F347616

General Info

Members Datasets Scaffolds Average Seq Length
234 169 200 262

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2831935698|2831935729
Length 303
Sequence AVVIELKTDEEIDRMAVTGRFVGELLAELSGVAEVGVNLMDLEHHARRRIAERGAESCYWDYAPSFGRGPFRNMLCLSVNDAVLHGLPHDYVLRDGDLLSIDMAVGIDGWVADSALSVVVGDPDPADLTLIEATEAALEAAISAAQPGGRLGDVSAAIGEVAQSYGYRVNAEFGGHGIGRTMHEAPHVPNSGRPRRGLRLDPGLTIAIEPWLCHSTDKIRYDEDGWTIRSADGSRTAHSEHTVAVTASGPRVLTRRPTDGAAPADLSRKPTGPVGAGADRDTSRPRGEGVRHRGRAPRRWSPG

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
7 2558860280 Kutzneria sp. 744 Isolate Unclassified
8 2643221692 Nocardia sp. Root136 Isolate Unclassified
9 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
10 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
11 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
12 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
13 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
14 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
15 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
16 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
17 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
18 2855683550 Micromonospora sp. RP3T Isolate Unclassified
19 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
20 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
21 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
22 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
23 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
24 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
25 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
26 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
27 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
28 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
72 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
73 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
74 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
87 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
88 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
96 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
97 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
156 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
157 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
158 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
164 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
165 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
166 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
167 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
168 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
169 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.47
Metatranscriptomes 0
Isolates 14.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.27
Nodule 0.85
Rhizoplane 12.82
Rhizosphere 56.41
Stem 0
Stem Tuber 0
Unclassified 25.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001638 3300003203 Bacteria 10572
2 rootH1_10060422 3300003316 Bacteria 2743
3 JGI25407J50210_10015837 3300003373 Bacteria 1950
4 Ga0070683_100002546 3300005329 Bacteria 14556
5 Ga0070668_100000179 3300005347 Bacteria 40901
6 Ga0070668_100262727 3300005347 Bacteria 1436
7 Ga0070674_100513523 3300005356 Bacteria 1000
8 Ga0070714_100056280 3300005435 Bacteria 3364
9 Ga0070714_100068500 3300005435 Bacteria 3062
10 Ga0070713_100493330 3300005436 Bacteria 1155
11 Ga0070710_10000182 3300005437 Bacteria 29036
