F347414

General Info

Members Datasets Scaffolds Average Seq Length
234 151 468 204

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0050860|Ga0495643_0050860_539_1198
Length 219
Sequence MSEFVIKVLLSYLLGSVVGSLVVGRLRGGVDIRTLGSGNAGGTNALRTQGKTFALWVLLIDIGKGWIATRLIPRLVLPGVAAAQAAPEELRVWLPVACGVASIVGHVYPIWHGFRGGKGVATLVGVILGLDPLLLLPMLLTWFATVFIFGFVGLASMLAAASIPIYVSSVGLEPGLPLTTFGVIVTALIVFTHRSNIARMRARTEPRARRLWLFGRHGR

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
149 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
150 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 3.42
Rhizosphere 78.63
Stem 0
Stem Tuber 0
Unclassified 13.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0050860 3300046522 Bacteria 2231
2 rootL2_10278978 3300003322 Bacteria 2041
3 rootH1_10220776 3300003323 Bacteria 3814
4 JGI25405J52794_10043734 3300003911 Bacteria 951
5 Ga0070677_10005910 3300005333 Bacteria 4054
6 Ga0068869_100469305 3300005334 Bacteria 1046
7 Ga0070682_100448744 3300005337 Bacteria 987
8 Ga0070689_100110584 3300005340 Bacteria 2185
9 Ga0070675_100041053 3300005354 Bacteria 3779
10 Ga0070674_100011895 3300005356 Bacteria 5319
11 Ga0070673_100010899 3300005364 Bacteria 6179
12 Ga0070673_100748249 3300005364 Unclassified 900
13 Ga0070667_100268407 3300005367 Bacteria 1529
14 Ga0070700_100199446 3300005441 Bacteria 1405
15 Ga0070663_100212134 3300005455 Bacteria 1516
16 Ga0070678_100007553 3300005456 Bacteria 6457
17 Ga0070681_10102301 3300005458 Bacteria 2810
18 Ga0070685_10248983 3300005466 Bacteria 1176
19 Ga0070679_100019485 3300005530 Bacteria 6597
20 Ga0070672_100009274 3300005543 Bacteria 6779
21 Ga0070672_100019931 3300005543 Bacteria 4881
22 Ga0070696_100106987 3300005546 Bacteria 2011
23 Ga0070665_100004910 3300005548 Bacteria 13869
24 Ga0070665_100022030 3300005548 Bacteria 6410
25 Ga0070665_100057123 3300005548 Bacteria 3913
26 Ga0070665_100165172 3300005548 Unclassified 2216
27 Ga0070665_100211877 3300005548 Unclassified 1938
28 Ga0070665_100255969 3300005548 Unclassified 1751
29 Ga0070665_100733766 3300005548 Unclassified 1001
30 Ga0068855_100137822 3300005563 Bacteria 2783
31 Ga0068856_100064258 3300005614 Bacteria 3626
32 Ga0068859_100001648 3300005617 Bacteria 22792
33 Ga0068861_100005767 3300005719 Bacteria 8400
34 Ga0068861_100584623 3300005719 Bacteria 1023
35 Ga0068870_10198225 3300005840 Bacteria 1216
36 Ga0068863_100008267 3300005841 Bacteria 10165
37 Ga0068863_100041123 3300005841 Bacteria 4394
38 Ga0068863_100062607 3300005841 Bacteria 3518
39 Ga0068858_100004977 3300005842 Bacteria 13017
40 Ga0068858_100010534 3300005842 Bacteria 8755
41 Ga0068860_100000142 3300005843 Bacteria 117670
42 Ga0068860_100023893 3300005843 Bacteria 5908
43 Ga0068862_100172649 3300005844 Bacteria 1936
44 Ga0068862_100410681 3300005844 Bacteria 1268
45 Ga0068862_100666114 3300005844 Bacteria 1005
46 Ga0081455_10004270 3300005937 Bacteria 16097
47 Ga0081455_10006436 3300005937 Bacteria 12590
48 Ga0081539_10000011 3300005985 Bacteria 461887
49 Ga0097621_100449455 3300006237 Bacteria 1161
50 Ga0068871_100136565 3300006358 Bacteria 2083
51 Ga0068865_100320524 3300006881 Bacteria 1246
