F347191
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 181 | 234 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300025961|Ga0207712_10528953|Ga0207712_105289532 |
| Length | 196 |
| Sequence | MAESVDCVWLAWQSERRDMPQQSNNLSGSGLERLNEMSEPEAHEMLIAVCGSKQWVDRMIARRPFASADALYAAADETWFALEKQSWLEAFSHHPRIGERNLARAKFAATAAQSSKEQSGMAGATEAVRTEFASGNAEYEKKFGHVFLICATGKTGEEMLDSLRERTENDAATELRNAANEQSKIVRIRLGKLVEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 111 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 113 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 127 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 128 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 129 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 135 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 137 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 138 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 139 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 146 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 147 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 153 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 154 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 156 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 157 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 158 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 159 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 160 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 161 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 162 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 163 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 167 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 168 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 169 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 170 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 171 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 172 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 0.85 |
| Rhizosphere | 97.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10080407 | 3300003320 | Bacteria | 3283 |
| 2 | Ga0065712_10379133 | 3300005290 | Bacteria | 754 |
| 3 | Ga0065715_10435577 | 3300005293 | Bacteria | 842 |
| 4 | Ga0070683_100072561 | 3300005329 | Bacteria | 3213 |
| 5 | Ga0070690_100122729 | 3300005330 | Unclassified | 1745 |
| 6 | Ga0070670_100003527 | 3300005331 | Bacteria | 13006 |
| 7 | Ga0070670_100137747 | 3300005331 | Bacteria | 2110 |
| 8 | Ga0070670_101231251 | 3300005331 | Bacteria | 684 |
| 9 | Ga0068869_100035065 | 3300005334 | Bacteria | 3554 |
| 10 | Ga0070666_10525912 | 3300005335 | Bacteria | 859 |
| 11 | Ga0070680_100004200 | 3300005336 | Bacteria | 10799 |
| 12 | Ga0070682_100008101 | 3300005337 | Bacteria | 5923 |
| 13 | Ga0070689_100098387 | 3300005340 | Bacteria | 2314 |
| 14 | Ga0070687_100452392 | 3300005343 | Bacteria | 854 |
| 15 | Ga0070692_10137408 | 3300005345 | Bacteria | 1380 |
| 16 | Ga0070675_100002385 | 3300005354 | Bacteria | 13992 |
| 17 | Ga0070675_100693465 | 3300005354 | Unclassified | 927 |
| 18 | Ga0070671_100683415 | 3300005355 | Bacteria | 890 |
| 19 | Ga0070674_100556348 | 3300005356 | Bacteria | 963 |
