F347810

General Info

Members Datasets Scaffolds Average Seq Length
235 180 470 164

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10471264|Ga0070692_104712642
Length 151
Sequence MAEPFLSEVRIMSFVFAPKGWALCNGQLLPINQNQALFSLLGTTFGGDGRVNFALPDLRGRTPIHVGSGHTLGERGGEQAHTLSIAEIPTHTHVVNGSGTATGVYHDPSNLTTLQAGTIVNVGGSQAHLNMQPFLTLSFCIALQGIFPSPN

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
129 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
130 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
149 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
150 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
151 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
152 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
153 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
154 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
155 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
156 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
157 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
158 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
159 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
160 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
161 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
162 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
163 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
164 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
165 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
166 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
167 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
168 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
169 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
170 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
171 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
172 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
173 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
174 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
175 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
176 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
177 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
178 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
179 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
180 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.96
Metatranscriptomes 0.43
Isolates 13.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 13.19
Rhizoplane 0.85
Rhizosphere 83.83
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10471264 3300005345 Bacteria 808
2 MBSR1b_contig_509442 2162886012 Bacteria 2293
3 JGI25406J46586_10013338 3300003203 Unclassified 3533
4 JGI25407J50210_10109536 3300003373 Bacteria 681
5 Ga0070658_10005615 3300005327 Bacteria 10172
6 Ga0070676_10188485 3300005328 Bacteria 1345
7 Ga0070683_100877830 3300005329 Bacteria 860
8 Ga0070670_100014686 3300005331 Bacteria 6724
9 Ga0068869_100020166 3300005334 Bacteria 4567
10 Ga0068868_100020007 3300005338 Bacteria 5022
11 Ga0070689_100436260 3300005340 Bacteria 1112
12 Ga0070669_100000002 3300005353 Bacteria 506497
13 Ga0070669_100160368 3300005353 Bacteria 1747