52 Ga0068865_100374630 3300006881 Bacteria 1159
53 Ga0097620_100001648 3300006931 Bacteria 22792
54 Ga0105240_10032587 3300009093 Bacteria 6746
55 Ga0105240_10257642 3300009093 Bacteria 2014
56 Ga0105240_10545946 3300009093 Bacteria 1283
57 Ga0105247_10004351 3300009101 Bacteria 9054
58 Ga0105247_10247213 3300009101 Bacteria 1218
59 Ga0105243_10172200 3300009148 Bacteria 1876
60 Ga0105241_10676933 3300009174 Bacteria 939
61 Ga0105242_10035943 3300009176 Bacteria 3972
62 Ga0105248_10125011 3300009177 Bacteria 2902
63 Ga0105248_10130039 3300009177 Bacteria 2840
64 Ga0105248_10725107 3300009177 Bacteria 1122
65 Ga0105237_10650462 3300009545 Bacteria 1061
66 Ga0105249_10016226 3300009553 Bacteria 6605
67 Ga0105249_10031995 3300009553 Bacteria 4758
68 Ga0105249_10054834 3300009553 Unclassified 3645
69 Ga0105239_10409001 3300010375 Bacteria 1536
70 Ga0105239_11352901 3300010375 Bacteria 822
71 Ga0157378_10573156 3300013297 Bacteria 1137
72 Ga0163162_10073075 3300013306 Bacteria 3485
73 Ga0163162_10192115 3300013306 Bacteria 2169
74 Ga0157375_10788500 3300013308 Bacteria 1099
75 Ga0163163_10066503 3300014325 Unclassified 3580
76 Ga0163163_10357333 3300014325 Bacteria 1517
77 Ga0163163_10773417 3300014325 Bacteria 1023
78 Ga0163163_11023954 3300014325 Bacteria 889
79 Ga0157380_10019483 3300014326 Bacteria 5057
80 Ga0157380_10028572 3300014326 Bacteria 4253
81 Ga0157380_10112850 3300014326 Bacteria 2287
82 Ga0157380_10185110 3300014326 Bacteria 1833
83 Ga0157380_10234605 3300014326 Bacteria 1650
84 Ga0157380_10403247 3300014326 Bacteria 1298
85 Ga0157379_10037172 3300014968 Bacteria 4341
86 Ga0157376_11011752 3300014969 Bacteria 854
87 Ga0163161_10453217 3300017792 Unclassified 1037
88 Ga0213876_10187323 3300021384 Bacteria 1101
89 Ga0207682_10043529 3300025893 Unclassified 1838
90 Ga0207710_10003156 3300025900 Bacteria 7382
91 Ga0207645_10221171 3300025907 Unclassified 1248
92 Ga0207643_10190118 3300025908 Bacteria 1246
93 Ga0207654_10158785 3300025911 Bacteria 1459
94 Ga0207695_10029423 3300025913 Bacteria 6068
95 Ga0207695_10168656 3300025913 Bacteria 2116
96 Ga0207695_10390233 3300025913 Bacteria 1277
97 Ga0207671_10285236 3300025914 Bacteria 1303
98 Ga0207671_10305109 3300025914 Unclassified 1258
99 Ga0207652_10125624 3300025921 Bacteria 2284
100 Ga0207681_10124969 3300025923 Unclassified 1893
101 Ga0207664_10069629 3300025929 Bacteria 2829
102 Ga0207644_10354068 3300025931 Bacteria 1193
103 Ga0207669_10024966 3300025937 Bacteria 3221
104 Ga0207669_10075635 3300025937 Bacteria 2134
105 Ga0207669_10305902 3300025937 Unclassified 1210
106 Ga0207704_10150948 3300025938 Bacteria 1639
107 Ga0207691_10004054 3300025940 Bacteria 14203
108 Ga0207691_10007731 3300025940 Bacteria 10347
109 Ga0207689_10014570 3300025942 Bacteria 6685
110 Ga0207689_10319960 3300025942 Unclassified 1287
111 Ga0207679_10682982 3300025945 Unclassified 931
112 Ga0207667_10553100 3300025949 Bacteria 1164
113 Ga0207651_10183451 3300025960 Bacteria 1662
114 Ga0207651_10881782 3300025960 Bacteria 796
115 Ga0207712_10050396 3300025961 Bacteria 2907
116 Ga0207712_10154730 3300025961 Bacteria 1775