| 20 | Ga0070673_100348788 | 3300005364 | Bacteria | 1313 |
| 21 | Ga0070688_100131496 | 3300005365 | Bacteria | 1689 |
| 22 | Ga0070659_100046796 | 3300005366 | Bacteria | 3391 |
| 23 | Ga0070711_100686702 | 3300005439 | Unclassified | 861 |
| 24 | Ga0070705_100315008 | 3300005440 | Bacteria | 1127 |
| 25 | Ga0070681_10037260 | 3300005458 | Bacteria | 4881 |
| 26 | Ga0070706_100057052 | 3300005467 | Bacteria | 3603 |
| 27 | Ga0070706_100098220 | 3300005467 | Bacteria | 2721 |
| 28 | Ga0070707_100186931 | 3300005468 | Bacteria | 2020 |
| 29 | Ga0070698_100028379 | 3300005471 | Bacteria | 5813 |
| 30 | Ga0070698_100111199 | 3300005471 | Bacteria | 2704 |
| 31 | Ga0070698_100131437 | 3300005471 | Bacteria | 2459 |
| 32 | Ga0070699_100000932 | 3300005518 | Bacteria | 27306 |
| 33 | Ga0070699_100299808 | 3300005518 | Unclassified | 1442 |
| 34 | Ga0070679_100004341 | 3300005530 | Bacteria | 13095 |
| 35 | Ga0070684_100035141 | 3300005535 | Bacteria | 4288 |
| 36 | Ga0068853_100199576 | 3300005539 | Unclassified | 1820 |
| 37 | Ga0068853_100232239 | 3300005539 | Bacteria | 1688 |
| 38 | Ga0068853_101134211 | 3300005539 | Bacteria | 754 |
| 39 | Ga0070695_100030737 | 3300005545 | Bacteria | 3345 |
| 40 | Ga0070696_100020415 | 3300005546 | Bacteria | 4490 |
| 41 | Ga0070693_100012705 | 3300005547 | Bacteria | 4268 |
| 42 | Ga0070665_100000085 | 3300005548 | Bacteria | 180238 |
| 43 | Ga0068855_100013905 | 3300005563 | Bacteria | 9707 |
| 44 | Ga0070664_100033768 | 3300005564 | Bacteria | 4288 |
| 45 | Ga0068854_100751466 | 3300005578 | Unclassified | 846 |
| 46 | Ga0068856_100000688 | 3300005614 | Bacteria | 36724 |
| 47 | Ga0068856_101207972 | 3300005614 | Bacteria | 772 |
| 48 | Ga0070702_100313136 | 3300005615 | Bacteria | 1090 |
| 49 | Ga0068852_100044250 | 3300005616 | Bacteria | 3780 |
| 50 | Ga0068859_100006306 | 3300005617 | Bacteria | 12028 |
| 51 | Ga0068859_100052500 | 3300005617 | Bacteria | 4099 |
| 52 | Ga0068859_100462308 | 3300005617 | Bacteria | 1365 |
| 53 | Ga0068864_100003639 | 3300005618 | Bacteria | 12740 |
| 54 | Ga0068870_10028396 | 3300005840 | Bacteria | 2809 |
| 55 | Ga0068863_100065951 | 3300005841 | Bacteria | 3425 |
| 56 | Ga0068858_100243448 | 3300005842 | Bacteria | 1707 |
| 57 | Ga0081539_10000559 | 3300005985 | Bacteria | 76871 |
| 58 | Ga0097621_100062657 | 3300006237 | Bacteria | 3054 |
| 59 | Ga0068871_101813555 | 3300006358 | Unclassified | 579 |
| 60 | Ga0075428_100035989 | 3300006844 | Bacteria | 5456 |
| 61 | Ga0075430_100097958 | 3300006846 | Bacteria | 2450 |
| 62 | Ga0075431_100022855 | 3300006847 | Bacteria | 6392 |
| 63 | Ga0075431_100148937 | 3300006847 | Bacteria | 2410 |
| 64 | Ga0075434_100010195 | 3300006871 | Bacteria | 8799 |
| 65 | Ga0075429_100013175 | 3300006880 | Bacteria | 7173 |
| 66 | Ga0075429_100068526 | 3300006880 | Bacteria | 3088 |
| 67 | Ga0075429_100170811 | 3300006880 | Bacteria | 1904 |
| 68 | Ga0097620_100006306 | 3300006931 | Bacteria | 12028 |
| 69 | Ga0097620_100052500 | 3300006931 | Bacteria | 4099 |
| 70 | Ga0097620_100462352 | 3300006931 | Bacteria | 1365 |
| 71 | Ga0105240_10526099 | 3300009093 | Bacteria | 1312 |
| 72 | Ga0111539_10055596 | 3300009094 | Bacteria | 4705 |