12 Ga0070684_100005923 3300005535 Bacteria 9412
13 Ga0070684_100430573 3300005535 Bacteria 1218
14 Ga0068853_100079043 3300005539 Bacteria 2876
15 Ga0068854_100396906 3300005578 Bacteria 1140
16 Ga0068852_100122960 3300005616 Bacteria 2379
17 Ga0068859_100572499 3300005617 Bacteria 1223
18 Ga0068863_100001803 3300005841 Bacteria 21258
19 Ga0068862_100089393 3300005844 Bacteria 2681
20 Ga0081538_10005172 3300005981 Bacteria 11814
21 Ga0081540_1026862 3300005983 Bacteria 3275
22 Ga0081539_10000109 3300005985 Bacteria 193696
23 Ga0081539_10003774 3300005985 Bacteria 17924
24 Ga0081539_10041055 3300005985 Bacteria 2709
25 Ga0081539_10100394 3300005985 Bacteria 1476
26 Ga0075364_10137529 3300006051 Bacteria 1642
27 Ga0070715_10126420 3300006163 Bacteria 1225
28 Ga0075370_10050104 3300006353 Bacteria 2368
29 Ga0097620_100572548 3300006931 Bacteria 1223
30 Ga0105245_10375602 3300009098 Bacteria 1414
31 Ga0105245_10399044 3300009098 Bacteria 1374
32 Ga0105242_10598241 3300009176 Bacteria 1065
33 Ga0105238_10108194 3300009551 Bacteria 2761
34 Ga0105249_10326199 3300009553 Bacteria 1548
35 Ga0157377_10418007 3300014745 Bacteria 917
36 Ga0157379_10012223 3300014968 Bacteria 7498
37 Ga0157379_10686525 3300014968 Bacteria 960
38 Ga0213875_10000892 3300021388 Bacteria 21840
39 Ga0207692_10006927 3300025898 Bacteria 4620
40 Ga0207694_10183160 3300025924 Bacteria 1699
41 Ga0207700_10064132 3300025928 Bacteria 2797
42 Ga0207664_10020471 3300025929 Bacteria 4904
43 Ga0207686_10045281 3300025934 Bacteria 2706
44 Ga0207661_10009319 3300025944 Bacteria 7037
45 Ga0207679_10004486 3300025945 Bacteria 8698
46 Ga0207639_10073234 3300026041 Bacteria 2685
47 Ga0207678_10128474 3300026067 Bacteria 2162
48 Ga0207641_10001492 3300026088 Bacteria 22909
49 Ga0268265_10109919 3300028380 Bacteria 2248
50 Ga0307515_10000319 3300028794 Bacteria 118880
51 Ga0307515_10075407 3300028794 Bacteria 4494
52 Ga0307515_10188522 3300028794 Bacteria 1982
53 Ga0307511_10001458 3300030521 Bacteria 24986
54 Ga0307512_10009744 3300030522 Bacteria 9228
55 Ga0307512_10013595 3300030522 Bacteria 7624
56 Ga0316177_1117602 3300030731 Bacteria 1663
57 Ga0316176_1016345 3300030732 Bacteria 1339
58 Ga0316180_1151159 3300030736 Bacteria 1039
59 Ga0307513_10037253 3300031456 Bacteria 5415
60 Ga0307408_100090762 3300031548 Bacteria 2306
61 Ga0307508_10016962 3300031616 Bacteria 6626
62 Ga0307516_10107333 3300031730 Bacteria 2601
63 Ga0307413_10097350 3300031824 Bacteria 1934
64 Ga0307410_10098505 3300031852 Bacteria 2091
65 Ga0307409_100009893 3300031995 Bacteria 5887
66 Ga0307409_100046508 3300031995 Bacteria 3285
67 Ga0307409_100230618 3300031995 Bacteria 1678
68 Ga0307416_100074713 3300032002 Bacteria 2833
69 Ga0307416_100109564 3300032002 Bacteria 2429
70 Ga0307415_100038396 3300032126 Bacteria 3155
71 Ga0307507_10033707 3300033179 Bacteria 5310
72 Ga0307510_10219210 3300033180 Bacteria 1416
73 Ga0316214_1014067 3300033545 Bacteria 1099
74 Ga0373942_0026651 3300035207 Bacteria 1497
75 Ga0373962_0006637 3300035242 Bacteria 2806
76 Ga0373935_0006817 3300035692 Bacteria 6824
77 Ga0373925_0033834 3300037068 Bacteria 3766
78 Ga0436364_0390119 3300037853 Bacteria 23235
79 Ga0451791_1067214 3300041451 Bacteria 934
80 Ga0451797_0426434 3300041453 Bacteria 1286
81 Ga0451853_0710131 3300041512 Bacteria 4353
82 Ga0439463_036086 3300042016 Bacteria 1252
83 Ga0450902_023264 3300042137 Bacteria 1029
84 Ga0439459_0025201 3300042438 Bacteria 1173
