F347230

General Info

Members Datasets Scaffolds Average Seq Length
234 174 468 75

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10001177|Ga0265331_100011772
Length 87
Sequence MVGNRQIGYSSAMGTLLSRITVRPEQCHGQPCIRGMRIRVSDILEMLANGIAEDEILRDFPDLEPDDIRASLAYAANLAGHPVIAAE

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
112 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
113 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
172 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 2.56
Rhizosphere 92.74
Stem 0
Stem Tuber 0
Unclassified 29.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10001177 3300031250 Bacteria 19917
2 MBSR1b_contig_9463684 2162886012 Bacteria 870
3 Ga0065707_10130170 3300005295 Bacteria 1931
4 Ga0070658_11963740 3300005327 Bacteria 505
5 Ga0070683_100271582 3300005329 Bacteria 1613
6 Ga0070670_100267629 3300005331 Bacteria 1491
7 Ga0068869_100018123 3300005334 Bacteria 4788
8 Ga0070680_100451240 3300005336 Unclassified 1098
9 Ga0070687_100109296 3300005343 Unclassified 1562
10 Ga0070687_100447467 3300005343 Unclassified 858
11 Ga0070692_10212285 3300005345 Bacteria 1139
12 Ga0070668_100431792 3300005347 Bacteria 1129
13 Ga0070669_100536184 3300005353 Bacteria 974
14 Ga0070669_100602465 3300005353 Unclassified 920
15 Ga0070675_100234453 3300005354 Bacteria 1602
16 Ga0070675_102044179 3300005354 Bacteria 528
17 Ga0070671_100312025 3300005355 Bacteria 1340
18 Ga0070711_100605288 3300005439 Bacteria 915
19 Ga0070694_100487547 3300005444 Unclassified 979
20 Ga0070708_100920073 3300005445 Unclassified 821
21 Ga0070662_101551396 3300005457 Unclassified 571
22 Ga0070681_11138139 3300005458 Unclassified 702
23 Ga0068867_100347665 3300005459 Bacteria 1236
24 Ga0070706_100407086 3300005467 Bacteria 1266
25 Ga0070707_100915096 3300005468 Unclassified 842
26 Ga0070698_100199789 3300005471 Bacteria 1935
27 Ga0070679_100309316 3300005530 Bacteria 1530
28 Ga0070679_100672151 3300005530 Bacteria 978
29 Ga0070684_100805449 3300005535 Bacteria 878
30 Ga0070697_100754826 3300005536 Unclassified 860
31 Ga0070672_100000176 3300005543 Bacteria 35571
32 Ga0070672_100931053 3300005543 Bacteria 768
33 Ga0070672_101914010 3300005543 Unclassified 534
34 Ga0070686_100302836 3300005544 Bacteria 1186
35 Ga0070686_101363322 3300005544 Bacteria 594
36 Ga0070695_100228900 3300005545 Bacteria 1343
37 Ga0070695_100357022 3300005545 Archaea 1096
38 Ga0070696_100322769 3300005546 Unclassified 1189
39 Ga0070693_100001288 3300005547 Bacteria 11329
40 Ga0070693_100040647 3300005547 Bacteria 2612
41 Ga0070693_100603137 3300005547 Bacteria 793
42 Ga0070693_101323904 3300005547 Unclassified 557
43 Ga0070665_100000365 3300005548 Bacteria 67635
44 Ga0070704_101394903 3300005549 Unclassified 643
45 Ga0070664_100078453 3300005564 Bacteria 2841
46 Ga0068857_101466525 3300005577 Unclassified 664
47 Ga0068857_101863006 3300005577 Unclassified 589
48 Ga0068854_101747535 3300005578 Bacteria 569
49 Ga0068852_100305973 3300005616 Unclassified 1540
50 Ga0068864_100387813 3300005618 Bacteria 1325
51 Ga0068864_102029433 3300005618 Unclassified 581
52 Ga0068861_100249481 3300005719 Bacteria 1514