| 73 | Ga0111539_10808594 | 3300009094 | Bacteria | 1091 |
| 74 | Ga0105245_10017885 | 3300009098 | Bacteria | 6191 |
| 75 | Ga0114129_10234723 | 3300009147 | Bacteria | 2469 |
| 76 | Ga0114129_10299843 | 3300009147 | Bacteria | 2142 |
| 77 | Ga0105241_10030005 | 3300009174 | Bacteria | 4061 |
| 78 | Ga0105242_10173526 | 3300009176 | Bacteria | 1896 |
| 79 | Ga0105248_10005447 | 3300009177 | Bacteria | 13986 |
| 80 | Ga0105249_10348838 | 3300009553 | Bacteria | 1499 |
| 81 | Ga0105239_10126830 | 3300010375 | Bacteria | 2837 |
| 82 | Ga0105246_10074022 | 3300011119 | Bacteria | 2406 |
| 83 | Ga0157373_10009506 | 3300013100 | Bacteria | 7181 |
| 84 | Ga0157371_10008259 | 3300013102 | Bacteria | 8317 |
| 85 | Ga0157374_10010400 | 3300013296 | Bacteria | 8000 |
| 86 | Ga0157374_10279644 | 3300013296 | Bacteria | 1648 |
| 87 | Ga0157372_10031059 | 3300013307 | Bacteria | 5847 |
| 88 | Ga0157372_10211189 | 3300013307 | Bacteria | 2249 |
| 89 | Ga0157375_11271323 | 3300013308 | Bacteria | 864 |
| 90 | Ga0163163_10081173 | 3300014325 | Bacteria | 3244 |
| 91 | Ga0157380_10236786 | 3300014326 | Bacteria | 1643 |
| 92 | Ga0182008_10085265 | 3300014497 | Bacteria | 1556 |
| 93 | Ga0157377_10095358 | 3300014745 | Bacteria | 1763 |
| 94 | Ga0207643_10152784 | 3300025908 | Bacteria | 1385 |
| 95 | Ga0207684_10136523 | 3300025910 | Bacteria | 2106 |
| 96 | Ga0207684_10156858 | 3300025910 | Bacteria | 1959 |
| 97 | Ga0207654_10336634 | 3300025911 | Bacteria | 1036 |
| 98 | Ga0207707_10038284 | 3300025912 | Bacteria | 4191 |
| 99 | Ga0207663_10862579 | 3300025916 | Unclassified | 723 |
| 100 | Ga0207660_10237788 | 3300025917 | Bacteria | 1434 |
| 101 | Ga0207657_10065111 | 3300025919 | Bacteria | 3108 |
| 102 | Ga0207652_10078393 | 3300025921 | Bacteria | 2884 |
| 103 | Ga0207646_10053183 | 3300025922 | Bacteria | 3622 |
| 104 | Ga0207650_10053017 | 3300025925 | Bacteria | 3005 |
| 105 | Ga0207659_10509067 | 3300025926 | Bacteria | 1020 |
| 106 | Ga0207687_10249361 | 3300025927 | Bacteria | 1411 |
| 107 | Ga0207644_10666804 | 3300025931 | Bacteria | 866 |
| 108 | Ga0207690_10319065 | 3300025932 | Bacteria | 1221 |
| 109 | Ga0207690_10556228 | 3300025932 | Bacteria | 933 |
| 110 | Ga0207706_10028079 | 3300025933 | Bacteria | 5027 |
| 111 | Ga0207686_10208263 | 3300025934 | Bacteria | 1404 |
| 112 | Ga0207670_10332092 | 3300025936 | Bacteria | 1199 |
| 113 | Ga0207669_10774292 | 3300025937 | Bacteria | 794 |
| 114 | Ga0207689_10013503 | 3300025942 | Bacteria | 6974 |
| 115 | Ga0207661_10000796 | 3300025944 | Bacteria | 20630 |
| 116 | Ga0207679_10212754 | 3300025945 | Bacteria | 1622 |
| 117 | Ga0207651_10445514 | 3300025960 | Bacteria | 1110 |
| 118 | Ga0207712_10528953 | 3300025961 | Bacteria | 1011 |
| 119 | Ga0207677_10042178 | 3300026023 | Bacteria | 3024 |
| 120 | Ga0207703_10129343 | 3300026035 | Bacteria | 2178 |
| 121 | Ga0207639_10062338 | 3300026041 | Bacteria | 2883 |
| 122 | Ga0207639_10209880 | 3300026041 | Unclassified | 1675 |
| 123 | Ga0207678_10065026 | 3300026067 | Bacteria | 3133 |
| 124 | Ga0207702_10012961 | 3300026078 | Bacteria | 6935 |
| 125 | Ga0207702_11134305 | 3300026078 | Bacteria | 776 |
| 126 | Ga0207641_10033286 | 3300026088 | Bacteria | 4282 |