85 Ga0466969_0010834 3300044656 Bacteria 4830
86 Ga0466972_0006564 3300044658 Bacteria 5846
87 Ga0466972_0009487 3300044658 Bacteria 4888
88 Ga0466972_0019047 3300044658 Bacteria 3432
89 Ga0466965_0001004 3300044683 Bacteria 10921
90 Ga0466965_0013958 3300044683 Bacteria 3797
91 Ga0466965_0022048 3300044683 Bacteria 3069
92 Ga0466965_0026166 3300044683 Bacteria 2828
93 Ga0466961_0146755 3300044693 Bacteria 1475
94 Ga0466968_0006736 3300044735 Bacteria 4342
95 Ga0466968_0135565 3300044735 Bacteria 1123
96 Ga0466970_0029097 3300044765 Bacteria 2906
97 Ga0466970_0111730 3300044765 Bacteria 1492
98 Ga0466957_0009531 3300044842 Bacteria 5544
99 Ga0466957_0054008 3300044842 Bacteria 2451
100 Ga0466957_0054821 3300044842 Bacteria 2435
101 Ga0466960_0000778 3300044901 Bacteria 11176
102 Ga0466960_0002863 3300044901 Bacteria 6540
103 Ga0466960_0009740 3300044901 Bacteria 3973
104 Ga0466959_0005845 3300045049 Bacteria 8469
105 Ga0466958_0086666 3300045836 Bacteria 1933
106 Ga0466967_0080515 3300045976 Bacteria 2939
107 Ga0466967_0330629 3300045976 Bacteria 1472
108 Ga0466967_0671626 3300045976 Bacteria 1025
109 Ga0495594_0041560 3300046499 Bacteria 2518
110 Ga0495594_0130050 3300046499 Bacteria 1426
111 Ga0495621_0176395 3300046539 Bacteria 851
112 Ga0496100_0000096 3300048903 Bacteria 50329
113 Ga0496100_0003663 3300048903 Bacteria 8040
114 Ga0496101_0000017 3300048904 Bacteria 239153
115 Ga0496101_0079998 3300048904 Bacteria 2413
116 Ga0496102_0000020 3300048905 Bacteria 260823
117 Ga0496102_0008196 3300048905 Bacteria 8940
118 Ga0496103_0000011 3300048906 Bacteria 304506
119 Ga0496103_0000229 3300048906 Bacteria 54604
120 Ga0496104_0663653 3300048907 Bacteria 951
121 Ga0496105_0084749 3300048908 Bacteria 2618
122 Ga0496106_0000604 3300048909 Bacteria 25646
123 Ga0496106_0590425 3300048909 Bacteria 890
124 Ga0496107_0004335 3300048910 Bacteria 9603
125 Ga0496107_0036856 3300048910 Bacteria 3509
126 Ga0496108_0000287 3300048911 Bacteria 43379
127 Ga0496108_0006116 3300048911 Bacteria 9740
128 Ga0496109_0002649 3300048912 Bacteria 15012
129 Ga0496109_0433520 3300048912 Bacteria 1242
130 Ga0496109_0513681 3300048912 Bacteria 1131
131 Ga0496110_0085319 3300048913 Bacteria 2818
132 Ga0496111_0043045 3300048914 Bacteria 3244
133 Ga0496111_0555223 3300048914 Bacteria 843
134 Ga0496113_0080452 3300048916 Bacteria 2496
135 Ga0496113_0137111 3300048916 Bacteria 1923
136 Ga0496114_0000736 3300048917 Bacteria 24418
137 Ga0496114_0165863 3300048917 Bacteria 1923
138 Ga0496115_0054346 3300048918 Bacteria 3216
139 Ga0496115_0057947 3300048918 Bacteria 3117
140 Ga0496116_0000067 3300048919 Bacteria 260793
141 Ga0496116_0013743 3300048919 Bacteria 6507
142 Ga0496117_0000170 3300048920 Bacteria 136272
143 Ga0496117_0029253 3300048920 Bacteria 4250
144 Ga0496118_0000076 3300048921 Bacteria 193263
145 Ga0496118_0030125 3300048921 Bacteria 4536
146 Ga0496119_0000237 3300048922 Bacteria 77727
147 Ga0496119_0013820 3300048922 Bacteria 6384
148 Ga0496119_0147001 3300048922 Bacteria 1267
149 Ga0496120_0004465 3300048923 Bacteria 11727
150 Ga0496120_0031836 3300048923 Bacteria 3188
151 Ga0496121_0000014 3300048924 Bacteria 609379
152 Ga0496121_0015689 3300048924 Bacteria 7903
153 Ga0496122_0000084 3300048925 Bacteria 208740
154 Ga0496122_0009281 3300048925 Bacteria 10402
155 Ga0496123_0007339 3300048926 Bacteria 10439
156 Ga0496123_0033363 3300048926 Bacteria 3706
157 Ga0496124_0000019 3300048927 Bacteria 436995
158 Ga0496124_0004177 3300048927 Bacteria 17019