14 Ga0070675_100010347 3300005354 Bacteria 7284
15 Ga0070671_100693343 3300005355 Bacteria 883
16 Ga0070674_100117043 3300005356 Bacteria 1967
17 Ga0070673_100046307 3300005364 Bacteria 3377
18 Ga0070659_100584707 3300005366 Bacteria 958
19 Ga0070659_100586799 3300005366 Bacteria 957
20 Ga0070667_100041652 3300005367 Bacteria 3853
21 Ga0070667_100271698 3300005367 Bacteria 1520
22 Ga0070705_100069478 3300005440 Bacteria 2124
23 Ga0070700_100244577 3300005441 Bacteria 1284
24 Ga0070700_100704551 3300005441 Bacteria 803
25 Ga0070694_100220793 3300005444 Bacteria 1421
26 Ga0070708_100001289 3300005445 Bacteria 19265
27 Ga0070678_100092891 3300005456 Bacteria 2319
28 Ga0070662_100030124 3300005457 Bacteria 3793
29 Ga0068867_100411707 3300005459 Bacteria 1143
30 Ga0070706_100013312 3300005467 Bacteria 7607
31 Ga0070706_100017462 3300005467 Bacteria 6622
32 Ga0070706_100076709 3300005467 Bacteria 3093
33 Ga0070707_100132860 3300005468 Bacteria 2421
34 Ga0070707_100189315 3300005468 Bacteria 2006
35 Ga0070707_102215259 3300005468 Bacteria 517
36 Ga0070698_100068567 3300005471 Bacteria 3564
37 Ga0070698_100308233 3300005471 Bacteria 1514
38 Ga0070698_100618208 3300005471 Bacteria 1024
39 Ga0070699_100148919 3300005518 Bacteria 2069
40 Ga0070699_100251271 3300005518 Bacteria 1580
41 Ga0070699_100254605 3300005518 Bacteria 1569
42 Ga0070684_100232407 3300005535 Bacteria 1684
43 Ga0068853_101151917 3300005539 Bacteria 748
44 Ga0070672_100118985 3300005543 Bacteria 2160
45 Ga0070686_100477888 3300005544 Bacteria 963
46 Ga0070693_100229721 3300005547 Bacteria 1220
47 Ga0070665_100000132 3300005548 Bacteria 140229
48 Ga0070665_100075724 3300005548 Bacteria 3372
49 Ga0070665_100957809 3300005548 Bacteria 868
50 Ga0070704_100155123 3300005549 Bacteria 1805
51 Ga0070664_100047103 3300005564 Bacteria 3642
52 Ga0068854_100058068 3300005578 Bacteria 2792
53 Ga0070702_101357107 3300005615 Bacteria 579
54 Ga0068852_100144557 3300005616 Bacteria 2205
55 Ga0068859_100035785 3300005617 Bacteria 4983
56 Ga0068859_100678241 3300005617 Bacteria 1122
57 Ga0068859_102404947 3300005617 Bacteria 580
58 Ga0068864_100002012 3300005618 Bacteria 16756
59 Ga0068861_100829679 3300005719 Bacteria 870
60 Ga0068858_100033310 3300005842 Bacteria 4783
61 Ga0068860_100088856 3300005843 Unclassified 2941
62 Ga0068860_100331076 3300005843 Bacteria 1496
63 Ga0068862_101498518 3300005844 Bacteria 680
64 Ga0081538_10063599 3300005981 Bacteria 2093
65 Ga0081539_10000413 3300005985 Bacteria 91117
66 Ga0070717_10502174 3300006028 Bacteria 1096
67 Ga0075365_10113481 3300006038 Bacteria 1864
68 Ga0075428_100009880 3300006844 Bacteria 10605
69 Ga0075428_100100782 3300006844 Bacteria 3149
70 Ga0075428_100672094 3300006844 Bacteria 1104
71 Ga0075430_100434048 3300006846 Bacteria 1084
72 Ga0075430_100989628 3300006846 Bacteria 693
73 Ga0075431_100003588 3300006847 Bacteria 15039
74 Ga0075431_100019275 3300006847 Bacteria 6954
75 Ga0075431_100089044 3300006847 Bacteria 3186
76 Ga0075431_100348178 3300006847 Bacteria 1490
77 Ga0075431_100703461 3300006847 Bacteria 988
78 Ga0075433_10001443 3300006852 Bacteria 17539
79 Ga0075433_10490486 3300006852 Bacteria 1082