53 Ga0068861_100633136 3300005719 Unclassified 986
54 Ga0068861_101692699 3300005719 Unclassified 625
55 Ga0068861_102279661 3300005719 Unclassified 543
56 Ga0068870_10016258 3300005840 Bacteria 3551
57 Ga0068860_100333612 3300005843 Bacteria 1490
58 Ga0081538_10136262 3300005981 Bacteria 1142
59 Ga0081539_10050891 3300005985 Bacteria 2340
60 Ga0070715_10751414 3300006163 Unclassified 587
61 Ga0070716_100070163 3300006173 Unclassified 2056
62 Ga0075366_10916031 3300006195 Bacteria 546
63 Ga0075433_10263215 3300006852 Bacteria 1529
64 Ga0075434_100205955 3300006871 Bacteria 1987
65 Ga0075434_100242003 3300006871 Bacteria 1824
66 Ga0075434_100243452 3300006871 Bacteria 1818
67 Ga0075434_100593519 3300006871 Bacteria 1127
68 Ga0075436_100006707 3300006914 Bacteria 7882
69 Ga0075436_100219027 3300006914 Unclassified 1350
70 Ga0075436_101166675 3300006914 Unclassified 581
71 Ga0075435_100006691 3300007076 Bacteria 8175
72 Ga0075435_100254593 3300007076 Bacteria 1495
73 Ga0075435_100257211 3300007076 Bacteria 1487
74 Ga0075435_100387293 3300007076 Bacteria 1201
75 Ga0099794_10024544 3300007265 Unclassified 2769
76 Ga0099794_10032946 3300007265 Unclassified 2434
77 Ga0114129_10707824 3300009147 Unclassified 1294
78 Ga0114129_10726895 3300009147 Bacteria 1273
79 Ga0114129_11566584 3300009147 Bacteria 808
80 Ga0105243_12657192 3300009148 Bacteria 541
81 Ga0105248_10152469 3300009177 Bacteria 2608
82 Ga0105238_10000118 3300009551 Bacteria 86809
83 Ga0105249_10603514 3300009553 Bacteria 1152
84 Ga0105246_11241746 3300011119 Unclassified 688
85 Ga0157370_10063247 3300013104 Bacteria 3507
86 Ga0157370_11700514 3300013104 Unclassified 566
87 Ga0157369_10100088 3300013105 Bacteria 3090
88 Ga0157378_10828874 3300013297 Bacteria 952
89 Ga0157372_12798840 3300013307 Unclassified 559
90 Ga0157375_11815385 3300013308 Unclassified 723
91 Ga0157377_10199922 3300014745 Unclassified 1268
92 Ga0207699_11127021 3300025906 Unclassified 581
93 Ga0207643_10145813 3300025908 Unclassified 1416
94 Ga0207684_10071308 3300025910 Bacteria 2952
95 Ga0207707_11662824 3300025912 Unclassified 501
96 Ga0207660_10271905 3300025917 Unclassified 1343
97 Ga0207660_11069979 3300025917 Bacteria 657
98 Ga0207662_10390416 3300025918 Bacteria 942
99 Ga0207657_10283045 3300025919 Bacteria 1316
100 Ga0207649_11542352 3300025920 Unclassified 526
101 Ga0207681_10000039 3300025923 Bacteria 153082
102 Ga0207681_10506654 3300025923 Unclassified 989
103 Ga0207681_10892021 3300025923 Bacteria 744
104 Ga0207694_10000001 3300025924 Bacteria 4078485
105 Ga0207694_10000042 3300025924 Bacteria 177961
106 Ga0207650_10415273 3300025925 Bacteria 1116
107 Ga0207659_10000005 3300025926 Bacteria 405839
108 Ga0207644_11161029 3300025931 Bacteria 649
109 Ga0207711_11242509 3300025941 Bacteria 687
110 Ga0207689_10054383 3300025942 Bacteria 3296
111 Ga0207689_10117089 3300025942 Bacteria 2191
112 Ga0207661_10388575 3300025944 Bacteria 1264
113 Ga0207679_10980437 3300025945 Bacteria 774
114 Ga0207667_10177781 3300025949 Bacteria 2186
115 Ga0207712_10778080 3300025961 Unclassified 840
116 Ga0207712_11392247 3300025961 Bacteria 627
117 Ga0207712_11883764 3300025961 Archaea 536