| 127 | Ga0207676_10021368 | 3300026095 | Bacteria | 4746 |
| 128 | Ga0207674_10000736 | 3300026116 | Bacteria | 42809 |
| 129 | Ga0209995_1000365 | 3300027471 | Bacteria | 7041 |
| 130 | Ga0209999_1005858 | 3300027543 | Bacteria | 2209 |
| 131 | Ga0209966_1002289 | 3300027695 | Bacteria | 3193 |
| 132 | Ga0209998_10000087 | 3300027717 | Bacteria | 36016 |
| 133 | Ga0268266_10000649 | 3300028379 | Bacteria | 47110 |
| 134 | Ga0268264_10039966 | 3300028381 | Bacteria | 3875 |
| 135 | Ga0307515_10000024 | 3300028794 | Bacteria | 393119 |
| 136 | Ga0265320_10056768 | 3300031240 | Bacteria | 1880 |
| 137 | Ga0265325_10043911 | 3300031241 | Bacteria | 2330 |
| 138 | Ga0265329_10124302 | 3300031242 | Unclassified | 828 |
| 139 | Ga0265331_10027178 | 3300031250 | Bacteria | 2871 |
| 140 | Ga0265316_10003739 | 3300031344 | Bacteria | 15289 |
| 141 | Ga0307408_100033768 | 3300031548 | Bacteria | 3577 |
| 142 | Ga0265313_10002143 | 3300031595 | Bacteria | 17555 |
| 143 | Ga0307405_10201501 | 3300031731 | Bacteria | 1446 |
| 144 | Ga0307405_10366739 | 3300031731 | Bacteria | 1116 |
| 145 | Ga0307410_10430528 | 3300031852 | Bacteria | 1072 |
| 146 | Ga0307406_10723027 | 3300031901 | Bacteria | 833 |
| 147 | Ga0307407_10083347 | 3300031903 | Bacteria | 1940 |
| 148 | Ga0307407_10382495 | 3300031903 | Unclassified | 1005 |
| 149 | Ga0307407_10407377 | 3300031903 | Unclassified | 977 |
| 150 | Ga0307412_10553877 | 3300031911 | Unclassified | 966 |
| 151 | Ga0307412_10718950 | 3300031911 | Unclassified | 859 |
| 152 | Ga0307409_100226754 | 3300031995 | Bacteria | 1690 |
| 153 | Ga0307409_100454555 | 3300031995 | Bacteria | 1237 |
| 154 | Ga0307409_100987397 | 3300031995 | Unclassified | 859 |
| 155 | Ga0307409_101479512 | 3300031995 | Unclassified | 706 |
| 156 | Ga0307416_100016847 | 3300032002 | Bacteria | 5093 |
| 157 | Ga0307416_100071126 | 3300032002 | Bacteria | 2888 |
| 158 | Ga0307416_100188572 | 3300032002 | Bacteria | 1942 |
| 159 | Ga0307414_10266591 | 3300032004 | Bacteria | 1432 |
| 160 | Ga0307411_10140289 | 3300032005 | Bacteria | 1781 |
| 161 | Ga0307411_10283253 | 3300032005 | Bacteria | 1320 |
| 162 | Ga0307411_10413976 | 3300032005 | Bacteria | 1118 |
| 163 | Ga0307415_100055775 | 3300032126 | Bacteria | 2706 |
| 164 | Ga0307415_100378200 | 3300032126 | Bacteria | 1201 |
| 165 | Ga0307415_100559780 | 3300032126 | Unclassified | 1010 |
| 166 | Ga0307415_100993180 | 3300032126 | Bacteria | 780 |
| 167 | Ga0373943_0527423 | 3300035170 | Bacteria | 692 |
| 168 | Ga0373933_0360054 | 3300035724 | Bacteria | 946 |
| 169 | Ga0373937_0603681 | 3300036401 | Bacteria | 1042 |
| 170 | Ga0395900_0948120 | 3300037418 | Bacteria | 782 |
| 171 | Ga0395905_0021861 | 3300037471 | Bacteria | 6050 |
| 172 | Ga0395905_0094025 | 3300037471 | Bacteria | 2812 |
| 173 | Ga0395905_0587952 | 3300037471 | Unclassified | 1015 |
| 174 | Ga0395901_0557137 | 3300038443 | Unclassified | 1161 |
| 175 | Ga0439453_0013715 | 3300041408 | Bacteria | 1381 |
| 176 | Ga0451807_0928212 | 3300041486 | Bacteria | 1019 |
| 177 | Ga0451853_3939986 | 3300041512 | Unclassified | 530 |
| 178 | Ga0439435_0029827 | 3300042436 | Bacteria | 1475 |
| 179 | Ga0439444_0097088 | 3300042437 | Unclassified | 664 |
