F347693

General Info

Members Datasets Scaffolds Average Seq Length
235 116 470 82

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10018137|JGI25407J50210_100181371
Length 91
Sequence VSVEPGEKHGXFIDVEVSDAARSDAELSKKLEEACPVDIFAAGDGGVEIVRANLDECVLCELCLDAAPPGAVRVVKLYDGGAALERMSAPT

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
3 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
60 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
61 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
62 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
67 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
68 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
69 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
94 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
95 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 0
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10018137 3300003373 Bacteria 1830
2 JGI25407J50210_10029054 3300003373 Bacteria 1433
3 JGI25407J50210_10031417 3300003373 Bacteria 1374
4 JGI25407J50210_10043224 3300003373 Bacteria 1152
5 JGI25407J50210_10079152 3300003373 Bacteria 817
6 JGI25407J50210_10086448 3300003373 Bacteria 777
7 Ga0070659_100857359 3300005366 Bacteria 792
8 Ga0070705_100739190 3300005440 Bacteria 777
9 Ga0070700_101191203 3300005441 Bacteria 636
10 Ga0070700_101761680 3300005441 Bacteria 533
11 Ga0070706_100874025 3300005467 Bacteria 831
12 Ga0070707_100712090 3300005468 Bacteria 967
13 Ga0070698_100095003 3300005471 Bacteria 2959
14 Ga0070698_101719936 3300005471 Bacteria 580
15 Ga0070686_100465376 3300005544 Bacteria 975
16 Ga0070695_100988834 3300005545 Bacteria 684
17 Ga0070696_100016334 3300005546 Bacteria 4996
18 Ga0070696_100843106 3300005546 Bacteria 757
19 Ga0070696_101454102 3300005546 Bacteria 586
20 Ga0070704_100342234 3300005549 Bacteria 1260
21 Ga0070704_101219063 3300005549 Bacteria 687
22 Ga0070702_100690495 3300005615 Bacteria 777
23 Ga0068861_100555970 3300005719 Bacteria 1046
24 Ga0068870_10805120 3300005840 Bacteria 657
25 Ga0068858_101655959 3300005842 Bacteria 632
26 Ga0068862_100265709 3300005844 Bacteria 1567
27 Ga0068862_101005923 3300005844 Bacteria 825
28 Ga0081455_10034175 3300005937 Bacteria 4558
29 Ga0081455_10051450 3300005937 Bacteria 3533
30 Ga0081538_10000064 3300005981 Bacteria 99059
31 Ga0081538_10000221 3300005981 Bacteria 64192
32 Ga0081538_10000351 3300005981 Bacteria 52575
33 Ga0081538_10001118 3300005981 Bacteria 28443
34 Ga0081538_10002741 3300005981 Bacteria 16911
35 Ga0081538_10007705 3300005981 Bacteria 9277
36 Ga0081538_10008194 3300005981 Bacteria 8918
37 Ga0081538_10012687 3300005981 Bacteria 6736
38 Ga0081538_10012909 3300005981 Bacteria 6660
39 Ga0081538_10038673 3300005981 Bacteria 3073
40 Ga0081538_10060344 3300005981 Bacteria 2182
41 Ga0081538_10072764 3300005981 Bacteria 1882
42 Ga0081538_10159127 3300005981 Bacteria 1007
43 Ga0081538_10160369 3300005981 Bacteria 1001
44 Ga0081538_10271492 3300005981 Bacteria 634
45 Ga0081539_10072648 3300005985 Bacteria 1838
46 Ga0075368_10214460 3300006042 Bacteria 817
47 Ga0075428_100007521 3300006844 Bacteria 12074
48 Ga0075428_100018528 3300006844 Bacteria 7698
49 Ga0075428_100509506 3300006844 Bacteria 1287
