmdc:mga0a205_3889_c1_6835_8058 406
35 3300049570 Ga0501033_0004315 Ga0501033_0004315_6728_8095 408
36 3300049580 Ga0501046_0020626 Ga0501046_0020626_698_2065 408
37 3300053077 Ga0495601_0008477 Ga0495601_0008477_4506_5888 408
38 3300014968 Ga0157379_10083144 Ga0157379_100831443 410
39 3300009098 Ga0105245_10112523 Ga0105245_101125232 412
40 3300046522 Ga0495643_0052135 Ga0495643_0052135_316_1623 414
41 3300048091 Ga0495626_0044552 Ga0495626_0044552_74_1381 414
42 3300048091 Ga0495626_0075604 Ga0495626_0075604_72_1319 414
43 3300049570 Ga0501033_0000043 Ga0501033_0000043_84448_85836 414
44 3300049574 Ga0501038_0000420 Ga0501038_0000420_35010_36398 414
45 iso_pu_bacteria 2510917027 2511181160 414
46 3300005548 Ga0070665_100000219 Ga0070665_10000021931 418
47 3300028379 Ga0268266_10000087 Ga0268266_1000008719 418
48 3300048927 Ga0496124_0008383 Ga0496124_0008383_4229_5575 418
49 3300009177 Ga0105248_10039840 Ga0105248_100398402 422
50 3300025941 Ga0207711_10034141 Ga0207711_100341415 422
51 3300005530 Ga0070679_100004192 Ga0070679_10000419215 423
52 3300005335 Ga0070666_10003165 Ga0070666_100031658 425
53 3300005336 Ga0070680_100218560 Ga0070680_1002185601 425
54 3300005355 Ga0070671_100010041 Ga0070671_1000100412 425
55 3300005458 Ga0070681_10032262 Ga0070681_100322624 425
56 3300005548 Ga0070665_100264779 Ga0070665_1002647792 425
57 3300005841 Ga0068863_100001774 Ga0068863_10000177411 425
58 3300009093 Ga0105240_10075659 Ga0105240_100756593 425
59 3300009177 Ga0105248_10000004 Ga0105248_1000000491 425
60 3300025931 Ga0207644_10011584 Ga0207644_100115843 425
61 3300025941 Ga0207711_10000008 Ga0207711_10000008183 425
62 3300025941 Ga0207711_10000010 Ga0207711_10000010294 425
63 3300026095 Ga0207676_10058350 Ga0207676_100583502 425
64 3300028379 Ga0268266_10039188 Ga0268266_100391884 425
65 3300046455 Ga0495603_0001833 Ga0495603_0001833_9760_11040 425
66 3300046472 Ga0495580_0056966 Ga0495580_0056966_1311_2591 425
67 3300046499 Ga0495594_0000992 Ga0495594_0000992_261_1541 425
68 3300046506 Ga0495583_0040969 Ga0495583_0040969_120_1400 425
69 3300046523 Ga0495644_0000101 Ga0495644_0000101_35318_36598 425
70 3300046660 Ga0495625_0079316 Ga0495625_0079316_257_1537 425
71 3300046691 Ga0495670_0033804 Ga0495670_0033804_373_1653 425
72 3300053119 Ga0500595_009887 Ga0500595_009887_1340_2626 425
73 3300013307 Ga0157372_10020138 Ga0157372_100201383 427
74 3300049583 Ga0501067_0030379 Ga0501067_0030379_1514_2809 427
75 3300027907 Ga0207428_10068383 Ga0207428_100683831 430
76 3300049742 Ga0501080_0170438 Ga0501080_0170438_629_1954 430
77 3300050511 nmdc:mga08y16_40044_c1 nmdc:mga08y16_40044_c1_1209_2642 430
78 3300053092 Ga0500583_0000763 Ga0500583_0000763_2638_3936 431
79 3300053096 Ga0500641_0000001 Ga0500641_0000001_754211_755509 431
80 3300053131 Ga0500652_000001 Ga0500652_000001_725921_727219 431
81 3300013104 Ga0157370_10104381 Ga0157370_101043812 432
