F347245

General Info

Members Datasets Scaffolds Average Seq Length
234 173 469 177

Family's Representative Sequence

Representative Sequence 3300031838|Ga0307518_10237989|Ga0307518_102379891
Length 193
Sequence VKVTGVTRPTRLGVAQLLAAVDELADLLIDTVDDGASIGFLAPLGRAAAVDWWRERADGVAAGRLAVWAASIGGRMVGTVSLAFPDKPNSRHRAELVKLMVHRDARGAGLGRRLLTIAEDAAVAAGITLLHLDTETDSPAEHLYRSTGWTRAGMIPDYAASPDGVLRPTTLYYKRVGAGTTAETGAGATARDR

Samples

Sample ID Description Type Environment
1 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
20 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
25 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
28 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
29 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
35 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
40 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
41 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
42 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
43 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
44 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
45 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
46 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
62 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
63 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
64 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
68 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
69 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
70 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
71 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
75 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
76 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
142 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
143 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
146 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
147 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
148 2643221647 Streptomyces sp. Root369 Isolate Unclassified
149 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
150 2643221714 Streptomyces sp. Root264 Isolate Unclassified
151 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
152 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
153 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
154 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
155 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
156 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
157 2867428634 Streptomyces sp. RP5T Isolate Unclassified
158 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
159 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
160 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
161 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
162 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
163 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
164 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
165 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
166 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
167 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
168 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
169 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
170 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
171 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
172 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
173 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.75
Metatranscriptomes 0.85
Isolates 12.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0
Rhizoplane 0
Rhizosphere 80.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307518_10237989 3300031838 Bacteria 1171
2 JGI24738J21930_10026886 3300002075 Bacteria 1180
3 rootH1_10041079 3300003316 Bacteria 2974
4 rootH1_10041079 3300003323 Bacteria 7321
5 rootL2_10147226 3300003322 Bacteria 1555
6 Ga0006562J51391_1179586 3300003578 Bacteria 3580