159 Ga0496125_0000014 3300048928 Bacteria 610124
160 Ga0496125_0048446 3300048928 Bacteria 3543
161 Ga0496126_0000017 3300048929 Bacteria 610676
162 Ga0496126_0000080 3300048929 Bacteria 221672
163 Ga0496126_0024546 3300048929 Bacteria 5818
164 Ga0496126_0073918 3300048929 Bacteria 3029
165 Ga0501031_0020043 3300049568 Bacteria 4360
166 Ga0501032_0068135 3300049569 Bacteria 2376
167 Ga0501033_0068575 3300049570 Bacteria 2607
168 Ga0501034_0030381 3300049571 Bacteria 5492
169 Ga0501034_0450223 3300049571 Bacteria 1205
170 Ga0501037_0050931 3300049573 Bacteria 3029
171 Ga0501037_0072058 3300049573 Bacteria 2513
172 Ga0501038_0032621 3300049574 Bacteria 4594
173 Ga0501039_0105530 3300049575 Bacteria 2200
174 Ga0501041_0146914 3300049577 Bacteria 1471
175 Ga0501042_0014215 3300049578 Bacteria 5431
176 Ga0501042_0077025 3300049578 Bacteria 2387
177 Ga0501043_0029948 3300049579 Bacteria 4276
178 Ga0501043_0512259 3300049579 Bacteria 895
179 Ga0501046_0065450 3300049580 Bacteria 2835
180 Ga0501046_0084777 3300049580 Bacteria 2443
181 Ga0501047_0009344 3300049581 Bacteria 9257
182 Ga0501047_0064224 3300049581 Bacteria 3541
183 Ga0501048_0018428 3300049582 Bacteria 5134
184 Ga0501048_0313789 3300049582 Bacteria 1117
185 Ga0501068_0073331 3300049584 Bacteria 2091
186 Ga0501076_0136081 3300049592 Bacteria 1994
187 Ga0501035_0045936 3300049822 Bacteria 3928
188 Ga0501035_0071336 3300049822 Bacteria 3076
189 Ga0501035_0152585 3300049822 Bacteria 2004
190 Ga0501044_0032432 3300049823 Bacteria 5492
191 nmdc:mga07m45_195025_c1 3300050496 Bacteria 1178
192 Ga0500641_0065331 3300053096 Bacteria 1522
193 Ga0500569_002846 3300053109 Bacteria 3461
194 Ga0500594_0038789 3300053118 Bacteria 1292
195 Ga0500652_003606 3300053131 Bacteria 4702
196 Ga0500559_0000063 3300053136 Bacteria 87005
197 Ga0500559_0008079 3300053136 Bacteria 4629
198 Ga0500573_0040708 3300053140 Bacteria 2683
199 Ga0501084_0010187 3300054114 Bacteria 7772
200 Ga0466962_0042035 3300061719 Bacteria 2187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10000182 Ga0070710_100001827 239
2 3300025898 Ga0207692_10006927 Ga0207692_100069274 239
3 3300044658 Ga0466972_0009487 Ga0466972_0009487_498_1292 239
4 3300044683 Ga0466965_0022048 Ga0466965_0022048_2037_2831 239
5 3300044735 Ga0466968_0135565 Ga0466968_0135565_57_851 239
6 3300044901 Ga0466960_0009740 Ga0466960_0009740_2501_3295 239
7 3300025934 Ga0207686_10045281 Ga0207686_100452813 242
8 3300031824 Ga0307413_10097350 Ga0307413_100973503 242
9 3300042137 Ga0450902_023264 Ga0450902_023264_274_1008 242
10 3300049579 Ga0501043_0512259 Ga0501043_0512259_13_768 242
11 3300053096 Ga0500641_0065331 Ga0500641_0065331_739_1509 242
12 3300044683 Ga0466965_0026166 Ga0466965_0026166_65_892 244
13 3300048922 Ga0496119_0147001 Ga0496119_0147001_53_856 244
14 3300009553 Ga0105249_10326199 Ga0105249_103261992 247
15 iso_pu_bacteria 8003856774 8003861834 247
16 iso_pu_bacteria 2738541308 2738888102 248
17 3300009098 Ga0105245_10375602 Ga0105245_103756021 249
18 iso_pu_bacteria 2551306166 2552112405 249
19 iso_pu_bacteria 2690315906 2691513862 249
20 iso_pu_bacteria 2515154088 2515496380 250
21 iso_pu_bacteria 2515154129 2515718449 250
22 iso_pu_bacteria 2515154137 2515756461 250
23 iso_pu_bacteria 2515154202 2516086874 250
24 iso_pu_bacteria 2515154203 2516089313 250
25 iso_pu_bacteria 2558860280 2559422583 250
26 iso_pu_bacteria 2643221692 2644512123 250
27 iso_pu_bacteria 2643221715 2644638796 250