82 3300013105 Ga0157369_10032228 Ga0157369_100322286 432
83 3300013307 Ga0157372_10110886 Ga0157372_101108863 432
84 3300046529 Ga0495652_0109816 Ga0495652_0109816_211_1581 432
85 3300046809 Ga0495600_0126280 Ga0495600_0126280_32_1402 432
86 3300025913 Ga0207695_10238869 Ga0207695_102388692 433
87 iso_pu_bacteria 2884215851 2884217352 433
88 3300006237 Ga0097621_100035659 Ga0097621_1000356592 435
89 3300013306 Ga0163162_10004761 Ga0163162_100047619 435
90 3300014969 Ga0157376_10021255 Ga0157376_100212552 435
91 3300025913 Ga0207695_10105820 Ga0207695_101058201 435
92 3300028379 Ga0268266_10003495 Ga0268266_1000349513 435
93 3300028379 Ga0268266_10004776 Ga0268266_100047769 435
94 3300046455 Ga0495603_0069588 Ga0495603_0069588_123_1457 435
95 3300046459 Ga0495629_0015339 Ga0495629_0015339_3043_4377 435
96 3300046462 Ga0495651_0062615 Ga0495651_0062615_1156_2490 435
97 3300046475 Ga0495639_0002824 Ga0495639_0002824_562_1896 435
98 3300046477 Ga0495664_0022846 Ga0495664_0022846_327_1661 435
99 3300046499 Ga0495594_0008385 Ga0495594_0008385_1353_2687 435
100 3300046516 Ga0495628_0045110 Ga0495628_0045110_1229_2563 435
101 3300046526 Ga0495666_0024887 Ga0495666_0024887_406_1740 435
102 3300046529 Ga0495652_0036364 Ga0495652_0036364_783_2117 435
103 3300046531 Ga0495665_0002281 Ga0495665_0002281_341_1675 435
104 3300046533 Ga0495640_0004823 Ga0495640_0004823_9170_10504 435
105 3300046535 Ga0495586_0028349 Ga0495586_0028349_1206_2540 435
106 3300046536 Ga0495587_0023822 Ga0495587_0023822_279_1613 435
107 3300046559 Ga0495667_0049199 Ga0495667_0049199_225_1559 435
108 3300046642 Ga0495634_0060691 Ga0495634_0060691_559_1893 435
109 3300046660 Ga0495625_0001099 Ga0495625_0001099_21995_23326 435
110 3300046663 Ga0495635_0037919 Ga0495635_0037919_45_1379 435
111 3300046678 Ga0495599_0008483 Ga0495599_0008483_1441_2775 435
112 3300046679 Ga0495623_0078377 Ga0495623_0078377_207_1541 435
113 3300046689 Ga0495613_0035190 Ga0495613_0035190_2339_3673 435
114 3300046690 Ga0495624_0008805 Ga0495624_0008805_3902_5236 435
115 3300047319 Ga0495674_0034758 Ga0495674_0034758_883_2217 435
116 3300047319 Ga0495674_0086693 Ga0495674_0086693_215_1549 435
117 3300047321 Ga0495676_0003782 Ga0495676_0003782_6845_8179 435
118 3300047444 Ga0495675_0038387 Ga0495675_0038387_235_1569 435
119 3300048089 Ga0495614_0002452 Ga0495614_0002452_93_1427 435
120 3300048907 Ga0496104_0080830 Ga0496104_0080830_1105_2439 435
121 3300048908 Ga0496105_0036751 Ga0496105_0036751_285_1619 435
122 3300005545 Ga0070695_100012958 Ga0070695_1000129582 436
123 3300005546 Ga0070696_100001832 Ga0070696_1000018328 436
124 3300046471 Ga0495650_0000009 Ga0495650_0000009_196981_198321 436
125 3300046506 Ga0495583_0018266 Ga0495583_0018266_434_1771 436
126 3300047469 Ga0495673_0031995 Ga0495673_0031995_918_2255 436
127 iso_pu_bacteria 2915606848 2915611538 436
128 3300005329 Ga0070683_100001215 Ga0070683_1000012157 437
