F347533

General Info

Members Datasets Scaffolds Average Seq Length
234 173 468 284

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0012731|Ga0501076_0012731_3762_4781
Length 339
Sequence VDEDERQRPDGLRAGADASRRHRGWRLLQRHAGGGRARLNAGAHALVGGVETGGSKILCAIGTGPDDVRAELRIPTGDPGETLARAVAFFREQPTRAAALGIACFGPVDLDPRSPTFGFITTTPKPRWAHTDVAGPFRSALGVPVGFDTDVNGAALGEHRWGAGAGIDPFVYVTVGTGIGGGALVNGRLLHGLVHPEMGHLRLPHDRAADPFPGTCPYHGDCLDGLASGRALRERWGAPAESLPSDHPAWPLEAEYLALGLVAVIGVLSPKRIVLGGGVMQQPVLLPRVRRRVVELLAGYVGASAIVEHVDDYIVPPALGARAGVLGALALAHATLVSP

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.99
Nodule 0
Rhizoplane 8.12
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0012731 3300049592 Bacteria 6296
2 Ga0070676_10198117 3300005328 Bacteria 1315
3 Ga0070690_100184715 3300005330 Bacteria 1442
4 Ga0068869_100109434 3300005334 Bacteria 2100
5 Ga0070666_10082251 3300005335 Unclassified 2202
6 Ga0070680_100333044 3300005336 Bacteria 1289
7 Ga0070682_100001824 3300005337 Bacteria 11866
8 Ga0068868_100020117 3300005338 Bacteria 5008
9 Ga0070689_100053015 3300005340 Bacteria 3138
10 Ga0070687_100032924 3300005343 Bacteria 2554
11 Ga0070669_100482701 3300005353 Bacteria 1026
12 Ga0070674_100204284 3300005356 Bacteria 1528
13 Ga0070667_100145146 3300005367 Unclassified 2081
14 Ga0070713_100213437 3300005436 Bacteria 1748
15 Ga0070701_10186573 3300005438 Bacteria 1217
16 Ga0070705_100016433 3300005440 Bacteria 3846
17 Ga0070700_100034480 3300005441 Bacteria 3057
18 Ga0070694_100086149 3300005444 Bacteria 2195
19 Ga0070708_100311343 3300005445 Bacteria 1483
20 Ga0070663_100018035 3300005455 Bacteria 4619
21 Ga0070663_100299315 3300005455 Bacteria 1287
22 Ga0070678_100054069 3300005456 Bacteria 2923
23 Ga0070662_100076984 3300005457 Bacteria 2474
24 Ga0070681_10071476 3300005458 Bacteria 3435
25 Ga0068867_100100344 3300005459 Bacteria 2210
26 Ga0070698_100213496 3300005471 Bacteria 1864
27 Ga0070699_100130188 3300005518 Bacteria 2218
28 Ga0070679_100073945 3300005530 Bacteria 3399
29 Ga0070672_100012749 3300005543 Bacteria 5917
30 Ga0070686_100049026 3300005544 Bacteria 2678
31 Ga0070686_100072424 3300005544 Bacteria 2259
32 Ga0070695_100028781 3300005545 Bacteria 3450
33 Ga0070696_100003007 3300005546 Bacteria 11189
34 Ga0070696_100047904 3300005546 Bacteria 2967
35 Ga0070696_100061033 3300005546 Bacteria 2637
36 Ga0070693_100030856 3300005547 Bacteria 2934
37 Ga0070704_100083889 3300005549 Bacteria 2354
38 Ga0068854_100141485 3300005578 Unclassified 1847
39 Ga0070702_100035396 3300005615 Bacteria 2758
40 Ga0068859_100118819 3300005617 Bacteria 2709
41 Ga0068859_100155765 3300005617 Bacteria 2362
42 Ga0068866_10055495 3300005718 Bacteria 2035
43 Ga0068861_100070132 3300005719 Bacteria 2713
44 Ga0068870_10056772 3300005840 Bacteria 2091
45 Ga0068863_100027609 3300005841 Bacteria 5415
46 Ga0068858_100046176 3300005842 Bacteria 4038
47 Ga0068860_100049037 3300005843 Bacteria 4024
48 Ga0081455_10027183 3300005937 Bacteria 5245
49 Ga0081539_10002003 3300005985 Bacteria 30898
50 Ga0070717_10037909 3300006028 Bacteria 3916
51 Ga0075364_10005747 3300006051 Bacteria 7234
52 Ga0070716_100078164 3300006173 Unclassified 1966