80 Ga0075434_100072399 3300006871 Bacteria 3438
81 Ga0075434_100258889 3300006871 Bacteria 1759
82 Ga0075429_100517039 3300006880 Bacteria 1046
83 Ga0068865_100116117 3300006881 Bacteria 1982
84 Ga0075436_100447377 3300006914 Unclassified 940
85 Ga0097620_100035784 3300006931 Bacteria 4983
86 Ga0097620_100678242 3300006931 Bacteria 1122
87 Ga0097620_102404901 3300006931 Bacteria 580
88 Ga0105245_10602702 3300009098 Bacteria 1125
89 Ga0114129_10049520 3300009147 Bacteria 5903
90 Ga0114129_10646844 3300009147 Bacteria 1365
91 Ga0114129_12176798 3300009147 Bacteria 668
92 Ga0105242_10042162 3300009176 Bacteria 3683
93 Ga0105248_10022024 3300009177 Bacteria 7061
94 Ga0105248_10116029 3300009177 Bacteria 3020
95 Ga0105238_10102491 3300009551 Bacteria 2844
96 Ga0105239_10543725 3300010375 Bacteria 1322
97 Ga0157374_10030955 3300013296 Bacteria 4860
98 Ga0157378_10009222 3300013297 Bacteria 8594
99 Ga0163162_10002597 3300013306 Bacteria 17117
100 Ga0157375_10042910 3300013308 Bacteria 4382
101 Ga0157375_10124486 3300013308 Bacteria 2691
102 Ga0163163_10039198 3300014325 Bacteria 4623
103 Ga0157380_10987930 3300014326 Bacteria 874
104 Ga0157377_10048343 3300014745 Bacteria 2386
105 Ga0157376_10460840 3300014969 Bacteria 1242
106 Ga0209233_1012839 3300025261 Bacteria 2412
107 Ga0207645_10205566 3300025907 Bacteria 1296
108 Ga0207684_10000358 3300025910 Bacteria 62368
109 Ga0207684_10022956 3300025910 Bacteria 5328
110 Ga0207660_11251412 3300025917 Bacteria 603
111 Ga0207662_11329789 3300025918 Bacteria 510
112 Ga0207649_10229341 3300025920 Bacteria 1327
113 Ga0207646_10001844 3300025922 Bacteria 25581
114 Ga0207646_10011629 3300025922 Bacteria 8510
115 Ga0207681_10000009 3300025923 Bacteria 410736
116 Ga0207681_10010723 3300025923 Bacteria 5624
117 Ga0207694_10285769 3300025924 Bacteria 1356
118 Ga0207650_10028449 3300025925 Bacteria 4008
119 Ga0207650_10335568 3300025925 Bacteria 1241
120 Ga0207659_10082902 3300025926 Bacteria 2375
121 Ga0207644_10666053 3300025931 Bacteria 867
122 Ga0207690_10366337 3300025932 Bacteria 1142
123 Ga0207690_10428849 3300025932 Bacteria 1059
124 Ga0207670_10452494 3300025936 Bacteria 1035
125 Ga0207669_10211048 3300025937 Bacteria 1417
126 Ga0207691_10023712 3300025940 Bacteria 5776
127 Ga0207711_10110506 3300025941 Bacteria 2444
128 Ga0207689_10683695 3300025942 Bacteria 865
129 Ga0207661_10767615 3300025944 Bacteria 887
130 Ga0207679_10030030 3300025945 Bacteria 3792
131 Ga0207679_10683463 3300025945 Bacteria 930
132 Ga0207667_10595093 3300025949 Bacteria 1116
133 Ga0207640_10051380 3300025981 Bacteria 2679
134 Ga0207658_10048563 3300025986 Bacteria 3113
135 Ga0207658_10119293 3300025986 Bacteria 2100
136 Ga0207677_10173123 3300026023 Bacteria 1690
137 Ga0207703_10046359 3300026035 Bacteria 3500
138 Ga0207708_10504891 3300026075 Bacteria 1014
139 Ga0207641_10101060 3300026088 Bacteria 2541
140 Ga0207641_10200136 3300026088 Bacteria 1841
141 Ga0207648_10469689 3300026089 Bacteria 1148
142 Ga0207648_10874686 3300026089 Bacteria 839
143 Ga0207676_10042034 3300026095 Bacteria 3514
144 Ga0207676_10288281 3300026095 Bacteria 1493
145 Ga0207683_10405077 3300026121 Bacteria 1255
146 Ga0207698_10125917 3300026142 Bacteria 2179