129 3300005535 Ga0070684_100037557 Ga0070684_1000375572 437
130 3300005616 Ga0068852_100005700 Ga0068852_1000057003 437
131 3300009551 Ga0105238_10194211 Ga0105238_101942111 437
132 3300025911 Ga0207654_10053273 Ga0207654_100532731 437
133 3300025944 Ga0207661_10004398 Ga0207661_100043984 437
134 iso_pu_bacteria 2889049205 2889054916 437
135 3300005536 Ga0070697_100157523 Ga0070697_1001575232 438
136 iso_pu_bacteria 2919414237 2919418088 438
137 iso_pu_bacteria 2925326138 2925330707 438
138 3300005336 Ga0070680_100002404 Ga0070680_10000240410 439
139 3300005440 Ga0070705_100001011 Ga0070705_10000101113 439
140 3300005444 Ga0070694_100001915 Ga0070694_1000019159 439
141 3300005444 Ga0070694_100005936 Ga0070694_1000059363 439
142 3300005471 Ga0070698_100064285 Ga0070698_1000642852 439
143 3300005545 Ga0070695_100000002 Ga0070695_10000000296 439
144 3300005546 Ga0070696_100000949 Ga0070696_10000094916 439
145 3300005546 Ga0070696_100001429 Ga0070696_1000014298 439
146 3300005546 Ga0070696_100134819 Ga0070696_1001348192 439
147 3300005549 Ga0070704_100001398 Ga0070704_1000013985 439
148 3300005549 Ga0070704_100003926 Ga0070704_1000039265 439
149 3300006844 Ga0075428_100181769 Ga0075428_1001817692 439
150 3300006871 Ga0075434_100032428 Ga0075434_1000324282 439
151 3300006871 Ga0075434_100035602 Ga0075434_1000356023 439
152 3300006914 Ga0075436_100015173 Ga0075436_1000151735 439
153 3300007076 Ga0075435_100052718 Ga0075435_1000527181 439
154 3300007076 Ga0075435_100067692 Ga0075435_1000676922 439
155 3300007265 Ga0099794_10000109 Ga0099794_100001095 439
156 3300025917 Ga0207660_10005075 Ga0207660_100050753 439
157 3300027671 Ga0209588_1000152 Ga0209588_100015215 439
158 3300038443 Ga0395901_0014474 Ga0395901_0014474_5535_6908 439
159 3300046491 Ga0495584_0065990 Ga0495584_0065990_309_1649 439
160 3300046539 Ga0495621_0010317 Ga0495621_0010317_1330_2670 439
161 3300050507 nmdc:mga05p37_260248_c1 nmdc:mga05p37_260248_c1_526_1866 439
162 3300050512 nmdc:mga0n895_41906_c1 nmdc:mga0n895_41906_c1_2459_3799 439
163 3300050513 nmdc:mga0rr50_41702_c1 nmdc:mga0rr50_41702_c1_584_1924 439
164 3300050514 nmdc:mga08x19_11469_c1 nmdc:mga08x19_11469_c1_3854_5194 439
165 3300050515 nmdc:mga0a205_175614_c1 nmdc:mga0a205_175614_c1_242_1582 439
166 3300050515 nmdc:mga0a205_196074_c1 nmdc:mga0a205_196074_c1_545_1885 439
167 3300005445 Ga0070708_100003798 Ga0070708_1000037988 440
168 3300005457 Ga0070662_100000233 Ga0070662_10000023326 440
169 3300005466 Ga0070685_10001492 Ga0070685_100014922 440
170 3300005468 Ga0070707_100131644 Ga0070707_1001316442 440
171 3300005544 Ga0070686_100000029 Ga0070686_100000029111 440
172 3300009174 Ga0105241_10000185 Ga0105241_1000018528 440
173 3300025911 Ga0207654_10000103 Ga0207654_1000010326 440
174 3300025921 Ga0207652_10010561 Ga0207652_100105617 440
175 3300025933 Ga0207706_10000157 Ga0207706_1000015757 440