50 Ga0075428_101573794 3300006844 Bacteria 688
51 Ga0075428_102637696 3300006844 Bacteria 513
52 Ga0075430_100000085 3300006846 Bacteria 52821
53 Ga0075430_100203429 3300006846 Bacteria 1644
54 Ga0075430_101542798 3300006846 Bacteria 546
55 Ga0075431_100005357 3300006847 Bacteria 12661
56 Ga0075431_100271676 3300006847 Bacteria 1718
57 Ga0075431_100470519 3300006847 Bacteria 1250
58 Ga0075431_100664432 3300006847 Bacteria 1022
59 Ga0075431_100995014 3300006847 Bacteria 806
60 Ga0075433_11220092 3300006852 Bacteria 652
61 Ga0075429_100076721 3300006880 Bacteria 2911
62 Ga0075429_100086183 3300006880 Bacteria 2738
63 Ga0075429_100651555 3300006880 Bacteria 923
64 Ga0075429_100941149 3300006880 Bacteria 756
65 Ga0075429_101372855 3300006880 Bacteria 616
66 Ga0068865_101977360 3300006881 Bacteria 529
67 Ga0111539_10012887 3300009094 Bacteria 10462
68 Ga0111539_10143900 3300009094 Bacteria 2791
69 Ga0111539_10710098 3300009094 Bacteria 1170
70 Ga0111539_11463900 3300009094 Bacteria 792
71 Ga0111539_11857850 3300009094 Bacteria 698
72 Ga0114129_10028901 3300009147 Bacteria 7854
73 Ga0114129_10033936 3300009147 Bacteria 7208
74 Ga0114129_10482849 3300009147 Bacteria 1621
75 Ga0114129_10573420 3300009147 Bacteria 1465
76 Ga0114129_10592209 3300009147 Bacteria 1438
77 Ga0114129_11369420 3300009147 Bacteria 874
78 Ga0114129_11612469 3300009147 Bacteria 794
79 Ga0105243_10208350 3300009148 Bacteria 1720
80 Ga0105249_12040173 3300009553 Bacteria 646
81 Ga0105246_10684707 3300011119 Bacteria 897
82 Ga0105246_11026122 3300011119 Bacteria 748
83 Ga0157372_13311014 3300013307 Unclassified 513
84 Ga0157380_12260343 3300014326 Bacteria 608
85 Ga0207662_10230895 3300025918 Bacteria 1209
86 Ga0207681_10269227 3300025923 Bacteria 1337
87 Ga0207690_10710621 3300025932 Bacteria 827
88 Ga0207670_11487477 3300025936 Bacteria 576
89 Ga0207669_10962413 3300025937 Bacteria 716
90 Ga0207708_11551452 3300026075 Bacteria 582
91 Ga0207708_11767007 3300026075 Unclassified 543
92 Ga0207675_102172570 3300026118 Bacteria 571
93 Ga0207428_10209384 3300027907 Archaea 1465
94 Ga0207428_10941673 3300027907 Bacteria 609
95 Ga0307408_100207282 3300031548 Bacteria 1591
96 Ga0307408_100380926 3300031548 Bacteria 1206
97 Ga0307408_100527675 3300031548 Bacteria 1038
98 Ga0307405_10941481 3300031731 Bacteria 733
99 Ga0307413_10096137 3300031824 Bacteria 1944
100 Ga0307413_10475900 3300031824 Bacteria 997
101 Ga0307413_11967834 3300031824 Unclassified 526
102 Ga0307410_10314087 3300031852 Bacteria 1241
103 Ga0307410_10375607 3300031852 Bacteria 1142
104 Ga0307410_10699610 3300031852 Bacteria 854
105 Ga0307406_10164282 3300031901 Bacteria 1600
106 Ga0307406_10345816 3300031901 Bacteria 1160
107 Ga0307406_11386407 3300031901 Bacteria 616
108 Ga0307407_11250997 3300031903 Bacteria 581
109 Ga0307409_100256029 3300031995 Bacteria 1603
110 Ga0307409_100283428 3300031995 Bacteria 1533
111 Ga0307409_100366517 3300031995 Bacteria 1365
112 Ga0307409_102564125 3300031995 Bacteria 538
113 Ga0307409_102832061 3300031995 Bacteria 512
114 Ga0307416_100016830 3300032002 Bacteria 5095
115 Ga0307416_100020406 3300032002 Bacteria 4727
116 Ga0307416_100110444 3300032002 Bacteria 2421