53 Ga0070712_100185429 3300006175 Bacteria 1624
54 Ga0075362_10005943 3300006177 Bacteria 4511
55 Ga0075366_10001490 3300006195 Bacteria 11690
56 Ga0097621_100114851 3300006237 Bacteria 2278
57 Ga0075370_10153072 3300006353 Bacteria 1352
58 Ga0068871_100351407 3300006358 Bacteria 1304
59 Ga0075430_100213703 3300006846 Bacteria 1600
60 Ga0075431_100283980 3300006847 Bacteria 1676
61 Ga0075433_10150655 3300006852 Bacteria 2069
62 Ga0075433_10255489 3300006852 Unclassified 1554
63 Ga0075434_100093163 3300006871 Bacteria 3016
64 Ga0075434_100516494 3300006871 Bacteria 1215
65 Ga0075429_100027422 3300006880 Bacteria 4944
66 Ga0075429_100052005 3300006880 Bacteria 3563
67 Ga0075429_100134821 3300006880 Bacteria 2161
68 Ga0097620_100118815 3300006931 Bacteria 2709
69 Ga0097620_100155757 3300006931 Bacteria 2362
70 Ga0075435_100308874 3300007076 Bacteria 1353
71 Ga0111539_10004140 3300009094 Bacteria 19023
72 Ga0111539_10086998 3300009094 Bacteria 3672
73 Ga0105245_10332735 3300009098 Bacteria 1499
74 Ga0114129_10217383 3300009147 Bacteria 2580
75 Ga0114129_10280228 3300009147 Bacteria 2228
76 Ga0114129_10324606 3300009147 Unclassified 2045
77 Ga0105243_10051472 3300009148 Bacteria 3258
78 Ga0105241_10158041 3300009174 Bacteria 1861
79 Ga0105242_10142309 3300009176 Unclassified 2083
80 Ga0105242_10277265 3300009176 Bacteria 1521
81 Ga0105248_10053652 3300009177 Bacteria 4523
82 Ga0105249_10058250 3300009553 Bacteria 3541
83 Ga0157375_10062027 3300013308 Bacteria 3713
84 Ga0157380_10041332 3300014326 Bacteria 3598
85 Ga0157380_10556973 3300014326 Bacteria 1126
86 Ga0157379_10313230 3300014968 Bacteria 1432
87 Ga0157379_10406138 3300014968 Unclassified 1253
88 Ga0157376_10355152 3300014969 Bacteria 1404
89 Ga0182006_1021702 3300015261 Bacteria 2675
90 Ga0207682_10073420 3300025893 Bacteria 1453
91 Ga0207642_10013453 3300025899 Unclassified 2986
92 Ga0207680_10028749 3300025903 Bacteria 3114
93 Ga0207643_10005031 3300025908 Bacteria 7082
94 Ga0207663_10024145 3300025916 Bacteria 3498
95 Ga0207662_10011230 3300025918 Bacteria 4958
96 Ga0207652_10099325 3300025921 Bacteria 2568
97 Ga0207681_10259928 3300025923 Bacteria 1359
98 Ga0207659_10091229 3300025926 Unclassified 2275
99 Ga0207664_10053480 3300025929 Bacteria 3196
100 Ga0207706_10039070 3300025933 Bacteria 4208
101 Ga0207706_10244197 3300025933 Bacteria 1569
102 Ga0207686_10292811 3300025934 Unclassified 1206
103 Ga0207670_10029978 3300025936 Bacteria 3472
104 Ga0207665_10006404 3300025939 Bacteria 7810
105 Ga0207691_10005514 3300025940 Bacteria 12227
106 Ga0207689_10005551 3300025942 Bacteria 11261
107 Ga0207679_10398855 3300025945 Bacteria 1210
108 Ga0207658_10449668 3300025986 Unclassified 1140
109 Ga0207678_10012671 3300026067 Bacteria 7410
110 Ga0207678_10023393 3300026067 Bacteria 5404
111 Ga0207708_10010445 3300026075 Bacteria 6894
112 Ga0207702_10191404 3300026078 Bacteria 1890
113 Ga0207648_10007459 3300026089 Bacteria 10751
114 Ga0207676_10230121 3300026095 Unclassified 1657
115 Ga0207675_100008207 3300026118 Bacteria 9839
116 Ga0207683_10000689 3300026121 Bacteria 30988
117 Ga0207428_10000328 3300027907 Bacteria 61709