147 Ga0268266_10007583 3300028379 Bacteria 9768
148 Ga0268265_10279080 3300028380 Bacteria 1494
149 Ga0268264_10024379 3300028381 Bacteria 4939
150 Ga0268264_10246950 3300028381 Bacteria 1656
151 Ga0307405_10637791 3300031731 Bacteria 874
152 Ga0307405_11252828 3300031731 Bacteria 643
153 Ga0307413_10003345 3300031824 Bacteria 6736
154 Ga0307410_11065421 3300031852 Bacteria 699
155 Ga0307407_10038515 3300031903 Bacteria 2650
156 Ga0307416_100045428 3300032002 Bacteria 3459
157 Ga0307414_10290112 3300032004 Bacteria 1379
158 Ga0307414_10323308 3300032004 Bacteria 1314
159 Ga0307414_10611124 3300032004 Unclassified 979
160 Ga0307411_10759576 3300032005 Bacteria 850
161 Ga0307415_100016347 3300032126 Bacteria 4421
162 Ga0307415_100479794 3300032126 Bacteria 1082
163 Ga0373937_0275700 3300036401 Bacteria 1588
164 Ga0395905_0209766 3300037471 Bacteria 1825
165 Ga0439435_0205493 3300042436 Bacteria 651
166 Ga0466968_0165798 3300044735 Bacteria 1021
167 Ga0466960_0007298 3300044901 Bacteria 4480
168 Ga0466967_0157127 3300045976 Bacteria 2131
169 Ga0495615_0107229 3300048090 Bacteria 795
170 Ga0496112_0227583 3300048915 Viruses 1820
171 Ga0496112_1013284 3300048915 Bacteria 750
172 Ga0501298_084096 3300049521 Bacteria 704
173 Ga0501042_0584576 3300049578 Bacteria 812
174 Ga0501072_1274455 3300049588 Unclassified 570
175 Ga0501075_0161586 3300049591 Bacteria 1709
176 Ga0501207_097009 3300049654 Bacteria 587
177 Ga0501223_037962 3300049663 Bacteria 935
178 Ga0501225_0051731 3300049705 Bacteria 1144
179 Ga0501079_0750442 3300049741 Bacteria 768
180 Ga0501079_0875148 3300049741 Bacteria 707
181 Ga0501081_0646727 3300049743 Bacteria 793
182 Ga0501083_0022083 3300049744 Bacteria 4417
183 Ga0501045_0224878 3300049824 Bacteria 1397
184 nmdc:mga0yw44_67108_c1 3300050492 Bacteria 2216
185 nmdc:mga07m45_498115_c1 3300050496 Bacteria 705
186 nmdc:mga05p37_20397_c1 3300050507 Bacteria 8017
187 nmdc:mga09592_259068_c1 3300050508 Bacteria 1508
188 nmdc:mga0qj67_414092_c1 3300050509 Bacteria 1087
189 nmdc:mga06r32_126897_c1 3300050510 Bacteria 2521
190 nmdc:mga06r32_19323_c1 3300050510 Bacteria 6252
191 nmdc:mga06r32_23043_c1 3300050510 Bacteria 5759
192 nmdc:mga06r32_432685_c1 3300050510 Bacteria 1296
193 nmdc:mga0n895_12916_c1 3300050512 Bacteria 7508
194 nmdc:mga0n895_249023_c1 3300050512 Bacteria 1803
195 nmdc:mga0rr50_105987_c1 3300050513 Bacteria 2217
196 nmdc:mga08x19_226490_c1 3300050514 Bacteria 676
197 nmdc:mga08x19_393095_c1 3300050514 Unclassified 972
198 nmdc:mga0a205_476473_c1 3300050515 Bacteria 1107
199 nmdc:mga0a205_95070_c1 3300050515 Bacteria 2879
200 Ga0495655_0049162 3300053083 Bacteria 1109
201 Ga0501084_0177130 3300054114 Bacteria 1800
202 Ga0587085_120844 3300059506 Bacteria 575
203 Ga0530510_0333678 3300061734 Unclassified 1138
204 2509371491 2509276018 Bacteria 6910194
205 2869239689 2869234852 Bacteria 6654993
206 2869253359 2869249662 Bacteria 6868783
207 2869271159 2869264136 Bacteria 6880765
208 2869279698 2869278585 Bacteria 7077053
209 2871460219 2871459585 Bacteria 6866887
210 2874112224 2874109183 Bacteria 6517025
211 2874136706 2874131515 Bacteria 6820270
212 2874141533 2874139085 Bacteria 7021506