118 Ga0207668_11275569 3300025972 Unclassified 661
119 Ga0207640_12182144 3300025981 Bacteria 503
120 Ga0207703_12019212 3300026035 Bacteria 553
121 Ga0207648_10170521 3300026089 Bacteria 1923
122 Ga0207675_100293146 3300026118 Unclassified 1583
123 Ga0207675_100348199 3300026118 Bacteria 1451
124 Ga0207675_100948171 3300026118 Bacteria 878
125 Ga0209588_1053184 3300027671 Unclassified 1310
126 Ga0209588_1086085 3300027671 Unclassified 1014
127 Ga0268266_10000252 3300028379 Bacteria 90702
128 Ga0268264_12089065 3300028381 Unclassified 575
129 Ga0265340_10006586 3300031247 Bacteria 6380
130 Ga0265327_10000176 3300031251 Bacteria 137002
131 Ga0265327_10040947 3300031251 Bacteria 2501
132 Ga0265316_10311744 3300031344 Unclassified 1144
133 Ga0265316_10748650 3300031344 Bacteria 687
134 Ga0307408_100331888 3300031548 Bacteria 1285
135 Ga0307408_100948131 3300031548 Bacteria 790
136 Ga0307410_11392867 3300031852 Bacteria 615
137 Ga0307406_11138405 3300031901 Bacteria 675
138 Ga0307409_100028746 3300031995 Bacteria 3967
139 Ga0307409_100798724 3300031995 Unclassified 951
140 Ga0307409_102022903 3300031995 Bacteria 606
141 Ga0307416_100058985 3300032002 Bacteria 3116
142 Ga0307416_100712816 3300032002 Bacteria 1093
143 Ga0307416_102645176 3300032002 Unclassified 599
144 Ga0307415_101058247 3300032126 Unclassified 757
145 Ga0373959_0000362 3300034820 Bacteria 9082
146 Ga0373926_0237436 3300035083 Bacteria 705
147 Ga0373929_0185849 3300035085 Bacteria 575
148 Ga0373935_0004434 3300035692 Bacteria 8242
149 Ga0373947_0198165 3300035725 Bacteria 1313
150 Ga0395905_0004964 3300037471 Bacteria 13707
151 Ga0395901_1457253 3300038443 Unclassified 642
152 Ga0436365_0039243 3300039437 Bacteria 1420
153 Ga0436365_0833271 3300039437 Bacteria 5528
154 Ga0436365_0970387 3300039437 Bacteria 322356
155 Ga0436360_0658305 3300039438 Unclassified 719
156 Ga0436363_0209853 3300039450 Bacteria 2333
157 Ga0436363_1011204 3300039450 Unclassified 1083
158 Ga0439465_0000444 3300041413 Bacteria 12123
159 Ga0451797_0153439 3300041453 Unclassified 872
160 Ga0451797_0537382 3300041453 Bacteria 521
161 Ga0451804_1047380 3300041463 Unclassified 566
162 Ga0451843_1431268 3300041509 Bacteria 715
163 Ga0451853_0788804 3300041512 Bacteria 639
164 Ga0439442_003676 3300042002 Bacteria 3037
165 Ga0439445_0069693 3300042004 Bacteria 971
166 Ga0439432_000715 3300042006 Bacteria 12443
167 Ga0439462_0000121 3300042015 Bacteria 12178
168 Ga0439446_0150629 3300042156 Bacteria 765
169 Ga0451577_0992132 3300042876 Unclassified 754
170 Ga0466963_0020558 3300044694 Bacteria 4151
171 Ga0453684_0006157 3300044712 Bacteria 23076
172 Ga0453684_0910732 3300044712 Bacteria 941
173 Ga0451576_0145738 3300045051 Unclassified 2469
174 Ga0466967_2047268 3300045976 Unclassified 569
175 Ga0495580_0162374 3300046472 Bacteria 1546
176 Ga0495594_0138350 3300046499 Unclassified 1380
177 Ga0495583_0030851 3300046506 Unclassified 2605
178 Ga0495665_0272224 3300046531 Bacteria 869
179 Ga0495586_0542357 3300046535 Bacteria 671
180 Ga0495587_0095605 3300046536 Bacteria 1714
181 Ga0495622_0092545 3300046557 Bacteria 1388
182 Ga0495588_0203969 3300046674 Bacteria 1044