118 Ga0307408_100021048 3300031548 Bacteria 4409
119 Ga0307408_100029968 3300031548 Bacteria 3775
120 Ga0307408_100250461 3300031548 Bacteria 1460
121 Ga0307408_100382820 3300031548 Bacteria 1203
122 Ga0307410_10164876 3300031852 Bacteria 1664
123 Ga0307407_10102761 3300031903 Bacteria 1778
124 Ga0307416_100259404 3300032002 Bacteria 1698
125 Ga0307416_100278924 3300032002 Bacteria 1646
126 Ga0307411_10048419 3300032005 Bacteria 2755
127 Ga0373929_0021890 3300035085 Bacteria 1301
128 Ga0373949_0030200 3300035090 Bacteria 1287
129 Ga0373951_0022001 3300035091 Bacteria 1466
130 Ga0373939_0046732 3300035114 Bacteria 1326
131 Ga0373941_0052106 3300035115 Bacteria 1304
132 Ga0373961_0012970 3300035241 Bacteria 2094
133 Ga0373931_0028352 3300035691 Bacteria 2866
134 Ga0373931_0103437 3300035691 Bacteria 1605
135 Ga0373927_0034241 3300035695 Bacteria 3305
136 Ga0373947_0049659 3300035725 Bacteria 2520
137 Ga0373947_0064795 3300035725 Bacteria 2228
138 Ga0316584_0055476 3300036712 Bacteria 2967
139 Ga0395899_0063294 3300037312 Bacteria 2722
140 Ga0395899_0100943 3300037312 Bacteria 2083
141 Ga0395900_0010630 3300037418 Bacteria 9413
142 Ga0395900_0043485 3300037418 Bacteria 4630
143 Ga0395900_0053715 3300037418 Bacteria 4147
144 Ga0395900_0121760 3300037418 Bacteria 2676
145 Ga0395900_0187627 3300037418 Bacteria 2098
146 Ga0395898_0006499 3300037466 Bacteria 12488
147 Ga0395898_0010110 3300037466 Bacteria 9875
148 Ga0395898_0025426 3300037466 Bacteria 5965
149 Ga0395898_0309119 3300037466 Bacteria 1508
150 Ga0395905_0016197 3300037471 Bacteria 7084
151 Ga0395905_0040698 3300037471 Bacteria 4360
152 Ga0395905_0088342 3300037471 Bacteria 2905
153 Ga0395905_0091191 3300037471 Bacteria 2857
154 Ga0395901_0002645 3300038443 Bacteria 18101
155 Ga0450888_001883 3300042126 Unclassified 2033
156 Ga0453684_0008385 3300044712 Bacteria 18549
157 Ga0453684_0043869 3300044712 Bacteria 6000
158 Ga0453684_0104575 3300044712 Bacteria 3456
159 Ga0453684_0802718 3300044712 Bacteria 1015
160 Ga0466959_0006932 3300045049 Bacteria 7913
161 Ga0451576_0007969 3300045051 Bacteria 12528
162 Ga0451576_0282869 3300045051 Bacteria 1734
163 Ga0466958_0183156 3300045836 Bacteria 1329
164 Ga0466967_0008636 3300045976 Bacteria 7490
165 Ga0466967_0021209 3300045976 Bacteria 5270
166 Ga0466967_0038187 3300045976 Bacteria 4116
167 Ga0466967_0042478 3300045976 Bacteria 3929
168 Ga0495629_0047611 3300046459 Bacteria 3007
169 Ga0495582_0122314 3300046473 Bacteria 1467
170 Ga0495630_0092804 3300046517 Bacteria 2282
171 Ga0495586_0044530 3300046535 Bacteria 2391
172 Ga0495634_0011977 3300046642 Bacteria 6291
173 Ga0495588_0252267 3300046674 Bacteria 930
174 Ga0495658_0020157 3300046683 Bacteria 3495
175 Ga0495613_0023056 3300046689 Bacteria 4639
176 Ga0495674_0464906 3300047319 Bacteria 1015
177 Ga0495676_0065637 3300047321 Bacteria 2816
178 Ga0496100_0206995 3300048903 Bacteria 1433
179 Ga0496100_0216176 3300048903 Unclassified 1404
180 Ga0496102_0370420 3300048905 Bacteria 1348
181 Ga0496103_0008472 3300048906 Bacteria 6108
182 Ga0496105_0133626 3300048908 Bacteria 2044
183 Ga0496106_0115467 3300048909 Bacteria 2093