| 180 | Ga0453683_0389973 | 3300044673 | Bacteria | 897 |
| 181 | Ga0495629_0004571 | 3300046459 | Bacteria | 10353 |
| 182 | Ga0495645_0037684 | 3300046543 | Bacteria | 3526 |
| 183 | Ga0495658_0043625 | 3300046683 | Bacteria | 2509 |
| 184 | Ga0495581_0011938 | 3300047315 | Bacteria | 5025 |
| 185 | Ga0495686_0192480 | 3300047472 | Bacteria | 1175 |
| 186 | Ga0496115_0177561 | 3300048918 | Unclassified | 1761 |
| 187 | Ga0501292_002776 | 3300049515 | Bacteria | 2285 |
| 188 | Ga0501041_0362033 | 3300049577 | Bacteria | 917 |
| 189 | Ga0501067_0179403 | 3300049583 | Bacteria | 1179 |
| 190 | Ga0501073_0001776 | 3300049589 | Bacteria | 16033 |
| 191 | Ga0501076_0865837 | 3300049592 | Bacteria | 745 |
| 192 | Ga0501077_0098717 | 3300049593 | Bacteria | 1851 |
| 193 | Ga0501077_0541823 | 3300049593 | Bacteria | 747 |
| 194 | Ga0501202_119263 | 3300049652 | Bacteria | 661 |
| 195 | Ga0501216_073105 | 3300049660 | Unclassified | 712 |
| 196 | Ga0501224_005757 | 3300049664 | Bacteria | 1786 |
| 197 | Ga0501233_001771 | 3300049668 | Bacteria | 3728 |
| 198 | Ga0501235_026166 | 3300049669 | Bacteria | 1306 |
| 199 | Ga0501239_002076 | 3300049672 | Bacteria | 1788 |
| 200 | Ga0501239_013419 | 3300049672 | Unclassified | 938 |
| 201 | Ga0501250_018666 | 3300049680 | Unclassified | 880 |
| 202 | Ga0501256_051809 | 3300049685 | Bacteria | 507 |
| 203 | Ga0501259_008820 | 3300049688 | Bacteria | 1630 |
| 204 | Ga0501261_039769 | 3300049690 | Unclassified | 738 |
| 205 | Ga0501225_0004652 | 3300049705 | Bacteria | 4073 |
| 206 | Ga0501225_0013109 | 3300049705 | Bacteria | 2321 |
| 207 | Ga0501079_0282217 | 3300049741 | Bacteria | 1299 |
| 208 | Ga0501080_0079323 | 3300049742 | Bacteria | 3052 |
| 209 | Ga0501083_0142453 | 3300049744 | Bacteria | 1569 |
| 210 | Ga0501265_014176 | 3300049762 | Unclassified | 1011 |
| 211 | Ga0501266_008171 | 3300049763 | Bacteria | 1317 |
| 212 | Ga0501267_009151 | 3300049764 | Bacteria | 986 |
| 213 | Ga0501268_006456 | 3300049765 | Bacteria | 1721 |
| 214 | Ga0501274_010934 | 3300049771 | Bacteria | 842 |
| 215 | Ga0501212_041102 | 3300049851 | Bacteria | 765 |
| 216 | nmdc:mga0k408_32609_c2 | 3300050493 | Unclassified | 2025 |
| 217 | nmdc:mga05p37_126339_c1 | 3300050507 | Bacteria | 3140 |
| 218 | nmdc:mga05p37_220569_c1 | 3300050507 | Bacteria | 2289 |
| 219 | nmdc:mga05p37_322155_c1 | 3300050507 | Bacteria | 1829 |
| 220 | nmdc:mga09592_1343_c2 | 3300050508 | Bacteria | 11749 |
| 221 | nmdc:mga09592_410587_c1 | 3300050508 | Bacteria | 1170 |
| 222 | nmdc:mga09592_64515_c1 | 3300050508 | Bacteria | 3101 |
| 223 | nmdc:mga09592_687190_c1 | 3300050508 | Bacteria | 872 |
| 224 | nmdc:mga0qj67_47529_c1 | 3300050509 | Bacteria | 3390 |
| 225 | nmdc:mga0qj67_79593_c1 | 3300050509 | Bacteria | 2625 |
| 226 | nmdc:mga06r32_101529_c1 | 3300050510 | Bacteria | 2823 |
| 227 | nmdc:mga06r32_263_c5 | 3300050510 | Bacteria | 13218 |
| 228 | nmdc:mga06r32_79510_c1 | 3300050510 | Bacteria | 3190 |
| 229 | nmdc:mga08y16_63648_c1 | 3300050511 | Bacteria | 3852 |
| 230 | nmdc:mga0rr50_95169_c1 | 3300050513 | Bacteria | 2327 |
| 231 | nmdc:mga0a205_11425_c1 | 3300050515 | Bacteria | 8174 |
| 232 | Ga0501084_0053643 | 3300054114 | Bacteria | 3373 |