117 Ga0207712_10315525 3300025961 Bacteria 1288
118 Ga0207668_10078308 3300025972 Bacteria 2387
119 Ga0207658_10335930 3300025986 Bacteria 1312
120 Ga0207703_10022421 3300026035 Bacteria 4952
121 Ga0207678_10389869 3300026067 Bacteria 1205
122 Ga0207702_10058850 3300026078 Bacteria 3271
123 Ga0207641_10000169 3300026088 Bacteria 91880
124 Ga0207641_10125244 3300026088 Unclassified 2299
125 Ga0207648_10029969 3300026089 Bacteria 4825
126 Ga0207675_100003191 3300026118 Bacteria 16085
127 Ga0207675_100282423 3300026118 Bacteria 1613
128 Ga0207683_10000888 3300026121 Bacteria 27470
129 Ga0207698_10259342 3300026142 Bacteria 1596
130 Ga0268266_10003046 3300028379 Bacteria 17166
131 Ga0268266_10016331 3300028379 Bacteria 6346
132 Ga0268266_10066155 3300028379 Bacteria 3125
133 Ga0268266_10197517 3300028379 Bacteria 1840
134 Ga0268266_10948994 3300028379 Bacteria 832
135 Ga0268265_10348196 3300028380 Bacteria 1352
136 Ga0268264_10000058 3300028381 Bacteria 308956
137 Ga0268264_10000060 3300028381 Bacteria 305056
138 Ga0265334_10000102 3300028573 Bacteria 57530
139 Ga0307511_10002485 3300030521 Bacteria 19263
140 Ga0307513_10033093 3300031456 Bacteria 5817
141 Ga0307513_10084291 3300031456 Unclassified 3265
142 Ga0307513_10410595 3300031456 Bacteria 1086
143 Ga0307509_10000074 3300031507 Bacteria 140111
144 Ga0307408_100256820 3300031548 Bacteria 1444
145 Ga0307408_100728898 3300031548 Unclassified 893
146 Ga0265313_10000485 3300031595 Bacteria 41821
147 Ga0307405_10045098 3300031731 Bacteria 2700
148 Ga0307405_10183193 3300031731 Bacteria 1506
149 Ga0307405_10211668 3300031731 Bacteria 1416
150 Ga0307413_10038431 3300031824 Bacteria 2774
151 Ga0307413_10242112 3300031824 Bacteria 1332
152 Ga0307410_10365756 3300031852 Bacteria 1156
153 Ga0307407_10024483 3300031903 Bacteria 3167
154 Ga0307407_10226559 3300031903 Bacteria 1267
155 Ga0307412_10177400 3300031911 Bacteria 1599
156 Ga0307409_100004387 3300031995 Bacteria 7919
157 Ga0307411_10066370 3300032005 Bacteria 2424
158 Ga0307415_100337482 3300032126 Bacteria 1263
159 Ga0307415_100344412 3300032126 Bacteria 1252
160 Ga0307510_10000006 3300033180 Bacteria 566474
161 Ga0307510_10008069 3300033180 Bacteria 12532
162 Ga0316215_1009330 3300033544 Unclassified 966
163 Ga0373936_0002789 3300035113 Bacteria 6513
164 Ga0373936_0003642 3300035113 Bacteria 5787
165 Ga0373927_0000001 3300035695 Bacteria 1082160
166 Ga0373927_0358712 3300035695 Unclassified 961
167 Ga0436365_0459199 3300039437 Bacteria 3418
168 Ga0436363_1450206 3300039450 Unclassified 878
169 Ga0451791_1801060 3300041451 Bacteria 7675
170 Ga0466961_0062595 3300044693 Bacteria 2364
171 Ga0466964_0000522 3300044706 Bacteria 12001
172 Ga0466971_0004989 3300044719 Bacteria 5742
173 Ga0466970_0010420 3300044765 Bacteria 4721
174 Ga0466957_0015008 3300044842 Bacteria 4519
175 Ga0466960_0151844 3300044901 Bacteria 1238
176 Ga0466959_0017069 3300045049 Bacteria 5314
177 Ga0466959_0086796 3300045049 Bacteria 2251
178 Ga0466958_0058382 3300045836 Bacteria 2346
179 Ga0495590_0014763 3300046457 Bacteria 2848
180 Ga0495638_0002475 3300046460 Bacteria 15041