183 Ga0495623_0459769 3300046679 Unclassified 676
184 Ga0495646_0090968 3300046680 Bacteria 1762
185 Ga0495600_0285666 3300046809 Bacteria 1043
186 Ga0495581_0040485 3300047315 Bacteria 2696
187 Ga0495604_0707081 3300047317 Bacteria 639
188 Ga0495636_0084656 3300047318 Bacteria 1369
189 Ga0495675_0537739 3300047444 Bacteria 667
190 Ga0495593_0022737 3300047673 Bacteria 3488
191 Ga0495602_0644123 3300048088 Bacteria 724
192 Ga0495614_0501384 3300048089 Unclassified 578
193 Ga0496102_1250867 3300048905 Unclassified 662
194 Ga0496108_0347178 3300048911 Bacteria 1295
195 Ga0496115_1339579 3300048918 Unclassified 531
196 Ga0501034_0340133 3300049571 Bacteria 1431
197 Ga0501039_0198696 3300049575 Bacteria 1577
198 Ga0501041_0036217 3300049577 Bacteria 2991
199 Ga0501042_0125761 3300049578 Bacteria 1846
200 Ga0501046_0047269 3300049580 Bacteria 3412
201 Ga0501068_0058024 3300049584 Bacteria 2348
202 Ga0501071_0094133 3300049587 Bacteria 2203
203 Ga0501072_0112163 3300049588 Bacteria 2171
204 Ga0501075_0090722 3300049591 Bacteria 2318
205 Ga0501076_0057865 3300049592 Bacteria 3079
206 Ga0501079_0631185 3300049741 Bacteria 843
207 Ga0501081_0035716 3300049743 Bacteria 3384
208 Ga0501044_0393228 3300049823 Bacteria 1300
209 Ga0501045_0201924 3300049824 Bacteria 1481
210 nmdc:mga0k408_262435_c1 3300050493 Bacteria 1031
211 nmdc:mga05p37_1170305_c1 3300050507 Bacteria 798
212 nmdc:mga05p37_269726_c1 3300050507 Unclassified 2034
213 nmdc:mga05p37_597219_c1 3300050507 Unclassified 1247
214 nmdc:mga0qj67_4436_c1 3300050509 Bacteria 10164
215 nmdc:mga06r32_5889_c1 3300050510 Bacteria 11033
216 nmdc:mga08y16_1270048_c1 3300050511 Unclassified 704
217 nmdc:mga0n895_48821_c1 3300050512 Bacteria 4145
218 nmdc:mga0n895_513971_c1 3300050512 Unclassified 1206
219 nmdc:mga0n895_674912_c1 3300050512 Bacteria 1031
220 nmdc:mga0n895_97173_c1 3300050512 Bacteria 2951
221 nmdc:mga0rr50_235481_c1 3300050513 Bacteria 1516
222 nmdc:mga0rr50_240309_c1 3300050513 Bacteria 1501
223 nmdc:mga08x19_969635_c1 3300050514 Unclassified 604
224 nmdc:mga0a205_453036_c1 3300050515 Bacteria 1143
225 nmdc:mga0a205_74902_c1 3300050515 Bacteria 3270
226 Ga0495655_0132854 3300053083 Unclassified 768
227 Ga0495595_0555640 3300053084 Unclassified 586
228 Ga0500628_000144 3300053129 Bacteria 13644
229 Ga0500576_186184 3300053725 Bacteria 726
230 Ga0501084_0002223 3300054114 Bacteria 15584
231 Ga0501084_0040453 3300054114 Bacteria 3900
232 Ga0501084_0478003 3300054114 Bacteria 1053
233 Ga0501082_0102685 3300060353 Bacteria 2473
234 Ga0501082_1038349 3300060353 Bacteria 717
235 Ga0265331_10001177
236 MBSR1b_contig_9463684
237 Ga0065707_10130170
238 Ga0070658_11963740
239 Ga0070683_100271582
240 Ga0070670_100267629
241 Ga0068869_100018123
242 Ga0070680_100451240
243 Ga0070687_100109296
244 Ga0070687_100447467
245 Ga0070692_10212285
246 Ga0070668_100431792
247 Ga0070669_100536184
248 Ga0070669_100602465
249 Ga0070675_100234453
250 Ga0070675_102044179
251 Ga0070671_100312025
252 Ga0070711_100605288
253 Ga0070694_100487547
254 Ga0070708_100920073
255 Ga0070662_101551396
256 Ga0070681_11138139
257 Ga0068867_100347665
258 Ga0070706_100407086
259 Ga0070707_100915096