213 2878735448 2878730984 Bacteria 6380721
214 2903519981 2903513507 Bacteria 6344008
215 2906366641 2906363423 Bacteria 6856682
216 2906376222 2906370794 Bacteria 6881062
217 2906393943 2906393657 Bacteria 6790866
218 2937874581 2937868953 Bacteria 6639878
219 2958097300 2958092219 Bacteria 6861151
220 2958150554 2958144490 Bacteria 6677056
221 2965046641 2965040258 Bacteria 6855979
222 2965096052 2965089291 Bacteria 6866420
223 2968017205 2968016561 Bacteria 7022047
224 2970470500 2970469710 Bacteria 6969209
225 2970493470 2970489779 Bacteria 6517260
226 2970515584 2970510686 Bacteria 7006402
227 2977917107 2977915119 Bacteria 6829656
228 2977957639 2977950692 Bacteria 6893264
229 2996354861 2996348954 Bacteria 7239054
230 3004200180 3004195979 Bacteria 6776956
231 3004234635 3004232784 Bacteria 6662140
232 3004281509 3004275668 Bacteria 7114440
233 8004367056 8004361976 Bacteria 6858373
234 8004644294 8004640170 Bacteria 6723001
235 8004703038 8004695233 Bacteria 6731676
236 Ga0070692_10471264
237 MBSR1b_contig_509442
238 JGI25406J46586_10013338
239 JGI25407J50210_10109536
240 Ga0070658_10005615
241 Ga0070676_10188485
242 Ga0070683_100877830
243 Ga0070670_100014686
244 Ga0068869_100020166
245 Ga0068868_100020007
246 Ga0070689_100436260
247 Ga0070669_100000002
248 Ga0070669_100160368
249 Ga0070675_100010347
250 Ga0070671_100693343
251 Ga0070674_100117043
252 Ga0070673_100046307
253 Ga0070659_100584707
254 Ga0070659_100586799
255 Ga0070667_100041652
256 Ga0070667_100271698
257 Ga0070705_100069478
258 Ga0070700_100244577
259 Ga0070700_100704551
260 Ga0070694_100220793
261 Ga0070708_100001289
262 Ga0070678_100092891
263 Ga0070662_100030124
264 Ga0068867_100411707
265 Ga0070706_100013312
266 Ga0070706_100017462
267 Ga0070706_100076709
268 Ga0070707_100132860
269 Ga0070707_100189315
270 Ga0070707_102215259
271 Ga0070698_100068567
272 Ga0070698_100308233
273 Ga0070698_100618208
274 Ga0070699_100148919
275 Ga0070699_100251271
276 Ga0070699_100254605
277 Ga0070684_100232407
278 Ga0068853_101151917
279 Ga0070672_100118985
280 Ga0070686_100477888
281 Ga0070693_100229721
282 Ga0070665_100000132
283 Ga0070665_100075724
284 Ga0070665_100957809
285 Ga0070704_100155123
286 Ga0070664_100047103
287 Ga0068854_100058068
288 Ga0070702_101357107
289 Ga0068852_100144557
290 Ga0068859_100035785
291 Ga0068859_100678241
292 Ga0068859_102404947
293 Ga0068864_100002012
294 Ga0068861_100829679
295 Ga0068858_100033310
296 Ga0068860_100088856
297 Ga0068860_100331076
298 Ga0068862_101498518
299 Ga0081538_10063599
300 Ga0081539_10000413
301 Ga0070717_10502174
302 Ga0075365_10113481
303 Ga0075428_100009880
304 Ga0075428_100100782
305 Ga0075428_100672094
306 Ga0075430_100434048
307 Ga0075430_100989628
308 Ga0075431_100003588
309 Ga0075431_100019275
310 Ga0075431_100089044
311 Ga0075431_100348178
312 Ga0075431_100703461
313 Ga0075433_10001443
314 Ga0075433_10490486
315 Ga0075434_100072399
316 Ga0075434_100258889
317 Ga0075429_100517039
318 Ga0068865_100116117
319 Ga0075436_100447377
320 Ga0097620_100035784
321 Ga0097620_100678242
322 Ga0097620_102404901
323 Ga0105245_10602702
324 Ga0114129_10049520
325 Ga0114129_10646844
326 Ga0114129_12176798