181 Ga0495606_0136838 3300046507 Bacteria 1450
182 Ga0495616_0280718 3300046513 Bacteria 708
183 Ga0495632_0022819 3300046519 Bacteria 3350
184 Ga0495668_0087055 3300046616 Unclassified 1713
185 Ga0495611_0116943 3300046648 Unclassified 1243
186 Ga0495625_0024507 3300046660 Bacteria 4591
187 Ga0495625_0087138 3300046660 Unclassified 2165
188 Ga0495671_0025433 3300046692 Bacteria 3077
189 Ga0495649_0007540 3300046694 Bacteria 6623
190 Ga0495649_0150093 3300046694 Bacteria 1225
191 Ga0495687_046473 3300047443 Bacteria 1874
192 Ga0495686_0064825 3300047472 Bacteria 2260
193 Ga0495686_0248121 3300047472 Unclassified 1001
194 Ga0495686_0270624 3300047472 Bacteria 948
195 Ga0496100_0431464 3300048903 Bacteria 1008
196 Ga0496102_0002471 3300048905 Bacteria 15774
197 Ga0496102_0005994 3300048905 Bacteria 10352
198 Ga0496103_0124618 3300048906 Bacteria 1642
199 Ga0496106_0305388 3300048909 Bacteria 1276
200 Ga0496109_0860644 3300048912 Bacteria 844
201 Ga0496114_0469732 3300048917 Bacteria 1113
202 Ga0496116_0016854 3300048919 Bacteria 5700
203 Ga0496117_0000090 3300048920 Bacteria 206388
204 Ga0496118_0000032 3300048921 Bacteria 330072
205 Ga0496118_0025494 3300048921 Bacteria 5067
206 Ga0496119_0000356 3300048922 Bacteria 64173
207 Ga0496119_0011980 3300048922 Bacteria 7101
208 Ga0496119_0062719 3300048922 Bacteria 2213
209 Ga0496120_0000226 3300048923 Bacteria 96713
210 Ga0496120_0037764 3300048923 Bacteria 2863
211 Ga0496121_0007448 3300048924 Bacteria 13226
212 Ga0496121_0072642 3300048924 Unclassified 2761
213 Ga0496121_0112632 3300048924 Bacteria 2072
214 Ga0496124_0059495 3300048927 Bacteria 3209
215 Ga0496125_0009134 3300048928 Bacteria 10255
216 Ga0496125_0023111 3300048928 Bacteria 5750
217 Ga0496125_0039770 3300048928 Bacteria 4043
218 Ga0496125_0058691 3300048928 Bacteria 3106
219 Ga0496126_0009427 3300048929 Bacteria 10364
220 Ga0496126_0021138 3300048929 Bacteria 6363
221 Ga0496126_0026282 3300048929 Bacteria 5584
222 Ga0496126_0404587 3300048929 Unclassified 1106
223 Ga0501042_0180877 3300049578 Bacteria 1521
224 Ga0501068_0034099 3300049584 Bacteria 3035
225 Ga0501071_0336150 3300049587 Bacteria 1148
226 Ga0500583_0053557 3300053092 Unclassified 1881
227 Ga0500583_0193151 3300053092 Unclassified 1013
228 Ga0500641_0194547 3300053096 Bacteria 867
229 Ga0500627_0051125 3300053158 Unclassified 1802
230 Ga0500633_0042960 3300053160 Unclassified 1528
231 Ga0500637_0001900 3300053178 Bacteria 9077
232 Ga0500637_0146032 3300053178 Bacteria 1368
233 Ga0500637_0221505 3300053178 Unclassified 1069
234 Ga0466962_0002969 3300061719 Bacteria 8087
235 Ga0495643_0050860
236 rootL2_10278978
237 rootH1_10220776
238 JGI25405J52794_10043734
239 Ga0070677_10005910
240 Ga0068869_100469305
241 Ga0070682_100448744
242 Ga0070689_100110584
243 Ga0070675_100041053
244 Ga0070674_100011895
245 Ga0070673_100010899
246 Ga0070673_100748249
247 Ga0070667_100268407
248 Ga0070700_100199446
249 Ga0070663_100212134
250 Ga0070678_100007553
251 Ga0070681_10102301
252 Ga0070685_10248983
253 Ga0070679_100019485
254 Ga0070672_100009274
255 Ga0070672_100019931
256 Ga0070696_100106987
257 Ga0070665_100004910