| 233 | Ga0501082_0266755 | 3300060353 | Bacteria | 1490 |
| 234 | Ga0501082_1087481 | 3300060353 | Unclassified | 699 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005439 | Ga0070711_100686702 | Ga0070711_1006867022 | 129 |
| 2 | 3300005539 | Ga0068853_101134211 | Ga0068853_1011342112 | 129 |
| 3 | 3300049660 | Ga0501216_073105 | Ga0501216_073105_66_464 | 129 |
| 4 | 3300049690 | Ga0501261_039769 | Ga0501261_039769_325_723 | 129 |
| 5 | 3300060353 | Ga0501082_1087481 | Ga0501082_1087481_29_454 | 135 |
| 6 | 3300046459 | Ga0495629_0004571 | Ga0495629_0004571_9329_9859 | 149 |
| 7 | 3300046683 | Ga0495658_0043625 | Ga0495658_0043625_1237_1767 | 149 |
| 8 | 3300047315 | Ga0495581_0011938 | Ga0495581_0011938_3986_4516 | 149 |
| 9 | 3300005467 | Ga0070706_100098220 | Ga0070706_1000982202 | 150 |
| 10 | 3300005467 | Ga0070706_100057052 | Ga0070706_1000570523 | 151 |
| 11 | 3300005471 | Ga0070698_100111199 | Ga0070698_1001111993 | 151 |
| 12 | 3300005518 | Ga0070699_100299808 | Ga0070699_1002998083 | 151 |
| 13 | 3300025910 | Ga0207684_10136523 | Ga0207684_101365233 | 151 |
| 14 | 3300027717 | Ga0209998_10000087 | Ga0209998_1000008730 | 151 |
| 15 | 3300031731 | Ga0307405_10366739 | Ga0307405_103667391 | 151 |
| 16 | 3300031903 | Ga0307407_10407377 | Ga0307407_104073772 | 151 |
| 17 | 3300031911 | Ga0307412_10553877 | Ga0307412_105538772 | 151 |
| 18 | 3300031911 | Ga0307412_10718950 | Ga0307412_107189502 | 151 |
| 19 | 3300031995 | Ga0307409_100226754 | Ga0307409_1002267543 | 151 |
| 20 | 3300031995 | Ga0307409_100987397 | Ga0307409_1009873972 | 151 |
| 21 | 3300031995 | Ga0307409_101479512 | Ga0307409_1014795122 | 151 |
| 22 | 3300032002 | Ga0307416_100016847 | Ga0307416_1000168472 | 151 |
| 23 | 3300032005 | Ga0307411_10413976 | Ga0307411_104139762 | 151 |
| 24 | 3300032126 | Ga0307415_100378200 | Ga0307415_1003782002 | 151 |
| 25 | 3300032126 | Ga0307415_100559780 | Ga0307415_1005597801 | 151 |
| 26 | 3300041512 | Ga0451853_3939986 | Ga0451853_3939986_23_502 | 151 |
| 27 | 3300049664 | Ga0501224_005757 | Ga0501224_005757_575_1033 | 151 |
| 28 | 3300049668 | Ga0501233_001771 | Ga0501233_001771_1032_1490 | 151 |
| 29 | 3300049669 | Ga0501235_026166 | Ga0501235_026166_338_796 | 151 |
| 30 | 3300049672 | Ga0501239_002076 | Ga0501239_002076_988_1446 | 151 |
| 31 | 3300049680 | Ga0501250_018666 | Ga0501250_018666_256_714 | 151 |
| 32 | 3300049685 | Ga0501256_051809 | Ga0501256_051809_12_470 | 151 |
| 33 | 3300049688 | Ga0501259_008820 | Ga0501259_008820_493_951 | 151 |
| 34 | 3300049705 | Ga0501225_0004652 | Ga0501225_0004652_2499_2957 | 151 |
| 35 | 3300049762 | Ga0501265_014176 | Ga0501265_014176_269_727 | 151 |
| 36 | 3300049763 | Ga0501266_008171 | Ga0501266_008171_36_494 | 151 |
| 37 | 3300049764 | Ga0501267_009151 | Ga0501267_009151_511_969 | 151 |
| 38 | 3300049765 | Ga0501268_006456 | Ga0501268_006456_682_1140 | 151 |
| 39 | 3300049771 | Ga0501274_010934 | Ga0501274_010934_163_621 | 151 |
| 40 | 3300037471 | Ga0395905_0021861 | Ga0395905_0021861_536_1075 | 153 |
| 41 | 3300009176 | Ga0105242_10173526 | Ga0105242_101735262 | 156 |
| 42 | 3300025934 | Ga0207686_10208263 | Ga0207686_102082633 | 156 |