260 Ga0070698_100199789
261 Ga0070679_100309316
262 Ga0070679_100672151
263 Ga0070684_100805449
264 Ga0070697_100754826
265 Ga0070672_100000176
266 Ga0070672_100931053
267 Ga0070672_101914010
268 Ga0070686_100302836
269 Ga0070686_101363322
270 Ga0070695_100228900
271 Ga0070695_100357022
272 Ga0070696_100322769
273 Ga0070693_100001288
274 Ga0070693_100040647
275 Ga0070693_100603137
276 Ga0070693_101323904
277 Ga0070665_100000365
278 Ga0070704_101394903
279 Ga0070664_100078453
280 Ga0068857_101466525
281 Ga0068857_101863006
282 Ga0068854_101747535
283 Ga0068852_100305973
284 Ga0068864_100387813
285 Ga0068864_102029433
286 Ga0068861_100249481
287 Ga0068861_100633136
288 Ga0068861_101692699
289 Ga0068861_102279661
290 Ga0068870_10016258
291 Ga0068860_100333612
292 Ga0081538_10136262
293 Ga0081539_10050891
294 Ga0070715_10751414
295 Ga0070716_100070163
296 Ga0075366_10916031
297 Ga0075433_10263215
298 Ga0075434_100205955
299 Ga0075434_100242003
300 Ga0075434_100243452
301 Ga0075434_100593519
302 Ga0075436_100006707
303 Ga0075436_100219027
304 Ga0075436_101166675
305 Ga0075435_100006691
306 Ga0075435_100254593
307 Ga0075435_100257211
308 Ga0075435_100387293
309 Ga0099794_10024544
310 Ga0099794_10032946
311 Ga0114129_10707824
312 Ga0114129_10726895
313 Ga0114129_11566584
314 Ga0105243_12657192
315 Ga0105248_10152469
316 Ga0105238_10000118
317 Ga0105249_10603514
318 Ga0105246_11241746
319 Ga0157370_10063247
320 Ga0157370_11700514
321 Ga0157369_10100088
322 Ga0157378_10828874
323 Ga0157372_12798840
324 Ga0157375_11815385
325 Ga0157377_10199922
326 Ga0207699_11127021
327 Ga0207643_10145813
328 Ga0207684_10071308
329 Ga0207707_11662824
330 Ga0207660_10271905
331 Ga0207660_11069979
332 Ga0207662_10390416
333 Ga0207657_10283045
334 Ga0207649_11542352
335 Ga0207681_10000039
336 Ga0207681_10506654
337 Ga0207681_10892021
338 Ga0207694_10000001
339 Ga0207694_10000042
340 Ga0207650_10415273
341 Ga0207659_10000005
342 Ga0207644_11161029
343 Ga0207711_11242509
344 Ga0207689_10054383
345 Ga0207689_10117089
346 Ga0207661_10388575
347 Ga0207679_10980437
348 Ga0207667_10177781
349 Ga0207712_10778080
350 Ga0207712_11392247
351 Ga0207712_11883764
352 Ga0207668_11275569
353 Ga0207640_12182144
354 Ga0207703_12019212
355 Ga0207648_10170521
356 Ga0207675_100293146
357 Ga0207675_100348199
358 Ga0207675_100948171
359 Ga0209588_1053184
360 Ga0209588_1086085
361 Ga0268266_10000252
362 Ga0268264_12089065
363 Ga0265340_10006586
364 Ga0265327_10000176
365 Ga0265327_10040947
366 Ga0265316_10311744
367 Ga0265316_10748650
368 Ga0307408_100331888
369 Ga0307408_100948131
370 Ga0307410_11392867
371 Ga0307406_11138405
372 Ga0307409_100028746
373 Ga0307409_100798724
374 Ga0307409_102022903
375 Ga0307416_100058985
376 Ga0307416_100712816
377 Ga0307416_102645176
378 Ga0307415_101058247
379 Ga0373959_0000362
380 Ga0373926_0237436
381 Ga0373929_0185849
382 Ga0373935_0004434
383 Ga0373947_0198165
384 Ga0395905_0004964
385 Ga0395901_1457253
386 Ga0436365_0039243
387 Ga0436365_0833271
388 Ga0436365_0970387
389 Ga0436360_0658305
390 Ga0436363_0209853
391 Ga0436363_1011204
392 Ga0439465_0000444
393 Ga0451797_0153439
394 Ga0451797_0537382