176 3300025936 Ga0207670_10127504 Ga0207670_101275041 440
177 3300034820 Ga0373959_0000357 Ga0373959_0000357_6607_7998 440
178 3300046684 Ga0495669_0064584 Ga0495669_0064584_102_1505 440
179 3300006871 Ga0075434_100000633 Ga0075434_10000063321 441
180 3300006871 Ga0075434_100019399 Ga0075434_1000193993 441
181 3300006914 Ga0075436_100001697 Ga0075436_1000016979 441
182 3300007076 Ga0075435_100000285 Ga0075435_10000028523 441
183 3300007076 Ga0075435_100027945 Ga0075435_1000279453 441
184 3300009147 Ga0114129_10001968 Ga0114129_100019683 441
185 3300025921 Ga0207652_10010143 Ga0207652_100101435 441
186 3300031824 Ga0307413_10033982 Ga0307413_100339822 441
187 3300031852 Ga0307410_10169330 Ga0307410_101693302 441
188 3300031995 Ga0307409_100049017 Ga0307409_1000490172 441
189 3300037418 Ga0395900_0217240 Ga0395900_0217240_346_1680 441
190 3300042012 Ga0439455_0012172 Ga0439455_0012172_256_1605 441
191 3300049570 Ga0501033_0043976 Ga0501033_0043976_1193_2551 441
192 3300049571 Ga0501034_0097170 Ga0501034_0097170_932_2290 441
193 3300049583 Ga0501067_0004771 Ga0501067_0004771_5874_7232 441
194 3300049584 Ga0501068_0000367 Ga0501068_0000367_19961_21319 441
195 3300049585 Ga0501069_0035935 Ga0501069_0035935_268_1626 441
196 3300049587 Ga0501071_0027341 Ga0501071_0027341_1621_2979 441
197 3300049589 Ga0501073_0090330 Ga0501073_0090330_193_1551 441
198 3300049589 Ga0501073_0174545 Ga0501073_0174545_31_1389 441
199 3300049590 Ga0501074_0138246 Ga0501074_0138246_99_1457 441
200 3300049593 Ga0501077_0077885 Ga0501077_0077885_54_1412 441
201 3300049742 Ga0501080_0018975 Ga0501080_0018975_281_1639 441
202 3300049744 Ga0501083_0002548 Ga0501083_0002548_17_1375 441
203 3300050507 nmdc:mga05p37_36484_c1 nmdc:mga05p37_36484_c1_1562_2920 441
204 3300050512 nmdc:mga0n895_105367_c1 nmdc:mga0n895_105367_c1_166_1524 441
205 3300050512 nmdc:mga0n895_11_c1 nmdc:mga0n895_11_c1_23439_24776 441
206 3300050512 nmdc:mga0n895_21131_c1 nmdc:mga0n895_21131_c1_3710_5068 441
207 3300050513 nmdc:mga0rr50_19_c1 nmdc:mga0rr50_19_c1_35645_36982 441
208 3300050513 nmdc:mga0rr50_36027_c1 nmdc:mga0rr50_36027_c1_892_2271 441
209 3300050514 nmdc:mga08x19_1370_c1 nmdc:mga08x19_1370_c1_7461_8798 441
210 3300050514 nmdc:mga08x19_44984_c1 nmdc:mga08x19_44984_c1_695_2074 441
211 3300054114 Ga0501084_0002596 Ga0501084_0002596_11174_12532 441
212 3300054114 Ga0501084_0142436 Ga0501084_0142436_508_1866 441
213 3300005445 Ga0070708_100094282 Ga0070708_1000942823 442
214 3300005985 Ga0081539_10005731 Ga0081539_100057313 442
215 3300026078 Ga0207702_10065381 Ga0207702_100653812 442
216 3300042876 Ga0451577_0070091 Ga0451577_0070091_1680_3068 442
217 3300049571 Ga0501034_0006723 Ga0501034_0006723_817_2178 442
218 3300049583 Ga0501067_0000325 Ga0501067_0000325_2907_4268 442
219 3300049586 Ga0501070_0006151 Ga0501070_0006151_3522_4883 442
220 3300049587 Ga0501071_0142147 Ga0501071_0142147_192_1553 442