184 Ga0496108_0002596 3300048911 Bacteria 14467
185 Ga0496109_0001361 3300048912 Bacteria 20257
186 Ga0496109_0154385 3300048912 Bacteria 2150
187 Ga0496110_0025771 3300048913 Bacteria 5027
188 Ga0496110_0077051 3300048913 Bacteria 2965
189 Ga0496110_0173051 3300048913 Bacteria 1959
190 Ga0496111_0002800 3300048914 Bacteria 10625
191 Ga0496111_0016196 3300048914 Bacteria 5135
192 Ga0496112_0123031 3300048915 Bacteria 2565
193 Ga0496112_0765041 3300048915 Bacteria 891
194 Ga0496113_0535796 3300048916 Bacteria 939
195 Ga0496114_0235118 3300048917 Bacteria 1610
196 Ga0496114_0411101 3300048917 Bacteria 1198
197 Ga0501042_0218422 3300049578 Bacteria 1375
198 Ga0501067_0001453 3300049583 Bacteria 12880
199 Ga0501067_0057421 3300049583 Bacteria 2155
200 Ga0501068_0202639 3300049584 Bacteria 1258
201 Ga0501069_0035790 3300049585 Bacteria 2736
202 Ga0501069_0132929 3300049585 Bacteria 1425
203 Ga0501071_0240406 3300049587 Bacteria 1365
204 Ga0501072_0015495 3300049588 Bacteria 5843
205 Ga0501072_0219286 3300049588 Bacteria 1516
206 Ga0501074_0140574 3300049590 Bacteria 1727
207 Ga0501075_0133238 3300049591 Bacteria 1893
208 Ga0501075_0204854 3300049591 Unclassified 1505
209 Ga0501077_0005553 3300049593 Bacteria 7676
210 Ga0501079_0054490 3300049741 Bacteria 3084
211 Ga0501079_0279442 3300049741 Bacteria 1306
212 Ga0501079_0321955 3300049741 Bacteria 1210
213 Ga0501081_0001461 3300049743 Bacteria 14477
214 Ga0501081_0024552 3300049743 Bacteria 4048
215 Ga0501035_0146857 3300049822 Bacteria 2048
216 Ga0501044_0214821 3300049823 Bacteria 1876
217 Ga0501045_0085943 3300049824 Bacteria 2322
218 nmdc:mga00v17_172043_c1 3300050491 Bacteria 1397
219 nmdc:mga0k408_2985_c1 3300050493 Bacteria 8967
220 nmdc:mga07m45_37414_c1 3300050496 Bacteria 2706
221 nmdc:mga05p37_211925_c2 3300050507 Unclassified 1436
222 nmdc:mga05p37_81244_c1 3300050507 Bacteria 3993
223 nmdc:mga06r32_64297_c1 3300050510 Bacteria 3538
224 nmdc:mga08y16_1357_c1 3300050511 Bacteria 24450
225 nmdc:mga08y16_238413_c1 3300050511 Unclassified 1880
226 nmdc:mga0n895_1089_c1 3300050512 Bacteria 19872
227 nmdc:mga0n895_234606_c1 3300050512 Bacteria 1862
228 nmdc:mga0rr50_218683_c1 3300050513 Bacteria 1572
229 nmdc:mga0a205_42138_c1 3300050515 Bacteria 4398
230 nmdc:mga0a205_53948_c1 3300050515 Bacteria 3880
231 Ga0501084_0015525 3300054114 Bacteria 6316
232 Ga0501082_0003395 3300060353 Bacteria 13901
233 Ga0501082_0268049 3300060353 Bacteria 1486
234 Ga0530510_0025510 3300061734 Bacteria 4227
235 Ga0501076_0012731
236 Ga0070676_10198117
237 Ga0070690_100184715
238 Ga0068869_100109434
239 Ga0070666_10082251
240 Ga0070680_100333044
241 Ga0070682_100001824
242 Ga0068868_100020117
243 Ga0070689_100053015
244 Ga0070687_100032924
245 Ga0070669_100482701
246 Ga0070674_100204284
247 Ga0070667_100145146
248 Ga0070713_100213437
249 Ga0070701_10186573
250 Ga0070705_100016433
251 Ga0070700_100034480
252 Ga0070694_100086149
253 Ga0070708_100311343
254 Ga0070663_100018035
255 Ga0070663_100299315
256 Ga0070678_100054069
257 Ga0070662_100076984
258 Ga0070681_10071476
259 Ga0068867_100100344
260 Ga0070698_100213496
261 Ga0070699_100130188
262 Ga0070679_100073945
263 Ga0070672_100012749