28 iso_pu_bacteria 2675903059 2676487165 250
29 iso_pu_bacteria 2751185792 2753328186 250
30 iso_pu_bacteria 2791354901 2791914503 250
31 iso_pu_bacteria 2816332139 2816505664 250
32 iso_pu_bacteria 2832004796 2832009311 250
33 iso_pu_bacteria 2855683550 2855688603 250
34 iso_pu_bacteria 2866065130 2866065357 250
35 iso_pu_bacteria 2866552031 2866554235 250
36 iso_pu_bacteria 2867302475 2867302861 250
37 iso_pu_bacteria 2867507094 2867512687 250
38 iso_pu_bacteria 2915358134 2915360490 250
39 iso_pu_bacteria 2929219909 2929225547 250
40 iso_pu_bacteria 2939657138 2939658719 250
41 iso_pu_bacteria 2996221748 2996222348 250
42 iso_pu_bacteria 3002998708 3003000329 250
43 iso_pu_bacteria 8001781756 8001786904 250
44 iso_pu_bacteria 8003830390 8003832699 250
45 iso_pu_bacteria 8054472261 8054479264 250
46 iso_pu_bacteria 8054913762 8054916913 250
47 iso_pu_bacteria 8055412473 8055416458 250
48 3300005435 Ga0070714_100068500 Ga0070714_1000685002 253
49 3300005535 Ga0070684_100430573 Ga0070684_1004305732 253
50 3300005617 Ga0068859_100572499 Ga0068859_1005724991 253
51 3300005985 Ga0081539_10041055 Ga0081539_100410554 253
52 3300006163 Ga0070715_10126420 Ga0070715_101264202 253
53 3300006931 Ga0097620_100572548 Ga0097620_1005725481 253
54 3300021388 Ga0213875_10000892 Ga0213875_1000089212 253
55 3300025928 Ga0207700_10064132 Ga0207700_100641324 253
56 3300025929 Ga0207664_10020471 Ga0207664_100204713 253
57 3300033545 Ga0316214_1014067 Ga0316214_10140672 253
58 3300037853 Ga0436364_0390119 Ga0436364_0390119_15151_15918 253
59 3300046499 Ga0495594_0130050 Ga0495594_0130050_540_1307 253
60 3300048903 Ga0496100_0000096 Ga0496100_0000096_15605_16366 253
61 3300048904 Ga0496101_0000017 Ga0496101_0000017_67368_68129 253
62 3300048905 Ga0496102_0008196 Ga0496102_0008196_4943_5704 253
63 3300048906 Ga0496103_0000229 Ga0496103_0000229_43196_43957 253
64 3300048909 Ga0496106_0000604 Ga0496106_0000604_111_872 253
65 3300048910 Ga0496107_0004335 Ga0496107_0004335_6660_7421 253
66 3300048911 Ga0496108_0006116 Ga0496108_0006116_7338_8099 253
67 3300048912 Ga0496109_0002649 Ga0496109_0002649_12160_12921 253
68 3300048913 Ga0496110_0085319 Ga0496110_0085319_734_1495 253
69 3300048914 Ga0496111_0043045 Ga0496111_0043045_1052_1813 253
70 3300048916 Ga0496113_0080452 Ga0496113_0080452_1314_2075 253
71 3300048917 Ga0496114_0000736 Ga0496114_0000736_15632_16393 253
72 3300048918 Ga0496115_0057947 Ga0496115_0057947_2227_2988 253
73 3300048919 Ga0496116_0013743 Ga0496116_0013743_1102_1863 253
74 3300048920 Ga0496117_0029253 Ga0496117_0029253_2232_2993 253
75 3300048921 Ga0496118_0030125 Ga0496118_0030125_1329_2090 253
76 3300048922 Ga0496119_0013820 Ga0496119_0013820_2129_2890 253
77 3300048923 Ga0496120_0031836 Ga0496120_0031836_248_1009 253
78 3300048924 Ga0496121_0000014 Ga0496121_0000014_219849_220610 253
79 3300048925 Ga0496122_0000084 Ga0496122_0000084_20600_21361 253
80 3300048926 Ga0496123_0007339 Ga0496123_0007339_6856_7617 253
81 3300048927 Ga0496124_0000019 Ga0496124_0000019_219849_220610 253
82 3300048928 Ga0496125_0000014 Ga0496125_0000014_219849_220610 253
83 3300048929 Ga0496126_0000017 Ga0496126_0000017_390067_390828 253
84 3300048929 Ga0496126_0024546 Ga0496126_0024546_4053_4823 253
85 3300049581 Ga0501047_0064224 Ga0501047_0064224_280_1044 253
86 3300061719 Ga0466962_0042035 Ga0466962_0042035_402_1169 253
87 3300003203 JGI25406J46586_10001638 JGI25406J46586_100016385 254