258 Ga0070665_100022030
259 Ga0070665_100057123
260 Ga0070665_100165172
261 Ga0070665_100211877
262 Ga0070665_100255969
263 Ga0070665_100733766
264 Ga0068855_100137822
265 Ga0068856_100064258
266 Ga0068859_100001648
267 Ga0068861_100005767
268 Ga0068861_100584623
269 Ga0068870_10198225
270 Ga0068863_100008267
271 Ga0068863_100041123
272 Ga0068863_100062607
273 Ga0068858_100004977
274 Ga0068858_100010534
275 Ga0068860_100000142
276 Ga0068860_100023893
277 Ga0068862_100172649
278 Ga0068862_100410681
279 Ga0068862_100666114
280 Ga0081455_10004270
281 Ga0081455_10006436
282 Ga0081539_10000011
283 Ga0097621_100449455
284 Ga0068871_100136565
285 Ga0068865_100320524
286 Ga0068865_100374630
287 Ga0097620_100001648
288 Ga0105240_10032587
289 Ga0105240_10257642
290 Ga0105240_10545946
291 Ga0105247_10004351
292 Ga0105247_10247213
293 Ga0105243_10172200
294 Ga0105241_10676933
295 Ga0105242_10035943
296 Ga0105248_10125011
297 Ga0105248_10130039
298 Ga0105248_10725107
299 Ga0105237_10650462
300 Ga0105249_10016226
301 Ga0105249_10031995
302 Ga0105249_10054834
303 Ga0105239_10409001
304 Ga0105239_11352901
305 Ga0157378_10573156
306 Ga0163162_10073075
307 Ga0163162_10192115
308 Ga0157375_10788500
309 Ga0163163_10066503
310 Ga0163163_10357333
311 Ga0163163_10773417
312 Ga0163163_11023954
313 Ga0157380_10019483
314 Ga0157380_10028572
315 Ga0157380_10112850
316 Ga0157380_10185110
317 Ga0157380_10234605
318 Ga0157380_10403247
319 Ga0157379_10037172
320 Ga0157376_11011752
321 Ga0163161_10453217
322 Ga0213876_10187323
323 Ga0207682_10043529
324 Ga0207710_10003156
325 Ga0207645_10221171
326 Ga0207643_10190118
327 Ga0207654_10158785
328 Ga0207695_10029423
329 Ga0207695_10168656
330 Ga0207695_10390233
331 Ga0207671_10285236
332 Ga0207671_10305109
333 Ga0207652_10125624
334 Ga0207681_10124969
335 Ga0207664_10069629
336 Ga0207644_10354068
337 Ga0207669_10024966
338 Ga0207669_10075635
339 Ga0207669_10305902
340 Ga0207704_10150948
341 Ga0207691_10004054
342 Ga0207691_10007731
343 Ga0207689_10014570
344 Ga0207689_10319960
345 Ga0207679_10682982
346 Ga0207667_10553100
347 Ga0207651_10183451
348 Ga0207651_10881782
349 Ga0207712_10050396
350 Ga0207712_10154730
351 Ga0207712_10315525
352 Ga0207668_10078308
353 Ga0207658_10335930
354 Ga0207703_10022421
355 Ga0207678_10389869
356 Ga0207702_10058850
357 Ga0207641_10000169
358 Ga0207641_10125244
359 Ga0207648_10029969
360 Ga0207675_100003191
361 Ga0207675_100282423
362 Ga0207683_10000888
363 Ga0207698_10259342
364 Ga0268266_10003046
365 Ga0268266_10016331
366 Ga0268266_10066155
367 Ga0268266_10197517
368 Ga0268266_10948994
369 Ga0268265_10348196
370 Ga0268264_10000058
371 Ga0268264_10000060
372 Ga0265334_10000102
373 Ga0307511_10002485
374 Ga0307513_10033093
375 Ga0307513_10084291
376 Ga0307513_10410595
377 Ga0307509_10000074
378 Ga0307408_100256820
379 Ga0307408_100728898
380 Ga0265313_10000485
381 Ga0307405_10045098
382 Ga0307405_10183193
383 Ga0307405_10211668
384 Ga0307413_10038431
385 Ga0307413_10242112
386 Ga0307410_10365756
387 Ga0307407_10024483
388 Ga0307407_10226559
389 Ga0307412_10177400
390 Ga0307409_100004387
391 Ga0307411_10066370
392 Ga0307415_100337482