264 Ga0070686_100049026
265 Ga0070686_100072424
266 Ga0070695_100028781
267 Ga0070696_100003007
268 Ga0070696_100047904
269 Ga0070696_100061033
270 Ga0070693_100030856
271 Ga0070704_100083889
272 Ga0068854_100141485
273 Ga0070702_100035396
274 Ga0068859_100118819
275 Ga0068859_100155765
276 Ga0068866_10055495
277 Ga0068861_100070132
278 Ga0068870_10056772
279 Ga0068863_100027609
280 Ga0068858_100046176
281 Ga0068860_100049037
282 Ga0081455_10027183
283 Ga0081539_10002003
284 Ga0070717_10037909
285 Ga0075364_10005747
286 Ga0070716_100078164
287 Ga0070712_100185429
288 Ga0075362_10005943
289 Ga0075366_10001490
290 Ga0097621_100114851
291 Ga0075370_10153072
292 Ga0068871_100351407
293 Ga0075430_100213703
294 Ga0075431_100283980
295 Ga0075433_10150655
296 Ga0075433_10255489
297 Ga0075434_100093163
298 Ga0075434_100516494
299 Ga0075429_100027422
300 Ga0075429_100052005
301 Ga0075429_100134821
302 Ga0097620_100118815
303 Ga0097620_100155757
304 Ga0075435_100308874
305 Ga0111539_10004140
306 Ga0111539_10086998
307 Ga0105245_10332735
308 Ga0114129_10217383
309 Ga0114129_10280228
310 Ga0114129_10324606
311 Ga0105243_10051472
312 Ga0105241_10158041
313 Ga0105242_10142309
314 Ga0105242_10277265
315 Ga0105248_10053652
316 Ga0105249_10058250
317 Ga0157375_10062027
318 Ga0157380_10041332
319 Ga0157380_10556973
320 Ga0157379_10313230
321 Ga0157379_10406138
322 Ga0157376_10355152
323 Ga0182006_1021702
324 Ga0207682_10073420
325 Ga0207642_10013453
326 Ga0207680_10028749
327 Ga0207643_10005031
328 Ga0207663_10024145
329 Ga0207662_10011230
330 Ga0207652_10099325
331 Ga0207681_10259928
332 Ga0207659_10091229
333 Ga0207664_10053480
334 Ga0207706_10039070
335 Ga0207706_10244197
336 Ga0207686_10292811
337 Ga0207670_10029978
338 Ga0207665_10006404
339 Ga0207691_10005514
340 Ga0207689_10005551
341 Ga0207679_10398855
342 Ga0207658_10449668
343 Ga0207678_10012671
344 Ga0207678_10023393
345 Ga0207708_10010445
346 Ga0207702_10191404
347 Ga0207648_10007459
348 Ga0207676_10230121
349 Ga0207675_100008207
350 Ga0207683_10000689
351 Ga0207428_10000328
352 Ga0307408_100021048
353 Ga0307408_100029968
354 Ga0307408_100250461
355 Ga0307408_100382820
356 Ga0307410_10164876
357 Ga0307407_10102761
358 Ga0307416_100259404
359 Ga0307416_100278924
360 Ga0307411_10048419
361 Ga0373929_0021890
362 Ga0373949_0030200
363 Ga0373951_0022001
364 Ga0373939_0046732
365 Ga0373941_0052106
366 Ga0373961_0012970
367 Ga0373931_0028352
368 Ga0373931_0103437
369 Ga0373927_0034241
370 Ga0373947_0049659
371 Ga0373947_0064795
372 Ga0316584_0055476
373 Ga0395899_0063294
374 Ga0395899_0100943
375 Ga0395900_0010630
376 Ga0395900_0043485
377 Ga0395900_0053715
378 Ga0395900_0121760
379 Ga0395900_0187627
380 Ga0395898_0006499
381 Ga0395898_0010110
382 Ga0395898_0025426
383 Ga0395898_0309119
384 Ga0395905_0016197
385 Ga0395905_0040698
386 Ga0395905_0088342
387 Ga0395905_0091191
388 Ga0395901_0002645
389 Ga0450888_001883
390 Ga0453684_0008385
391 Ga0453684_0043869
392 Ga0453684_0104575
393 Ga0453684_0802718
394 Ga0466959_0006932
395 Ga0451576_0007969
396 Ga0451576_0282869
397 Ga0466958_0183156
398 Ga0466967_0008636
399 Ga0466967_0021209
400 Ga0466967_0038187