7 Ga0006562J51391_1179587 3300003578 Bacteria 2840
8 Ga0070682_100662922 3300005337 Bacteria 832
9 Ga0070698_101328853 3300005471 Bacteria 669
10 Ga0068856_100291846 3300005614 Bacteria 1648
11 Ga0081455_10251979 3300005937 Bacteria 1291
12 Ga0075368_10018963 3300006042 Bacteria 2592
13 Ga0075367_10000715 3300006178 Bacteria 12829
14 Ga0075370_10060204 3300006353 Bacteria 2163
15 Ga0075431_100009850 3300006847 Bacteria 9594
16 Ga0075434_100514803 3300006871 Bacteria 1217
17 Ga0075429_100001076 3300006880 Bacteria 21896
18 Ga0114129_10416459 3300009147 Bacteria 1768
19 Ga0163163_10101115 3300014325 Bacteria 2905
20 Ga0182008_10001889 3300014497 Bacteria 13607
21 Ga0182007_10001956 3300015262 Bacteria 10656
22 Ga0183367_1001 3300015688 Bacteria 1225545
23 Ga0207647_10007097 3300025904 Bacteria 8125
24 Ga0207702_10048006 3300026078 Bacteria 3599
25 Ga0207676_10229721 3300026095 Bacteria 1658
26 Ga0209813_10028965 3300027866 Bacteria 1618
27 Ga0307517_10025660 3300028786 Bacteria 7194
28 Ga0307515_10000287 3300028794 Bacteria 123976
29 Ga0307511_10001720 3300030521 Bacteria 23047
30 Ga0307511_10032714 3300030521 Bacteria 4612
31 Ga0307511_10299589 3300030521 Bacteria 727
32 Ga0307512_10005793 3300030522 Bacteria 12730
33 Ga0307513_10175888 3300031456 Bacteria 2011
34 Ga0307509_10025474 3300031507 Bacteria 6604
35 Ga0307509_10050413 3300031507 Bacteria 4457
36 Ga0307508_10005031 3300031616 Bacteria 12704
37 Ga0307508_10022244 3300031616 Bacteria 5761
38 Ga0307508_10291897 3300031616 Bacteria 1224
39 Ga0307514_10005489 3300031649 Bacteria 11272
40 Ga0307516_10035339 3300031730 Bacteria 5015
41 Ga0307518_10125553 3300031838 Bacteria 1810
42 Ga0307507_10010287 3300033179 Bacteria 12137
43 Ga0307510_10000644 3300033180 Bacteria 35417
44 Ga0307510_10075544 3300033180 Bacteria 3321
45 Ga0395900_0061911 3300037418 Bacteria 3847
46 Ga0395898_0004150 3300037466 Bacteria 15886
47 Ga0395905_0419409 3300037471 Bacteria 1234
48 Ga0439439_0009972 3300041406 Bacteria 2266
49 Ga0439442_061150 3300042002 Bacteria 798
50 Ga0439449_0000174 3300042007 Bacteria 22298
51 Ga0439449_0089838 3300042007 Bacteria 1134
52 Ga0439455_0007367 3300042012 Bacteria 2324
53 Ga0450899_016701 3300042135 Bacteria 842
54 Ga0450903_001245 3300042138 Bacteria 4785
55 Ga0439458_0004092 3300042157 Bacteria 3365
56 Ga0439458_0023136 3300042157 Bacteria 1447
57 Ga0439458_0069097 3300042157 Bacteria 890
58 Ga0466972_0002259 3300044658 Bacteria 9474
59 Ga0466972_0020845 3300044658 Bacteria 3272
60 Ga0466972_0038397 3300044658 Bacteria 2339
61 Ga0466965_0014317 3300044683 Bacteria 3752
62 Ga0466965_0053623 3300044683 Bacteria 2004
63 Ga0466966_0000327 3300044684 Bacteria 30788
64 Ga0466966_0047398 3300044684 Bacteria 2740
65 Ga0466966_0322003 3300044684 Bacteria 929
66 Ga0466961_0023413 3300044693 Bacteria 3974
67 Ga0466961_0025223 3300044693 Bacteria 3823
68 Ga0466963_0024735 3300044694 Bacteria 3823
69 Ga0466964_0001693 3300044706 Bacteria 7614
70 Ga0466971_0001961 3300044719 Bacteria 8713
71 Ga0466971_0133055 3300044719 Bacteria 1155
72 Ga0466970_0000256 3300044765 Bacteria 26142
73 Ga0466957_0000688 3300044842 Bacteria 17260
74 Ga0466960_0124035 3300044901 Bacteria 1356
75 Ga0466959_0002567 3300045049 Bacteria 11660
76 Ga0466959_0207136 3300045049 Bacteria 1364
77 Ga0466958_0017730 3300045836 Bacteria 4122
78 Ga0466967_0002276 3300045976 Bacteria 11846
79 Ga0466967_0075530 3300045976 Bacteria 3029
80 Ga0495617_044029 3300046452 Bacteria 1490
81 Ga0495592_0013138 3300046454 Bacteria 6302
82 Ga0495592_0017645 3300046454 Bacteria 5424
83 Ga0495629_0003393 3300046459 Bacteria 12051
84 Ga0495629_0038505 3300046459 Bacteria 3367
85 Ga0495629_0177010 3300046459 Bacteria 1479
86 Ga0495638_0040889 3300046460 Bacteria 2936
87 Ga0495651_0367049 3300046462 Bacteria 947
88 Ga0495605_0017988 3300046474 Bacteria 3796
89 Ga0495662_0000436 3300046476 Bacteria 18733
90 Ga0495662_0007753 3300046476 Bacteria 5287
91 Ga0495662_0050585 3300046476 Bacteria 2006