117 Ga0307416_103872433 3300032002 Bacteria 501
118 Ga0307411_10008462 3300032005 Bacteria 5335
119 Ga0307415_100007688 3300032126 Bacteria 5917
120 Ga0307415_100311367 3300032126 Bacteria 1309
121 Ga0307415_100359062 3300032126 Bacteria 1230
122 Ga0307415_101239056 3300032126 Bacteria 704
123 Ga0373953_0384804 3300035117 Bacteria 617
124 Ga0395899_0684464 3300037312 Bacteria 645
125 Ga0395900_0357880 3300037418 Bacteria 1432
126 Ga0395898_0380405 3300037466 Bacteria 1346
127 Ga0395898_0520184 3300037466 Bacteria 1131
128 Ga0395905_0518277 3300037471 Bacteria 1093
129 Ga0436364_1211745 3300037853 Bacteria 6771
130 Ga0395901_0369812 3300038443 Bacteria 1477
131 Ga0395901_1820391 3300038443 Bacteria 558
132 Ga0451833_0864101 3300041491 Bacteria 1250
133 Ga0439463_004573 3300042016 Bacteria 3466
134 Ga0439460_0020834 3300042461 Bacteria 1786
135 Ga0439440_0039365 3300042993 Bacteria 1147
136 Ga0466966_0072956 3300044684 Bacteria 2148
137 Ga0466959_0068447 3300045049 Bacteria 2573
138 Ga0466967_1477932 3300045976 Bacteria 677
139 Ga0495584_0170563 3300046491 Bacteria 1106
140 Ga0495637_0134547 3300046520 Bacteria 942
141 Ga0495644_0276268 3300046523 Bacteria 655
142 Ga0495609_0243572 3300046538 Bacteria 742
143 Ga0495668_0088317 3300046616 Bacteria 1700
144 Ga0495589_0535536 3300046794 Bacteria 534
145 Ga0495676_0666928 3300047321 Bacteria 674
146 Ga0501031_0108013 3300049568 Bacteria 1817
147 Ga0501031_0212669 3300049568 Bacteria 1260
148 Ga0501031_0968733 3300049568 Bacteria 544
149 Ga0501032_0032233 3300049569 Bacteria 3590
150 Ga0501033_0047637 3300049570 Bacteria 3186
151 Ga0501036_0153706 3300049572 Bacteria 1941
152 Ga0501036_0215609 3300049572 Bacteria 1612
153 Ga0501038_0044790 3300049574 Bacteria 3842
154 Ga0501038_0886190 3300049574 Bacteria 659
155 Ga0501038_1196134 3300049574 Bacteria 552
156 Ga0501039_0074493 3300049575 Bacteria 2638
157 Ga0501039_0271066 3300049575 Bacteria 1334
158 Ga0501041_0549115 3300049577 Bacteria 736
159 Ga0501042_0303333 3300049578 Bacteria 1154
160 Ga0501042_0534717 3300049578 Bacteria 852
161 Ga0501042_0908116 3300049578 Bacteria 641
162 Ga0501043_0111335 3300049579 Bacteria 2149
163 Ga0501046_0054179 3300049580 Bacteria 3156
164 Ga0501047_0427437 3300049581 Bacteria 1155
165 Ga0501048_1234758 3300049582 Bacteria 537
166 Ga0501067_0016463 3300049583 Bacteria 4084
167 Ga0501067_0085170 3300049583 Bacteria 1754
168 Ga0501069_0097280 3300049585 Bacteria 1668
169 Ga0501069_0669877 3300049585 Bacteria 625
170 Ga0501070_0176358 3300049586 Bacteria 1759
171 Ga0501071_0133284 3300049587 Bacteria 1847
172 Ga0501071_0184833 3300049587 Bacteria 1562
173 Ga0501071_0826100 3300049587 Bacteria 715
174 Ga0501072_0490916 3300049588 Bacteria 971
175 Ga0501072_1369270 3300049588 Unclassified 548
176 Ga0501072_1429441 3300049588 Bacteria 535
177 Ga0501073_0039800 3300049589 Bacteria 3329
178 Ga0501074_0030867 3300049590 Bacteria 3882
179 Ga0501075_0091629 3300049591 Bacteria 2307
180 Ga0501076_0346371 3300049592 Bacteria 1220
181 Ga0501076_0701633 3300049592 Bacteria 835
182 Ga0501076_0725733 3300049592 Bacteria 820
183 Ga0501077_0723097 3300049593 Bacteria 640
184 Ga0501209_213258 3300049656 Bacteria 597
185 Ga0501079_0152865 3300049741 Bacteria 1799