401 Ga0466967_0042478
402 Ga0495629_0047611
403 Ga0495582_0122314
404 Ga0495630_0092804
405 Ga0495586_0044530
406 Ga0495634_0011977
407 Ga0495588_0252267
408 Ga0495658_0020157
409 Ga0495613_0023056
410 Ga0495674_0464906
411 Ga0495676_0065637
412 Ga0496100_0206995
413 Ga0496100_0216176
414 Ga0496102_0370420
415 Ga0496103_0008472
416 Ga0496105_0133626
417 Ga0496106_0115467
418 Ga0496108_0002596
419 Ga0496109_0001361
420 Ga0496109_0154385
421 Ga0496110_0025771
422 Ga0496110_0077051
423 Ga0496110_0173051
424 Ga0496111_0002800
425 Ga0496111_0016196
426 Ga0496112_0123031
427 Ga0496112_0765041
428 Ga0496113_0535796
429 Ga0496114_0235118
430 Ga0496114_0411101
431 Ga0501042_0218422
432 Ga0501067_0001453
433 Ga0501067_0057421
434 Ga0501068_0202639
435 Ga0501069_0035790
436 Ga0501069_0132929
437 Ga0501071_0240406
438 Ga0501072_0015495
439 Ga0501072_0219286
440 Ga0501074_0140574
441 Ga0501075_0133238
442 Ga0501075_0204854
443 Ga0501077_0005553
444 Ga0501079_0054490
445 Ga0501079_0279442
446 Ga0501079_0321955
447 Ga0501081_0001461
448 Ga0501081_0024552
449 Ga0501035_0146857
450 Ga0501044_0214821
451 Ga0501045_0085943
452 nmdc:mga00v17_172043_c1
453 nmdc:mga0k408_2985_c1
454 nmdc:mga07m45_37414_c1
455 nmdc:mga05p37_211925_c2
456 nmdc:mga05p37_81244_c1
457 nmdc:mga06r32_64297_c1
458 nmdc:mga08y16_1357_c1
459 nmdc:mga08y16_238413_c1
460 nmdc:mga0n895_1089_c1
461 nmdc:mga0n895_234606_c1
462 nmdc:mga0rr50_218683_c1
463 nmdc:mga0a205_42138_c1
464 nmdc:mga0a205_53948_c1
465 Ga0501084_0015525
466 Ga0501082_0003395
467 Ga0501082_0268049
468 Ga0530510_0025510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

47

335

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xc3-assembly1.cif.gz_A structure of a putative fructokinase from bacillus subtilis 0.9569 4 286
1xc3-assembly1.cif.gz_A structure of a putative fructokinase from bacillus subtilis 0.9407 4 286
7wn7-assembly1.cif.gz_A crystal structure of hearnpv p26 0.8619 5 35
6xb3-assembly8.cif.gz_P structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.8491 7 35
6xb3-assembly6.cif.gz_K structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.848 7 35
ID Description Score Start End Superfamily
af_Q54TJ9_112_309_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9477 108 284 3.30.420.40
1xc3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.945 4 106 3.30.420.40
1xc3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9363 4 106 3.30.420.40
af_Q54TJ9_5_111_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9346 4 106 3.30.420.40
3ohrA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9109 108 286 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A3B8NH54-F1-model_v4 fructokinase (EC 2.7.1.4) 0.9714 155 284 GO:0005524
GO:0016301
GO:0046872
AF-A0A1N6RRH6-F1-model_v4 fructokinase (EC 2.7.1.4) 0.9705 6 287 GO:0005524
GO:0016301
GO:0046872
AF-A0A0S7BBD5-F1-model_v4 fructokinase (EC 2.7.1.4) 0.9689 4 283 GO:0005524
GO:0016301
GO:0046872
AF-A0A0F5R4L1-F1-model_v4 fructokinase (EC 2.7.1.4) 0.9682 5 286 GO:0005524
GO:0016301
GO:0046872
AF-A0A2V9SD69-F1-model_v4 fructokinase (EC 2.7.1.4) 0.9669 6 286 GO:0005524
GO:0016301
GO:0046872

Map