| 43 | 3300006358 | Ga0068871_101813555 | Ga0068871_1018135551 | 157 |
| 44 | 3300013296 | Ga0157374_10279644 | Ga0157374_102796444 | 157 |
| 45 | 3300014326 | Ga0157380_10236786 | Ga0157380_102367862 | 157 |
| 46 | 3300005290 | Ga0065712_10379133 | Ga0065712_103791332 | 158 |
| 47 | 3300005343 | Ga0070687_100452392 | Ga0070687_1004523921 | 158 |
| 48 | 3300005354 | Ga0070675_100693465 | Ga0070675_1006934652 | 158 |
| 49 | 3300005365 | Ga0070688_100131496 | Ga0070688_1001314962 | 158 |
| 50 | 3300005468 | Ga0070707_100186931 | Ga0070707_1001869312 | 158 |
| 51 | 3300005471 | Ga0070698_100131437 | Ga0070698_1001314373 | 158 |
| 52 | 3300005546 | Ga0070696_100020415 | Ga0070696_1000204154 | 158 |
| 53 | 3300005578 | Ga0068854_100751466 | Ga0068854_1007514662 | 158 |
| 54 | 3300005617 | Ga0068859_100052500 | Ga0068859_1000525002 | 158 |
| 55 | 3300005985 | Ga0081539_10000559 | Ga0081539_1000055929 | 158 |
| 56 | 3300006844 | Ga0075428_100035989 | Ga0075428_1000359896 | 158 |
| 57 | 3300006847 | Ga0075431_100022855 | Ga0075431_1000228556 | 158 |
| 58 | 3300006880 | Ga0075429_100068526 | Ga0075429_1000685262 | 158 |
| 59 | 3300006931 | Ga0097620_100052500 | Ga0097620_1000525002 | 158 |
| 60 | 3300009094 | Ga0111539_10055596 | Ga0111539_100555962 | 158 |
| 61 | 3300009147 | Ga0114129_10234723 | Ga0114129_102347233 | 158 |
| 62 | 3300014497 | Ga0182008_10085265 | Ga0182008_100852651 | 158 |
| 63 | 3300025910 | Ga0207684_10156858 | Ga0207684_101568582 | 158 |
| 64 | 3300025922 | Ga0207646_10053183 | Ga0207646_100531834 | 158 |
| 65 | 3300025926 | Ga0207659_10509067 | Ga0207659_105090671 | 158 |
| 66 | 3300031548 | Ga0307408_100033768 | Ga0307408_1000337681 | 158 |
| 67 | 3300031852 | Ga0307410_10430528 | Ga0307410_104305282 | 158 |
| 68 | 3300031901 | Ga0307406_10723027 | Ga0307406_107230272 | 158 |
| 69 | 3300031903 | Ga0307407_10382495 | Ga0307407_103824952 | 158 |
| 70 | 3300031995 | Ga0307409_100454555 | Ga0307409_1004545551 | 158 |
| 71 | 3300032002 | Ga0307416_100071126 | Ga0307416_1000711262 | 158 |
| 72 | 3300032005 | Ga0307411_10140289 | Ga0307411_101402892 | 158 |
| 73 | 3300032126 | Ga0307415_100993180 | Ga0307415_1009931802 | 158 |
| 74 | 3300041408 | Ga0439453_0013715 | Ga0439453_0013715_788_1291 | 158 |
| 75 | 3300042436 | Ga0439435_0029827 | Ga0439435_0029827_86_589 | 158 |
| 76 | 3300042437 | Ga0439444_0097088 | Ga0439444_0097088_97_600 | 158 |
| 77 | 3300049515 | Ga0501292_002776 | Ga0501292_002776_1430_1933 | 158 |
| 78 | 3300049652 | Ga0501202_119263 | Ga0501202_119263_65_568 | 158 |
| 79 | 3300049705 | Ga0501225_0013109 | Ga0501225_0013109_1530_2033 | 158 |
| 80 | 3300049851 | Ga0501212_041102 | Ga0501212_041102_184_687 | 158 |
| 81 | 3300050507 | nmdc:mga05p37_126339_c1 | nmdc:mga05p37_126339_c1_24_527 | 158 |
| 82 | 3300050507 | nmdc:mga05p37_220569_c1 | nmdc:mga05p37_220569_c1_1299_1802 | 158 |
| 83 | 3300050508 | nmdc:mga09592_1343_c2 | nmdc:mga09592_1343_c2_2652_3155 | 158 |
| 84 | 3300050508 | nmdc:mga09592_410587_c1 | nmdc:mga09592_410587_c1_350_853 | 158 |
| 85 | 3300050509 | nmdc:mga0qj67_79593_c1 | nmdc:mga0qj67_79593_c1_662_1165 | 158 |
| 86 | 3300050510 | nmdc:mga06r32_79510_c1 | nmdc:mga06r32_79510_c1_1891_2394 | 158 |