186 Ga0501079_0395992 3300049741 Bacteria 1083
187 Ga0501080_0023327 3300049742 Bacteria 5737
188 Ga0501080_0498378 3300049742 Bacteria 1089
189 Ga0501081_0382869 3300049743 Bacteria 1040
190 Ga0501083_0026556 3300049744 Bacteria 4001
191 Ga0501035_0056020 3300049822 Bacteria 3519
192 Ga0501044_0032612 3300049823 Bacteria 5474
193 Ga0501045_0252375 3300049824 Bacteria 1313
194 nmdc:mga03n38_229419_c1 3300050490 Bacteria 973
195 nmdc:mga00v17_207610_c1 3300050491 Bacteria 1267
196 nmdc:mga00v17_966140_c1 3300050491 Bacteria 537
197 nmdc:mga0yw44_135789_c1 3300050492 Bacteria 1596
198 nmdc:mga04h51_29612_c1 3300050495 Bacteria 1716
199 nmdc:mga05p37_10033_c1 3300050507 Bacteria 11239
200 nmdc:mga05p37_1217025_c1 3300050507 Bacteria 776
201 nmdc:mga05p37_15655_c1 3300050507 Bacteria 9115
202 nmdc:mga05p37_356146_c1 3300050507 Bacteria 1722
203 nmdc:mga05p37_379889_c1 3300050507 Bacteria 1656
204 nmdc:mga05p37_444578_c1 3300050507 Bacteria 1502
205 nmdc:mga05p37_539549_c1 3300050507 Bacteria 1330
206 nmdc:mga09592_36080_c1 3300050508 Bacteria 4141
207 nmdc:mga09592_651002_c1 3300050508 Bacteria 899
208 nmdc:mga09592_82477_c1 3300050508 Bacteria 2740
209 nmdc:mga0qj67_10344_c1 3300050509 Bacteria 6970
210 nmdc:mga0qj67_219749_c1 3300050509 Bacteria 1542
211 nmdc:mga0qj67_292778_c1 3300050509 Bacteria 1319
212 nmdc:mga0qj67_350927_c1 3300050509 Bacteria 1193
213 nmdc:mga06r32_1012866_c1 3300050510 Bacteria 783
214 nmdc:mga06r32_375936_c1 3300050510 Bacteria 1404
215 nmdc:mga06r32_52160_c1 3300050510 Bacteria 3917
216 nmdc:mga08y16_1099676_c1 3300050511 Bacteria 770
217 nmdc:mga08y16_158329_c1 3300050511 Bacteria 2353
218 nmdc:mga08y16_4296_c1 3300050511 Bacteria 14877
219 nmdc:mga08y16_735174_c1 3300050511 Bacteria 984
220 nmdc:mga0rr50_1275065_c1 3300050513 Bacteria 623
221 Ga0495655_0215877 3300053083 Bacteria 633
222 Ga0501084_0148375 3300054114 Bacteria 1976
223 Ga0501084_0239649 3300054114 Bacteria 1531
224 Ga0501084_0400586 3300054114 Bacteria 1160
225 Ga0501082_0022116 3300060353 Bacteria 5481
226 Ga0501082_0260358 3300060353 Bacteria 1509
227 Ga0501082_0288884 3300060353 Bacteria 1428
228 Ga0501082_1011612 3300060353 Bacteria 727
229 Ga0501082_1757076 3300060353 Bacteria 541
230 Ga0501082_1784409 3300060353 Unclassified 537
231 Ga0530510_0241681 3300061734 Bacteria 1344
232 Ga0530510_0260458 3300061734 Bacteria 1293
233 Ga0530510_0610298 3300061734 Bacteria 830
234 Ga0530510_0737410 3300061734 Bacteria 751
235 Ga0530510_1295956 3300061734 Bacteria 559
236 JGI25407J50210_10018137
237 JGI25407J50210_10029054
238 JGI25407J50210_10031417
239 JGI25407J50210_10043224
240 JGI25407J50210_10079152
241 JGI25407J50210_10086448
242 Ga0070659_100857359
243 Ga0070705_100739190
244 Ga0070700_101191203
245 Ga0070700_101761680
246 Ga0070706_100874025
247 Ga0070707_100712090
248 Ga0070698_100095003
249 Ga0070698_101719936
250 Ga0070686_100465376
251 Ga0070695_100988834
252 Ga0070696_100016334
253 Ga0070696_100843106
254 Ga0070696_101454102
255 Ga0070704_100342234
256 Ga0070704_101219063
257 Ga0070702_100690495
258 Ga0068861_100555970
259 Ga0068870_10805120
260 Ga0068858_101655959
261 Ga0068862_100265709
262 Ga0068862_101005923