92 Ga0495664_0013903 3300046477 Bacteria 4562
93 Ga0495584_0090183 3300046491 Bacteria 1546
94 Ga0495585_0173412 3300046492 Bacteria 1112
95 Ga0495596_0027651 3300046500 Bacteria 2279
96 Ga0495607_0035287 3300046501 Bacteria 3026
97 Ga0495583_0021096 3300046506 Bacteria 3356
98 Ga0495583_0037944 3300046506 Bacteria 2280
99 Ga0495606_0004135 3300046507 Bacteria 14728
100 Ga0495608_0055706 3300046511 Bacteria 2613
101 Ga0495616_0020462 3300046513 Bacteria 3598
102 Ga0495618_0065055 3300046514 Bacteria 2317
103 Ga0495620_0007810 3300046515 Bacteria 5778
104 Ga0495620_0009126 3300046515 Bacteria 5289
105 Ga0495628_0077033 3300046516 Bacteria 2594
106 Ga0495628_0106709 3300046516 Bacteria 2157
107 Ga0495630_0040056 3300046517 Bacteria 3501
108 Ga0495631_0007379 3300046518 Bacteria 5593
109 Ga0495643_0026370 3300046522 Bacteria 3279
110 Ga0495643_0087789 3300046522 Bacteria 1609
111 Ga0495648_0033968 3300046524 Bacteria 3326
112 Ga0495648_0084906 3300046524 Bacteria 1790
113 Ga0495666_0061360 3300046526 Bacteria 1796
114 Ga0495652_0018717 3300046529 Bacteria 6173
115 Ga0495652_0080502 3300046529 Bacteria 2690
116 Ga0495640_0003158 3300046533 Bacteria 13271
117 Ga0495597_0012994 3300046542 Bacteria 3998
118 Ga0495597_0044704 3300046542 Bacteria 1968
119 Ga0495645_0287299 3300046543 Bacteria 1079
120 Ga0495622_0010819 3300046557 Bacteria 4210
121 Ga0495622_0021305 3300046557 Bacteria 3018
122 Ga0495633_0027932 3300046558 Bacteria 2752
123 Ga0495667_0098923 3300046559 Bacteria 1889
124 Ga0495668_0015100 3300046616 Bacteria 4516
125 Ga0495668_0115424 3300046616 Bacteria 1468
126 Ga0495634_0005624 3300046642 Bacteria 9602
127 Ga0495634_0038879 3300046642 Bacteria 3242
128 Ga0495611_0124030 3300046648 Bacteria 1204
129 Ga0495625_0032670 3300046660 Bacteria 3856
130 Ga0495625_0159962 3300046660 Bacteria 1509
131 Ga0495635_0018440 3300046663 Bacteria 4869
132 Ga0495635_0117663 3300046663 Bacteria 1813
133 Ga0495657_0087726 3300046675 Bacteria 2001
134 Ga0495657_0167087 3300046675 Bacteria 1357
135 Ga0495623_0022430 3300046679 Bacteria 4079
136 Ga0495646_0063637 3300046680 Bacteria 2189
137 Ga0495658_0052201 3300046683 Bacteria 2318
138 Ga0495613_0006178 3300046689 Bacteria 8964
139 Ga0495613_0062769 3300046689 Bacteria 2718
140 Ga0495613_0095344 3300046689 Bacteria 2152
141 Ga0495613_0161356 3300046689 Bacteria 1594
142 Ga0495624_0101826 3300046690 Bacteria 1768
143 Ga0495624_0151183 3300046690 Bacteria 1420
144 Ga0495671_0053925 3300046692 Bacteria 1994
145 Ga0495649_0084044 3300046694 Bacteria 1700
146 Ga0495589_0013015 3300046794 Bacteria 4298
147 Ga0495589_0039119 3300046794 Bacteria 2371
148 Ga0495600_0060286 3300046809 Bacteria 2478
149 Ga0495660_0027588 3300046810 Bacteria 3212
150 Ga0495660_0179701 3300046810 Bacteria 1024
151 Ga0495581_0017922 3300047315 Bacteria 4115
152 Ga0495604_0109207 3300047317 Bacteria 2019
153 Ga0495604_0161759 3300047317 Bacteria 1581
154 Ga0495636_0005480 3300047318 Bacteria 4986
155 Ga0495636_0167504 3300047318 Bacteria 992
156 Ga0495674_0171526 3300047319 Bacteria 1810
157 Ga0495676_0016397 3300047321 Bacteria 6579
158 Ga0495676_0058700 3300047321 Bacteria 3025
159 Ga0495676_0175591 3300047321 Bacteria 1504
160 Ga0495680_0010272 3300047322 Bacteria 8351
161 Ga0495687_000743 3300047443 Bacteria 35403
162 Ga0495687_068618 3300047443 Bacteria 1430
163 Ga0495687_075562 3300047443 Bacteria 1336
164 Ga0495675_0032648 3300047444 Bacteria 3322
165 Ga0495675_0085514 3300047444 Bacteria 1983
166 Ga0495677_0149561 3300047445 Bacteria 899
167 Ga0495685_006111 3300047447 Bacteria 3940
168 Ga0495685_014557 3300047447 Bacteria 2674
169 Ga0495685_015704 3300047447 Bacteria 2585
170 Ga0495685_117387 3300047447 Bacteria 874
171 Ga0495681_0013419 3300047470 Bacteria 4751
172 Ga0495686_0040535 3300047472 Bacteria 2969
173 Ga0495593_0022348 3300047673 Bacteria 3525
174 Ga0495593_0074325 3300047673 Bacteria 1762
175 Ga0495602_0099019 3300048088 Bacteria 2398