88 3300003316 rootH1_10060422 rootH1_100604221 254
89 3300003373 JGI25407J50210_10015837 JGI25407J50210_100158372 254
90 3300005329 Ga0070683_100002546 Ga0070683_1000025469 254
91 3300005347 Ga0070668_100000179 Ga0070668_10000017922 254
92 3300005347 Ga0070668_100262727 Ga0070668_1002627271 254
93 3300005356 Ga0070674_100513523 Ga0070674_1005135231 254
94 3300005435 Ga0070714_100056280 Ga0070714_1000562802 254
95 3300005436 Ga0070713_100493330 Ga0070713_1004933301 254
96 3300005535 Ga0070684_100005923 Ga0070684_1000059239 254
97 3300005539 Ga0068853_100079043 Ga0068853_1000790434 254
98 3300005578 Ga0068854_100396906 Ga0068854_1003969062 254
99 3300005616 Ga0068852_100122960 Ga0068852_1001229604 254
100 3300005841 Ga0068863_100001803 Ga0068863_10000180315 254
101 3300005844 Ga0068862_100089393 Ga0068862_1000893932 254
102 3300005981 Ga0081538_10005172 Ga0081538_100051728 254
103 3300005983 Ga0081540_1026862 Ga0081540_10268622 254
104 3300005985 Ga0081539_10000109 Ga0081539_10000109203 254
105 3300005985 Ga0081539_10003774 Ga0081539_100037745 254
106 3300005985 Ga0081539_10100394 Ga0081539_101003942 254
107 3300006051 Ga0075364_10137529 Ga0075364_101375293 254
108 3300006353 Ga0075370_10050104 Ga0075370_100501041 254
109 3300009098 Ga0105245_10399044 Ga0105245_103990442 254
110 3300009176 Ga0105242_10598241 Ga0105242_105982411 254
111 3300009551 Ga0105238_10108194 Ga0105238_101081943 254
112 3300014745 Ga0157377_10418007 Ga0157377_104180071 254
113 3300014968 Ga0157379_10012223 Ga0157379_100122237 254
114 3300014968 Ga0157379_10686525 Ga0157379_106865251 254
115 3300025924 Ga0207694_10183160 Ga0207694_101831602 254
116 3300025944 Ga0207661_10009319 Ga0207661_100093196 254
117 3300025945 Ga0207679_10004486 Ga0207679_100044866 254
118 3300026041 Ga0207639_10073234 Ga0207639_100732343 254
119 3300026067 Ga0207678_10128474 Ga0207678_101284743 254
120 3300026088 Ga0207641_10001492 Ga0207641_1000149217 254
121 3300028380 Ga0268265_10109919 Ga0268265_101099193 254
122 3300028794 Ga0307515_10000319 Ga0307515_1000031922 254
123 3300028794 Ga0307515_10075407 Ga0307515_100754073 254
124 3300028794 Ga0307515_10188522 Ga0307515_101885223 254
125 3300030521 Ga0307511_10001458 Ga0307511_1000145826 254
126 3300030522 Ga0307512_10009744 Ga0307512_100097445 254
127 3300030522 Ga0307512_10013595 Ga0307512_100135955 254
128 3300030731 Ga0316177_1117602 Ga0316177_11176023 254
129 3300030732 Ga0316176_1016345 Ga0316176_10163453 254
130 3300030736 Ga0316180_1151159 Ga0316180_11511591 254
131 3300031456 Ga0307513_10037253 Ga0307513_100372534 254
132 3300031548 Ga0307408_100090762 Ga0307408_1000907622 254
133 3300031616 Ga0307508_10016962 Ga0307508_100169623 254
134 3300031730 Ga0307516_10107333 Ga0307516_101073334 254
135 3300031852 Ga0307410_10098505 Ga0307410_100985051 254
136 3300031995 Ga0307409_100009893 Ga0307409_1000098936 254
137 3300031995 Ga0307409_100046508 Ga0307409_1000465083 254
138 3300031995 Ga0307409_100230618 Ga0307409_1002306183 254
139 3300032002 Ga0307416_100074713 Ga0307416_1000747133 254
140 3300032002 Ga0307416_100109564 Ga0307416_1001095643 254
141 3300032126 Ga0307415_100038396 Ga0307415_1000383964 254
142 3300033179 Ga0307507_10033707 Ga0307507_100337073 254
143 3300033180 Ga0307510_10219210 Ga0307510_102192103 254
144 3300035207 Ga0373942_0026651 Ga0373942_0026651_95_913 254
145 3300035242 Ga0373962_0006637 Ga0373962_0006637_1704_2522 254
146 3300035692 Ga0373935_0006817 Ga0373935_0006817_5306_6130 254