263 Ga0081455_10034175
264 Ga0081455_10051450
265 Ga0081538_10000064
266 Ga0081538_10000221
267 Ga0081538_10000351
268 Ga0081538_10001118
269 Ga0081538_10002741
270 Ga0081538_10007705
271 Ga0081538_10008194
272 Ga0081538_10012687
273 Ga0081538_10012909
274 Ga0081538_10038673
275 Ga0081538_10060344
276 Ga0081538_10072764
277 Ga0081538_10159127
278 Ga0081538_10160369
279 Ga0081538_10271492
280 Ga0081539_10072648
281 Ga0075368_10214460
282 Ga0075428_100007521
283 Ga0075428_100018528
284 Ga0075428_100509506
285 Ga0075428_101573794
286 Ga0075428_102637696
287 Ga0075430_100000085
288 Ga0075430_100203429
289 Ga0075430_101542798
290 Ga0075431_100005357
291 Ga0075431_100271676
292 Ga0075431_100470519
293 Ga0075431_100664432
294 Ga0075431_100995014
295 Ga0075433_11220092
296 Ga0075429_100076721
297 Ga0075429_100086183
298 Ga0075429_100651555
299 Ga0075429_100941149
300 Ga0075429_101372855
301 Ga0068865_101977360
302 Ga0111539_10012887
303 Ga0111539_10143900
304 Ga0111539_10710098
305 Ga0111539_11463900
306 Ga0111539_11857850
307 Ga0114129_10028901
308 Ga0114129_10033936
309 Ga0114129_10482849
310 Ga0114129_10573420
311 Ga0114129_10592209
312 Ga0114129_11369420
313 Ga0114129_11612469
314 Ga0105243_10208350
315 Ga0105249_12040173
316 Ga0105246_10684707
317 Ga0105246_11026122
318 Ga0157372_13311014
319 Ga0157380_12260343
320 Ga0207662_10230895
321 Ga0207681_10269227
322 Ga0207690_10710621
323 Ga0207670_11487477
324 Ga0207669_10962413
325 Ga0207708_11551452
326 Ga0207708_11767007
327 Ga0207675_102172570
328 Ga0207428_10209384
329 Ga0207428_10941673
330 Ga0307408_100207282
331 Ga0307408_100380926
332 Ga0307408_100527675
333 Ga0307405_10941481
334 Ga0307413_10096137
335 Ga0307413_10475900
336 Ga0307413_11967834
337 Ga0307410_10314087
338 Ga0307410_10375607
339 Ga0307410_10699610
340 Ga0307406_10164282
341 Ga0307406_10345816
342 Ga0307406_11386407
343 Ga0307407_11250997
344 Ga0307409_100256029
345 Ga0307409_100283428
346 Ga0307409_100366517
347 Ga0307409_102564125
348 Ga0307409_102832061
349 Ga0307416_100016830
350 Ga0307416_100020406
351 Ga0307416_100110444
352 Ga0307416_103872433
353 Ga0307411_10008462
354 Ga0307415_100007688
355 Ga0307415_100311367
356 Ga0307415_100359062
357 Ga0307415_101239056
358 Ga0373953_0384804
359 Ga0395899_0684464
360 Ga0395900_0357880
361 Ga0395898_0380405
362 Ga0395898_0520184
363 Ga0395905_0518277
364 Ga0436364_1211745
365 Ga0395901_0369812
366 Ga0395901_1820391
367 Ga0451833_0864101
368 Ga0439463_004573
369 Ga0439460_0020834
370 Ga0439440_0039365
371 Ga0466966_0072956
372 Ga0466959_0068447
373 Ga0466967_1477932
374 Ga0495584_0170563
375 Ga0495637_0134547
376 Ga0495644_0276268
377 Ga0495609_0243572
378 Ga0495668_0088317
379 Ga0495589_0535536
380 Ga0495676_0666928
381 Ga0501031_0108013
382 Ga0501031_0212669
383 Ga0501031_0968733
384 Ga0501032_0032233
385 Ga0501033_0047637
386 Ga0501036_0153706
387 Ga0501036_0215609
388 Ga0501038_0044790
389 Ga0501038_0886190
390 Ga0501038_1196134
391 Ga0501039_0074493
392 Ga0501039_0271066
393 Ga0501041_0549115
394 Ga0501042_0303333
395 Ga0501042_0534717
396 Ga0501042_0908116
397 Ga0501043_0111335
398 Ga0501046_0054179
399 Ga0501047_0427437
400 Ga0501048_1234758
401 Ga0501067_0016463
402 Ga0501067_0085170