176 Ga0495602_0318524 3300048088 Bacteria 1132
177 Ga0495614_0027732 3300048089 Bacteria 2441
178 Ga0495614_0143956 3300048089 Bacteria 1060
179 Ga0495614_0155412 3300048089 Bacteria 1021
180 Ga0495614_0203060 3300048089 Bacteria 897
181 Ga0495626_0246541 3300048091 Bacteria 718
182 Ga0501031_0039905 3300049568 Bacteria 3065
183 Ga0501032_0138984 3300049569 Bacteria 1600
184 Ga0501034_0186223 3300049571 Bacteria 2039
185 Ga0501036_0023785 3300049572 Bacteria 5162
186 Ga0501038_0003320 3300049574 Bacteria 15008
187 Ga0501043_0272842 3300049579 Bacteria 1298
188 Ga0501047_0030953 3300049581 Bacteria 5159
189 Ga0501047_0047473 3300049581 Bacteria 4148
190 Ga0501048_0092741 3300049582 Bacteria 2130
191 Ga0501070_0173819 3300049586 Bacteria 1774
192 Ga0501080_0105187 3300049742 Bacteria 2617
193 Ga0501035_0341553 3300049822 Bacteria 1254
194 nmdc:mga06z11_27227_c1 3300050494 Bacteria 2732
195 nmdc:mga04h51_34416_c1 3300050495 Bacteria 1618
196 nmdc:mga07m45_229328_c1 3300050496 Bacteria 1080
197 nmdc:mga05p37_340708_c1 3300050507 Bacteria 1768
198 nmdc:mga09592_4475_c1 3300050508 Bacteria 11301
199 nmdc:mga06r32_21780_c1 3300050510 Bacteria 5917
200 nmdc:mga0a205_1250003_c1 3300050515 Bacteria 590
201 Ga0500644_0007420 3300053088 Bacteria 2855
202 Ga0500583_0081989 3300053092 Bacteria 1559
203 Ga0500573_0018878 3300053140 Bacteria 3939
204 Ga0500624_002767 3300053157 Bacteria 2333
205 Ga0466962_0000069 3300061719 Bacteria 42565
206 Ga0466962_0027155 3300061719 Bacteria 2748
207 2585304107 2582581313 Bacteria 10042643
208 2585312099 2582581314 Bacteria 11452267
209 2616698937 2616644814 Bacteria 11555299
210 2644263872 2643221647 Bacteria 10741251
211 2644440951 2643221678 Bacteria 9540101
212 2644632515 2643221714 Bacteria 9015452
213 2785339757 2784746763 Bacteria 9783172
214 2785373189 2784746768 Bacteria 10036182
215 2786674814 2786546132 Bacteria 10419719
216 2808845326 2808606359 Bacteria 9866990
217 2808915031 2808606375 Bacteria 9466072
218 2862283041 2862281513 Bacteria 9621493
219 2867436382 2867428634 Bacteria 9590268
220 2877677712 2877676314 Bacteria 9512378
221 2912716003 2912715099 Bacteria 9460473
222 2919475171 2919468124 Bacteria 9133025
223 2954382488 2954380949 Bacteria 10050426
224 2954680588 2954673503 Bacteria 9685905
225 2954683565 2954682443 Bacteria 9862841
226 2954693289 2954691527 Bacteria 10720516
227 2954708382 2954701450 Bacteria 10834262
228 2954712964 2954711539 Bacteria 10867210
229 2954722923 2954721474 Bacteria 10456478
230 2954738907 2954731030 Bacteria 10243860
231 2954741833 2954740390 Bacteria 10229294
232 2954757764 2954749733 Bacteria 10366972
233 2954760812 2954759201 Bacteria 9358192
234 2990063373 2990059506 Bacteria 9321252
235 8048411908 8048406513 Bacteria 8936924
236 Ga0307518_10237989
237 JGI24738J21930_10026886
238 rootH1_10041079
239 rootL2_10147226
240 Ga0006562J51391_1179586
241 Ga0006562J51391_1179587
242 Ga0070682_100662922
243 Ga0070698_101328853
244 Ga0068856_100291846
245 Ga0081455_10251979
246 Ga0075368_10018963
247 Ga0075367_10000715
248 Ga0075370_10060204
249 Ga0075431_100009850
250 Ga0075434_100514803
251 Ga0075429_100001076
252 Ga0114129_10416459
253 Ga0163163_10101115
254 Ga0182008_10001889
255 Ga0182007_10001956
256 Ga0183367_1001
257 Ga0207647_10007097
258 Ga0207702_10048006
259 Ga0207676_10229721
260 Ga0209813_10028965
261 Ga0307517_10025660
262 Ga0307515_10000287
263 Ga0307511_10001720
264 Ga0307511_10032714
265 Ga0307511_10299589
266 Ga0307512_10005793
267 Ga0307513_10175888
268 Ga0307509_10025474
269 Ga0307509_10050413
270 Ga0307508_10005031
271 Ga0307508_10022244
272 Ga0307508_10291897
273 Ga0307514_10005489
274 Ga0307516_10035339
275 Ga0307518_10125553
276 Ga0307507_10010287
277 Ga0307510_10000644
278 Ga0307510_10075544
279 Ga0395900_0061911
280 Ga0395898_0004150
281 Ga0395905_0419409
282 Ga0439439_0009972
283 Ga0439442_061150
284 Ga0439449_0000174
285 Ga0439449_0089838