395 Ga0451804_1047380
396 Ga0451843_1431268
397 Ga0451853_0788804
398 Ga0439442_003676
399 Ga0439445_0069693
400 Ga0439432_000715
401 Ga0439462_0000121
402 Ga0439446_0150629
403 Ga0451577_0992132
404 Ga0466963_0020558
405 Ga0453684_0006157
406 Ga0453684_0910732
407 Ga0451576_0145738
408 Ga0466967_2047268
409 Ga0495580_0162374
410 Ga0495594_0138350
411 Ga0495583_0030851
412 Ga0495665_0272224
413 Ga0495586_0542357
414 Ga0495587_0095605
415 Ga0495622_0092545
416 Ga0495588_0203969
417 Ga0495623_0459769
418 Ga0495646_0090968
419 Ga0495600_0285666
420 Ga0495581_0040485
421 Ga0495604_0707081
422 Ga0495636_0084656
423 Ga0495675_0537739
424 Ga0495593_0022737
425 Ga0495602_0644123
426 Ga0495614_0501384
427 Ga0496102_1250867
428 Ga0496108_0347178
429 Ga0496115_1339579
430 Ga0501034_0340133
431 Ga0501039_0198696
432 Ga0501041_0036217
433 Ga0501042_0125761
434 Ga0501046_0047269
435 Ga0501068_0058024
436 Ga0501071_0094133
437 Ga0501072_0112163
438 Ga0501075_0090722
439 Ga0501076_0057865
440 Ga0501079_0631185
441 Ga0501081_0035716
442 Ga0501044_0393228
443 Ga0501045_0201924
444 nmdc:mga0k408_262435_c1
445 nmdc:mga05p37_1170305_c1
446 nmdc:mga05p37_269726_c1
447 nmdc:mga05p37_597219_c1
448 nmdc:mga0qj67_4436_c1
449 nmdc:mga06r32_5889_c1
450 nmdc:mga08y16_1270048_c1
451 nmdc:mga0n895_48821_c1
452 nmdc:mga0n895_513971_c1
453 nmdc:mga0n895_674912_c1
454 nmdc:mga0n895_97173_c1
455 nmdc:mga0rr50_235481_c1
456 nmdc:mga0rr50_240309_c1
457 nmdc:mga08x19_969635_c1
458 nmdc:mga0a205_453036_c1
459 nmdc:mga0a205_74902_c1
460 Ga0495655_0132854
461 Ga0495595_0555640
462 Ga0500628_000144
463 Ga0500576_186184
464 Ga0501084_0002223
465 Ga0501084_0040453
466 Ga0501084_0478003
467 Ga0501082_0102685
468 Ga0501082_1038349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04255

DUF433

Protein of unknown function (DUF433)

20

75

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ga1-assembly1.cif.gz_B crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution 0.8981 8 72
5cy2-assembly2.cif.gz_E tn3 resolvase - site iii complex crystal form ii 0.8725 27 67
6z1p-assembly1.cif.gz_BE structure of the mitochondrial ribosome from tetrahymena thermophila 0.8603 29 64
5af3-assembly1.cif.gz_A x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8579 9 61
5af3-assembly1.cif.gz_B x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8576 9 61
ID Description Score Start End Superfamily
af_P9WLC5_172_234_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9079 9 67 1.10.10.10
2ga1B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8969 9 72 1.10.10.10
4lfuA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8359 29 69 1.10.10.10
1zr4D03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8304 27 63 1.10.10.60
af_P9WLC5_172_234_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8303 9 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A090AKS1-F1-model_v4 DUF433 domain-containing protein 1.008 8 68
AF-A0A7T8CM78-F1-model_v4 deleted 1.004 8 69
AF-A0A7W8GG57-F1-model_v4 Uncharacterized protein (DUF433 family) 1.003 5 69
AF-A0A1S6EWE5-F1-model_v4 Antitoxin 1.003 4 69
AF-A0A6I2G268-F1-model_v4 DUF433 domain-containing protein 1.003 6 68

Map