147 3300037068 Ga0373925_0033834 Ga0373925_0033834_995_1759 254
148 3300041451 Ga0451791_1067214 Ga0451791_1067214_29_850 254
149 3300041453 Ga0451797_0426434 Ga0451797_0426434_257_1039 254
150 3300041512 Ga0451853_0710131 Ga0451853_0710131_2880_3653 254
151 3300042016 Ga0439463_036086 Ga0439463_036086_197_1015 254
152 3300042438 Ga0439459_0025201 Ga0439459_0025201_107_925 254
153 3300044656 Ga0466969_0010834 Ga0466969_0010834_3972_4739 254
154 3300044658 Ga0466972_0006564 Ga0466972_0006564_1646_2458 254
155 3300044658 Ga0466972_0019047 Ga0466972_0019047_314_1114 254
156 3300044683 Ga0466965_0001004 Ga0466965_0001004_3420_4232 254
157 3300044683 Ga0466965_0013958 Ga0466965_0013958_1281_2111 254
158 3300044693 Ga0466961_0146755 Ga0466961_0146755_55_825 254
159 3300044735 Ga0466968_0006736 Ga0466968_0006736_2444_3274 254
160 3300044765 Ga0466970_0029097 Ga0466970_0029097_670_1500 254
161 3300044765 Ga0466970_0111730 Ga0466970_0111730_454_1218 254
162 3300044842 Ga0466957_0009531 Ga0466957_0009531_43_873 254
163 3300044842 Ga0466957_0054008 Ga0466957_0054008_1477_2262 254
164 3300044842 Ga0466957_0054821 Ga0466957_0054821_121_933 254
165 3300044901 Ga0466960_0000778 Ga0466960_0000778_6265_7077 254
166 3300044901 Ga0466960_0002863 Ga0466960_0002863_5221_6051 254
167 3300045049 Ga0466959_0005845 Ga0466959_0005845_1405_2235 254
168 3300045836 Ga0466958_0086666 Ga0466958_0086666_441_1271 254
169 3300045976 Ga0466967_0080515 Ga0466967_0080515_1352_2170 254
170 3300045976 Ga0466967_0330629 Ga0466967_0330629_168_971 254
171 3300045976 Ga0466967_0671626 Ga0466967_0671626_66_887 254
172 3300046499 Ga0495594_0041560 Ga0495594_0041560_323_1093 254
173 3300046539 Ga0495621_0176395 Ga0495621_0176395_40_831 254
174 3300048903 Ga0496100_0003663 Ga0496100_0003663_3577_4359 254
175 3300048904 Ga0496101_0079998 Ga0496101_0079998_1466_2248 254
176 3300048905 Ga0496102_0000020 Ga0496102_0000020_182466_183248 254
177 3300048906 Ga0496103_0000011 Ga0496103_0000011_293709_294491 254
178 3300048907 Ga0496104_0663653 Ga0496104_0663653_142_924 254
179 3300048908 Ga0496105_0084749 Ga0496105_0084749_247_1029 254
180 3300048909 Ga0496106_0590425 Ga0496106_0590425_92_874 254
181 3300048910 Ga0496107_0036856 Ga0496107_0036856_2695_3477 254
182 3300048911 Ga0496108_0000287 Ga0496108_0000287_10486_11316 254
183 3300048912 Ga0496109_0433520 Ga0496109_0433520_170_964 254
184 3300048912 Ga0496109_0513681 Ga0496109_0513681_230_1012 254
185 3300048914 Ga0496111_0555223 Ga0496111_0555223_44_826 254
186 3300048916 Ga0496113_0137111 Ga0496113_0137111_118_915 254
187 3300048917 Ga0496114_0165863 Ga0496114_0165863_941_1723 254
188 3300048918 Ga0496115_0054346 Ga0496115_0054346_2189_2974 254
189 3300048919 Ga0496116_0000067 Ga0496116_0000067_182451_183233 254
190 3300048920 Ga0496117_0000170 Ga0496117_0000170_57886_58668 254
191 3300048921 Ga0496118_0000076 Ga0496118_0000076_182440_183222 254
192 3300048922 Ga0496119_0000237 Ga0496119_0000237_12758_13540 254
193 3300048923 Ga0496120_0004465 Ga0496120_0004465_1428_2210 254
194 3300048924 Ga0496121_0015689 Ga0496121_0015689_5503_6285 254
195 3300048925 Ga0496122_0009281 Ga0496122_0009281_5480_6265 254
196 3300048926 Ga0496123_0033363 Ga0496123_0033363_2034_2819 254
197 3300048927 Ga0496124_0004177 Ga0496124_0004177_15258_16040 254
198 3300048928 Ga0496125_0048446 Ga0496125_0048446_1333_2115 254
199 3300048929 Ga0496126_0000080 Ga0496126_0000080_38378_39160 254