286 Ga0439455_0007367
287 Ga0450899_016701
288 Ga0450903_001245
289 Ga0439458_0004092
290 Ga0439458_0023136
291 Ga0439458_0069097
292 Ga0466972_0002259
293 Ga0466972_0020845
294 Ga0466972_0038397
295 Ga0466965_0014317
296 Ga0466965_0053623
297 Ga0466966_0000327
298 Ga0466966_0047398
299 Ga0466966_0322003
300 Ga0466961_0023413
301 Ga0466961_0025223
302 Ga0466963_0024735
303 Ga0466964_0001693
304 Ga0466971_0001961
305 Ga0466971_0133055
306 Ga0466970_0000256
307 Ga0466957_0000688
308 Ga0466960_0124035
309 Ga0466959_0002567
310 Ga0466959_0207136
311 Ga0466958_0017730
312 Ga0466967_0002276
313 Ga0466967_0075530
314 Ga0495617_044029
315 Ga0495592_0013138
316 Ga0495592_0017645
317 Ga0495629_0003393
318 Ga0495629_0038505
319 Ga0495629_0177010
320 Ga0495638_0040889
321 Ga0495651_0367049
322 Ga0495605_0017988
323 Ga0495662_0000436
324 Ga0495662_0007753
325 Ga0495662_0050585
326 Ga0495664_0013903
327 Ga0495584_0090183
328 Ga0495585_0173412
329 Ga0495596_0027651
330 Ga0495607_0035287
331 Ga0495583_0021096
332 Ga0495583_0037944
333 Ga0495606_0004135
334 Ga0495608_0055706
335 Ga0495616_0020462
336 Ga0495618_0065055
337 Ga0495620_0007810
338 Ga0495620_0009126
339 Ga0495628_0077033
340 Ga0495628_0106709
341 Ga0495630_0040056
342 Ga0495631_0007379
343 Ga0495643_0026370
344 Ga0495643_0087789
345 Ga0495648_0033968
346 Ga0495648_0084906
347 Ga0495666_0061360
348 Ga0495652_0018717
349 Ga0495652_0080502
350 Ga0495640_0003158
351 Ga0495597_0012994
352 Ga0495597_0044704
353 Ga0495645_0287299
354 Ga0495622_0010819
355 Ga0495622_0021305
356 Ga0495633_0027932
357 Ga0495667_0098923
358 Ga0495668_0015100
359 Ga0495668_0115424
360 Ga0495634_0005624
361 Ga0495634_0038879
362 Ga0495611_0124030
363 Ga0495625_0032670
364 Ga0495625_0159962
365 Ga0495635_0018440
366 Ga0495635_0117663
367 Ga0495657_0087726
368 Ga0495657_0167087
369 Ga0495623_0022430
370 Ga0495646_0063637
371 Ga0495658_0052201
372 Ga0495613_0006178
373 Ga0495613_0062769
374 Ga0495613_0095344
375 Ga0495613_0161356
376 Ga0495624_0101826
377 Ga0495624_0151183
378 Ga0495671_0053925
379 Ga0495649_0084044
380 Ga0495589_0013015
381 Ga0495589_0039119
382 Ga0495600_0060286
383 Ga0495660_0027588
384 Ga0495660_0179701
385 Ga0495581_0017922
386 Ga0495604_0109207
387 Ga0495604_0161759
388 Ga0495636_0005480
389 Ga0495636_0167504
390 Ga0495674_0171526
391 Ga0495676_0016397
392 Ga0495676_0058700
393 Ga0495676_0175591
394 Ga0495680_0010272
395 Ga0495687_000743
396 Ga0495687_068618
397 Ga0495687_075562
398 Ga0495675_0032648
399 Ga0495675_0085514
400 Ga0495677_0149561
401 Ga0495685_006111
402 Ga0495685_014557
403 Ga0495685_015704
404 Ga0495685_117387
405 Ga0495681_0013419
406 Ga0495686_0040535
407 Ga0495593_0022348
408 Ga0495593_0074325
409 Ga0495602_0099019
410 Ga0495602_0318524
411 Ga0495614_0027732
412 Ga0495614_0143956
413 Ga0495614_0155412
414 Ga0495614_0203060
415 Ga0495626_0246541
416 Ga0501031_0039905
417 Ga0501032_0138984
418 Ga0501034_0186223
419 Ga0501036_0023785
420 Ga0501038_0003320
421 Ga0501043_0272842
422 Ga0501047_0030953
423 Ga0501047_0047473
424 Ga0501048_0092741
425 Ga0501070_0173819
426 Ga0501080_0105187
427 Ga0501035_0341553
428 nmdc:mga06z11_27227_c1
429 nmdc:mga04h51_34416_c1
430 nmdc:mga07m45_229328_c1
431 nmdc:mga05p37_340708_c1
432 nmdc:mga09592_4475_c1
433 nmdc:mga06r32_21780_c1
434 nmdc:mga0a205_1250003_c1
435 Ga0500644_0007420
436 Ga0500583_0081989
437 Ga0500573_0018878
438 Ga0500624_002767
439 Ga0466962_0000069
440 Ga0466962_0027155
441 2585304107
442 2585312099
443 2616698937
444 2644263872
445 2644440951
446 2644632515
447 2785339757
448 2785373189
449 2786674814
450 2808845326
451 2808915031
452 2862283041
453 2867436382
454 2877677712
455 2912716003
456 2919475171
457 2954382488
458 2954680588
459 2954683565
460 2954693289
461 2954708382
462 2954712964
463 2954722923
464 2954738907
465 2954741833
466 2954757764
467 2954760812
468 2990063373
469 8048411908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