327 Ga0105242_10042162
328 Ga0105248_10022024
329 Ga0105248_10116029
330 Ga0105238_10102491
331 Ga0105239_10543725
332 Ga0157374_10030955
333 Ga0157378_10009222
334 Ga0163162_10002597
335 Ga0157375_10042910
336 Ga0157375_10124486
337 Ga0163163_10039198
338 Ga0157380_10987930
339 Ga0157377_10048343
340 Ga0157376_10460840
341 Ga0209233_1012839
342 Ga0207645_10205566
343 Ga0207684_10000358
344 Ga0207684_10022956
345 Ga0207660_11251412
346 Ga0207662_11329789
347 Ga0207649_10229341
348 Ga0207646_10001844
349 Ga0207646_10011629
350 Ga0207681_10000009
351 Ga0207681_10010723
352 Ga0207694_10285769
353 Ga0207650_10028449
354 Ga0207650_10335568
355 Ga0207659_10082902
356 Ga0207644_10666053
357 Ga0207690_10366337
358 Ga0207690_10428849
359 Ga0207670_10452494
360 Ga0207669_10211048
361 Ga0207691_10023712
362 Ga0207711_10110506
363 Ga0207689_10683695
364 Ga0207661_10767615
365 Ga0207679_10030030
366 Ga0207679_10683463
367 Ga0207667_10595093
368 Ga0207640_10051380
369 Ga0207658_10048563
370 Ga0207658_10119293
371 Ga0207677_10173123
372 Ga0207703_10046359
373 Ga0207708_10504891
374 Ga0207641_10101060
375 Ga0207641_10200136
376 Ga0207648_10469689
377 Ga0207648_10874686
378 Ga0207676_10042034
379 Ga0207676_10288281
380 Ga0207683_10405077
381 Ga0207698_10125917
382 Ga0268266_10007583
383 Ga0268265_10279080
384 Ga0268264_10024379
385 Ga0268264_10246950
386 Ga0307405_10637791
387 Ga0307405_11252828
388 Ga0307413_10003345
389 Ga0307410_11065421
390 Ga0307407_10038515
391 Ga0307416_100045428
392 Ga0307414_10290112
393 Ga0307414_10323308
394 Ga0307414_10611124
395 Ga0307411_10759576
396 Ga0307415_100016347
397 Ga0307415_100479794
398 Ga0373937_0275700
399 Ga0395905_0209766
400 Ga0439435_0205493
401 Ga0466968_0165798
402 Ga0466960_0007298
403 Ga0466967_0157127
404 Ga0495615_0107229
405 Ga0496112_0227583
406 Ga0496112_1013284
407 Ga0501298_084096
408 Ga0501042_0584576
409 Ga0501072_1274455
410 Ga0501075_0161586
411 Ga0501207_097009
412 Ga0501223_037962
413 Ga0501225_0051731
414 Ga0501079_0750442
415 Ga0501079_0875148
416 Ga0501081_0646727
417 Ga0501083_0022083
418 Ga0501045_0224878
419 nmdc:mga0yw44_67108_c1
420 nmdc:mga07m45_498115_c1
421 nmdc:mga05p37_20397_c1
422 nmdc:mga09592_259068_c1
423 nmdc:mga0qj67_414092_c1
424 nmdc:mga06r32_126897_c1
425 nmdc:mga06r32_19323_c1
426 nmdc:mga06r32_23043_c1
427 nmdc:mga06r32_432685_c1
428 nmdc:mga0n895_12916_c1
429 nmdc:mga0n895_249023_c1
430 nmdc:mga0rr50_105987_c1
431 nmdc:mga08x19_226490_c1
432 nmdc:mga08x19_393095_c1
433 nmdc:mga0a205_476473_c1
434 nmdc:mga0a205_95070_c1
435 Ga0495655_0049162
436 Ga0501084_0177130
437 Ga0587085_120844
438 Ga0530510_0333678
439 2509371491
440 2869239689
441 2869253359
442 2869271159
443 2869279698
444 2871460219
445 2874112224
446 2874136706
447 2874141533
448 2878735448
449 2903519981
450 2906366641
451 2906376222
452 2906393943
453 2937874581
454 2958097300
455 2958150554
456 2965046641
457 2965096052
458 2968017205
459 2970470500
460 2970493470
461 2970515584
462 2977917107
463 2977957639
464 2996354861
465 3004200180
466 3004234635
467 3004281509
468 8004367056
469 8004644294
470 8004703038

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.98

Map