221 3300049589 Ga0501073_0009851 Ga0501073_0009851_5396_6757 442
222 3300049590 Ga0501074_0000355 Ga0501074_0000355_261_1622 442
223 3300049592 Ga0501076_0112742 Ga0501076_0112742_711_2072 442
224 3300049741 Ga0501079_0040167 Ga0501079_0040167_502_1863 442
225 3300049742 Ga0501080_0027795 Ga0501080_0027795_3707_5068 442
226 3300049743 Ga0501081_0050026 Ga0501081_0050026_752_2113 442
227 3300049744 Ga0501083_0058560 Ga0501083_0058560_941_2302 442
228 3300054114 Ga0501084_0000520 Ga0501084_0000520_16161_17522 442
229 3300060353 Ga0501082_0010465 Ga0501082_0010465_4856_6217 442
230 iso_pu_bacteria 2744054657 2745166503 442
231 iso_pu_bacteria 2816332336 2817616634 442
232 3300005289 Ga0065704_10074532 Ga0065704_100745323 444
233 3300013102 Ga0157371_10000096 Ga0157371_1000009666 444
234 3300013105 Ga0157369_10009389 Ga0157369_100093894 444
235 3300049579 Ga0501043_0000504 Ga0501043_0000504_11672_13060 444

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01566

Nramp

Natural resistance-associated macrophage protein-like

77

436

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tl2-assembly1.cif.gz_A crystal structure of eremococcus coleocola manganese transporter in complex with an aromatic bis-isothiourea substituted compound 0.9426 16 440
8e6n-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state 0.9418 41 444
5m8a-assembly1.cif.gz_A crystal structure of eremococcus coleocola manganese transporter mutant e129a 0.9407 16 440
5m8j-assembly1.cif.gz_A crystal structure of eremococcus coleocola manganese transporter mutant h236a 0.9406 16 440
5m8k-assembly1.cif.gz_A crystal structure of eremococcus coleocola manganese transporter mutant e129q 0.9404 16 440
ID Description Score Start End Superfamily
af_Q553K4_170_526_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9829 58 417 1.20.1740.10
af_Q553K4_170_526_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9802 58 417 1.20.1740.10
af_A0A1D8PFT1_6_466_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9661 45 400 1.20.1740.10
af_I1J9B4_68_431_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9573 60 416 1.20.1740.10
af_Q2QN30_93_531_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9544 45 440 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A7W1G1D8-F1-model_v4 Divalent metal cation transporter MntH 0.9977 39 441 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
GO:0046872
AF-A0A1X7GIQ7-F1-model_v4 Divalent metal cation transporter MntH 0.9976 9 443 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
GO:0046872
AF-A0A1I5E2Q2-F1-model_v4 Divalent metal cation transporter MntH 0.9974 16 440 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
GO:0046872
AF-A0A0F4FT17-F1-model_v4 deleted 0.9974 9 440
AF-A0A1I3NKH0-F1-model_v4 Divalent metal cation transporter MntH 0.9971 9 444 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.56 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map