47

155

0.87

PF08445

FR47

FR47-like protein

89

154

0.86

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

29

149

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

63

151

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.9779 1 170
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.9723 1 170
1y9w-assembly1.cif.gz_B structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579 0.8934 59 170
2vi7-assembly2.cif.gz_C structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa 0.8686 2 169
2q4v-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of thialysine n-acetyltransferase (ssat2) from homo sapiens 0.866 58 142
ID Description Score Start End Superfamily
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9713 1 170 3.40.630.30
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9656 1 170 3.40.630.30
af_Q54KJ9_7_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9597 13 169 3.40.630.30
af_Q54KJ7_19_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9266 15 170 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9168 58 171 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1Z1WNA3-F1-model_v4 N-acetyltransferase domain-containing protein 0.9894 3 170 GO:0016747
AF-A0A371BAP2-F1-model_v4 N-acetyltransferase 0.989 2 169 GO:0016747
AF-A0A3S0KPY2-F1-model_v4 GNAT family N-acetyltransferase 0.9884 19 170 GO:0016747
AF-A0A076MSX5-F1-model_v4 Acetyltransferase 0.9857 2 170 GO:0016747
AF-A0A2P9EY24-F1-model_v4 Acetyltransferase (EC 2.3.1.-) 0.9839 2 170 GO:0016747

Map