200 3300048929 Ga0496126_0073918 Ga0496126_0073918_884_1681 254
201 3300049568 Ga0501031_0020043 Ga0501031_0020043_1534_2325 254
202 3300049569 Ga0501032_0068135 Ga0501032_0068135_385_1206 254
203 3300049570 Ga0501033_0068575 Ga0501033_0068575_1619_2440 254
204 3300049571 Ga0501034_0030381 Ga0501034_0030381_455_1276 254
205 3300049571 Ga0501034_0450223 Ga0501034_0450223_286_1107 254
206 3300049573 Ga0501037_0050931 Ga0501037_0050931_1281_2102 254
207 3300049573 Ga0501037_0072058 Ga0501037_0072058_1196_2017 254
208 3300049574 Ga0501038_0032621 Ga0501038_0032621_479_1300 254
209 3300049575 Ga0501039_0105530 Ga0501039_0105530_351_1172 254
210 3300049577 Ga0501041_0146914 Ga0501041_0146914_88_864 254
211 3300049578 Ga0501042_0014215 Ga0501042_0014215_2864_3688 254
212 3300049578 Ga0501042_0077025 Ga0501042_0077025_463_1284 254
213 3300049579 Ga0501043_0029948 Ga0501043_0029948_1620_2441 254
214 3300049580 Ga0501046_0065450 Ga0501046_0065450_412_1233 254
215 3300049580 Ga0501046_0084777 Ga0501046_0084777_1542_2363 254
216 3300049581 Ga0501047_0009344 Ga0501047_0009344_3742_4563 254
217 3300049582 Ga0501048_0018428 Ga0501048_0018428_1963_2784 254
218 3300049582 Ga0501048_0313789 Ga0501048_0313789_187_1008 254
219 3300049584 Ga0501068_0073331 Ga0501068_0073331_731_1555 254
220 3300049592 Ga0501076_0136081 Ga0501076_0136081_24_815 254
221 3300049822 Ga0501035_0045936 Ga0501035_0045936_1489_2310 254
222 3300049822 Ga0501035_0071336 Ga0501035_0071336_423_1214 254
223 3300049822 Ga0501035_0152585 Ga0501035_0152585_11_832 254
224 3300049823 Ga0501044_0032432 Ga0501044_0032432_2348_3169 254
225 3300050496 nmdc:mga07m45_195025_c1 nmdc:mga07m45_195025_c1_123_914 254
226 3300053109 Ga0500569_002846 Ga0500569_002846_1329_2135 254
227 3300053118 Ga0500594_0038789 Ga0500594_0038789_250_1056 254
228 3300053131 Ga0500652_003606 Ga0500652_003606_2404_3210 254
229 3300053136 Ga0500559_0000063 Ga0500559_0000063_712_1476 254
230 3300053136 Ga0500559_0008079 Ga0500559_0008079_2809_3603 254
231 3300053140 Ga0500573_0040708 Ga0500573_0040708_528_1301 254
232 3300054114 Ga0501084_0010187 Ga0501084_0010187_145_936 254
233 iso_pu_bacteria 2831935698 2831935729 254
234 iso_pu_bacteria 8056207758 8056212901 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

13

247

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9756 1 254
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9744 1 252
3tb5-assembly3.cif.gz_C crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9712 3 252
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9666 1 252
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9595 1 254
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9776 1 254 3.90.230.10
3tb5C00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9713 3 252 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9686 4 252 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9595 1 254 3.90.230.10
af_Q54VU7_119_404_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.958 1 253 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A810LSL7-F1-model_v4 deleted 0.9997 1 254
AF-A0A4R7PLM7-F1-model_v4 deleted 0.9964 1 254
AF-A0A810LSL7-F1-model_v4 deleted 0.9958 1 254
AF-A0A1V4Q7Y1-F1-model_v4 Type I methionyl aminopeptidase 0.9948 93 254 GO:0005829
GO:0070006
AF-A0A1U6IZA4-F1-model_v4 Metallopeptidase family M24 0.9946 120 254 GO:0005829
GO:0070006

Feature Viewer

pLDDT pTM Quality
94.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map