393 Ga0307415_100344412
394 Ga0307510_10000006
395 Ga0307510_10008069
396 Ga0316215_1009330
397 Ga0373936_0002789
398 Ga0373936_0003642
399 Ga0373927_0000001
400 Ga0373927_0358712
401 Ga0436365_0459199
402 Ga0436363_1450206
403 Ga0451791_1801060
404 Ga0466961_0062595
405 Ga0466964_0000522
406 Ga0466971_0004989
407 Ga0466970_0010420
408 Ga0466957_0015008
409 Ga0466960_0151844
410 Ga0466959_0017069
411 Ga0466959_0086796
412 Ga0466958_0058382
413 Ga0495590_0014763
414 Ga0495638_0002475
415 Ga0495606_0136838
416 Ga0495616_0280718
417 Ga0495632_0022819
418 Ga0495668_0087055
419 Ga0495611_0116943
420 Ga0495625_0024507
421 Ga0495625_0087138
422 Ga0495671_0025433
423 Ga0495649_0007540
424 Ga0495649_0150093
425 Ga0495687_046473
426 Ga0495686_0064825
427 Ga0495686_0248121
428 Ga0495686_0270624
429 Ga0496100_0431464
430 Ga0496102_0002471
431 Ga0496102_0005994
432 Ga0496103_0124618
433 Ga0496106_0305388
434 Ga0496109_0860644
435 Ga0496114_0469732
436 Ga0496116_0016854
437 Ga0496117_0000090
438 Ga0496118_0000032
439 Ga0496118_0025494
440 Ga0496119_0000356
441 Ga0496119_0011980
442 Ga0496119_0062719
443 Ga0496120_0000226
444 Ga0496120_0037764
445 Ga0496121_0007448
446 Ga0496121_0072642
447 Ga0496121_0112632
448 Ga0496124_0059495
449 Ga0496125_0009134
450 Ga0496125_0023111
451 Ga0496125_0039770
452 Ga0496125_0058691
453 Ga0496126_0009427
454 Ga0496126_0021138
455 Ga0496126_0026282
456 Ga0496126_0404587
457 Ga0501042_0180877
458 Ga0501068_0034099
459 Ga0501071_0336150
460 Ga0500583_0053557
461 Ga0500583_0193151
462 Ga0500641_0194547
463 Ga0500627_0051125
464 Ga0500633_0042960
465 Ga0500637_0001900
466 Ga0500637_0146032
467 Ga0500637_0221505
468 Ga0466962_0002969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

10

200

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.7994 15 187
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.7693 3 191
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.6904 3 191
7qn9-assembly1.cif.gz_E cryo-em structure of human full-length extrasynaptic alpha4beta3delta gaba(a)r in complex with gaba, histamine and nanobody nb25 in a pre-open/closed state 0.5244 112 185
6pxd-assembly1.cif.gz_E cryoem structure of zebra fish alpha-1 glycine receptor, apo state 0.4644 107 191
ID Description Score Start End Superfamily
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8038 16 179 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7266 3 179 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7116 16 179 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6855 3 179 1.10.1760.20
af_Q0DJY3_133_222_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4737 112 186 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A849GJW6-F1-model_v4 deleted 0.9167 38 199
AF-A0A849GJW6-F1-model_v4 deleted 0.9007 38 199
AF-A0A521WD38-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.8848 21 197 GO:0005886
GO:0008654
GO:0043772
AF-A0A800FZJ6-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.8811 76 188 GO:0005886
GO:0008654
GO:0043772
AF-A0A3C1F5S0-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.8796 41 188 GO:0005886
GO:0008654
GO:0043772

Map