403 Ga0501069_0097280
404 Ga0501069_0669877
405 Ga0501070_0176358
406 Ga0501071_0133284
407 Ga0501071_0184833
408 Ga0501071_0826100
409 Ga0501072_0490916
410 Ga0501072_1369270
411 Ga0501072_1429441
412 Ga0501073_0039800
413 Ga0501074_0030867
414 Ga0501075_0091629
415 Ga0501076_0346371
416 Ga0501076_0701633
417 Ga0501076_0725733
418 Ga0501077_0723097
419 Ga0501209_213258
420 Ga0501079_0152865
421 Ga0501079_0395992
422 Ga0501080_0023327
423 Ga0501080_0498378
424 Ga0501081_0382869
425 Ga0501083_0026556
426 Ga0501035_0056020
427 Ga0501044_0032612
428 Ga0501045_0252375
429 nmdc:mga03n38_229419_c1
430 nmdc:mga00v17_207610_c1
431 nmdc:mga00v17_966140_c1
432 nmdc:mga0yw44_135789_c1
433 nmdc:mga04h51_29612_c1
434 nmdc:mga05p37_10033_c1
435 nmdc:mga05p37_1217025_c1
436 nmdc:mga05p37_15655_c1
437 nmdc:mga05p37_356146_c1
438 nmdc:mga05p37_379889_c1
439 nmdc:mga05p37_444578_c1
440 nmdc:mga05p37_539549_c1
441 nmdc:mga09592_36080_c1
442 nmdc:mga09592_651002_c1
443 nmdc:mga09592_82477_c1
444 nmdc:mga0qj67_10344_c1
445 nmdc:mga0qj67_219749_c1
446 nmdc:mga0qj67_292778_c1
447 nmdc:mga0qj67_350927_c1
448 nmdc:mga06r32_1012866_c1
449 nmdc:mga06r32_375936_c1
450 nmdc:mga06r32_52160_c1
451 nmdc:mga08y16_1099676_c1
452 nmdc:mga08y16_158329_c1
453 nmdc:mga08y16_4296_c1
454 nmdc:mga08y16_735174_c1
455 nmdc:mga0rr50_1275065_c1
456 Ga0495655_0215877
457 Ga0501084_0148375
458 Ga0501084_0239649
459 Ga0501084_0400586
460 Ga0501082_0022116
461 Ga0501082_0260358
462 Ga0501082_0288884
463 Ga0501082_1011612
464 Ga0501082_1757076
465 Ga0501082_1784409
466 Ga0530510_0241681
467 Ga0530510_0260458
468 Ga0530510_0610298
469 Ga0530510_0737410
470 Ga0530510_1295956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ok0-assembly1.cif.gz_D cryo-em structure of the sulfolobus acidocaldarius rna polymerase at 2.88 a 0.821 11 75
2y0s-assembly2.cif.gz_D crystal structure of sulfolobus shibatae rna polymerase in p21 space group 0.7979 11 75
8hil-assembly1.cif.gz_C a cryo-em structure of b. oleracea rna polymerase v at 3.57 angstrom 0.79 11 75
8him-assembly1.cif.gz_C a cryo-em structure of b. oleracea rna polymerase v elongation complex at 2.73 angstrom 0.7844 10 75
7oqy-assembly1.cif.gz_D cryo-em structure of the cellular negative regulator tfs4 bound to the archaeal rna polymerase 0.7766 11 75
ID Description Score Start End Superfamily
2y0sD03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8143 11 73 3.30.70.20
af_Q46905_5_80_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7943 14 71 3.30.70.20
2y0sD03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7536 11 73 3.30.70.20
af_Q8IHT3_226_284_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7357 15 67 3.30.70.20
af_Q9W351_230_466_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6866 71 89 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A538L495-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9818 11 84
AF-A0A7V9GQV1-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9767 11 85
AF-A0A838PPT9-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9734 11 78
AF-A0A5B8U4T3-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9729 11 82
AF-A0A6I2Y8B8-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9716 10 85

Map