| 87 | 3300050511 | nmdc:mga08y16_63648_c1 | nmdc:mga08y16_63648_c1_2016_2519 | 158 |
| 88 | 3300050515 | nmdc:mga0a205_11425_c1 | nmdc:mga0a205_11425_c1_2597_3100 | 158 |
| 89 | 3300003320 | rootH2_10080407 | rootH2_100804076 | 159 |
| 90 | 3300005293 | Ga0065715_10435577 | Ga0065715_104355771 | 159 |
| 91 | 3300005329 | Ga0070683_100072561 | Ga0070683_1000725613 | 159 |
| 92 | 3300005330 | Ga0070690_100122729 | Ga0070690_1001227292 | 159 |
| 93 | 3300005331 | Ga0070670_100003527 | Ga0070670_1000035273 | 159 |
| 94 | 3300005331 | Ga0070670_100137747 | Ga0070670_1001377473 | 159 |
| 95 | 3300005331 | Ga0070670_101231251 | Ga0070670_1012312512 | 159 |
| 96 | 3300005334 | Ga0068869_100035065 | Ga0068869_1000350654 | 159 |
| 97 | 3300005335 | Ga0070666_10525912 | Ga0070666_105259122 | 159 |
| 98 | 3300005336 | Ga0070680_100004200 | Ga0070680_1000042004 | 159 |
| 99 | 3300005337 | Ga0070682_100008101 | Ga0070682_1000081014 | 159 |
| 100 | 3300005340 | Ga0070689_100098387 | Ga0070689_1000983872 | 159 |
| 101 | 3300005345 | Ga0070692_10137408 | Ga0070692_101374082 | 159 |
| 102 | 3300005354 | Ga0070675_100002385 | Ga0070675_10000238510 | 159 |
| 103 | 3300005355 | Ga0070671_100683415 | Ga0070671_1006834152 | 159 |
| 104 | 3300005356 | Ga0070674_100556348 | Ga0070674_1005563482 | 159 |
| 105 | 3300005364 | Ga0070673_100348788 | Ga0070673_1003487881 | 159 |
| 106 | 3300005366 | Ga0070659_100046796 | Ga0070659_1000467962 | 159 |
| 107 | 3300005440 | Ga0070705_100315008 | Ga0070705_1003150082 | 159 |
| 108 | 3300005458 | Ga0070681_10037260 | Ga0070681_100372604 | 159 |
| 109 | 3300005471 | Ga0070698_100028379 | Ga0070698_1000283793 | 159 |
| 110 | 3300005518 | Ga0070699_100000932 | Ga0070699_1000009327 | 159 |
| 111 | 3300005530 | Ga0070679_100004341 | Ga0070679_1000043414 | 159 |
| 112 | 3300005535 | Ga0070684_100035141 | Ga0070684_1000351415 | 159 |
| 113 | 3300005539 | Ga0068853_100199576 | Ga0068853_1001995762 | 159 |
| 114 | 3300005539 | Ga0068853_100232239 | Ga0068853_1002322392 | 159 |
| 115 | 3300005545 | Ga0070695_100030737 | Ga0070695_1000307372 | 159 |
| 116 | 3300005547 | Ga0070693_100012705 | Ga0070693_1000127055 | 159 |
| 117 | 3300005548 | Ga0070665_100000085 | Ga0070665_100000085142 | 159 |
| 118 | 3300005563 | Ga0068855_100013905 | Ga0068855_1000139054 | 159 |
| 119 | 3300005564 | Ga0070664_100033768 | Ga0070664_1000337682 | 159 |
| 120 | 3300005614 | Ga0068856_100000688 | Ga0068856_10000068833 | 159 |
| 121 | 3300005614 | Ga0068856_101207972 | Ga0068856_1012079721 | 159 |
| 122 | 3300005615 | Ga0070702_100313136 | Ga0070702_1003131362 | 159 |
| 123 | 3300005616 | Ga0068852_100044250 | Ga0068852_1000442502 | 159 |
| 124 | 3300005617 | Ga0068859_100006306 | Ga0068859_1000063063 | 159 |
| 125 | 3300005617 | Ga0068859_100462308 | Ga0068859_1004623083 | 159 |
| 126 | 3300005618 | Ga0068864_100003639 | Ga0068864_10000363910 | 159 |
| 127 | 3300005840 | Ga0068870_10028396 | Ga0068870_100283962 | 159 |
| 128 | 3300005841 | Ga0068863_100065951 | Ga0068863_1000659513 | 159 |
| 129 | 3300005842 | Ga0068858_100243448 | Ga0068858_1002434482 | 159 |
| 130 | 3300006237 | Ga0097621_100062657 | Ga0097621_1000626571 | 159 |
| 131 | 3300006846 | Ga0075430_100097958 | Ga0075430_1000979581 | 159 |
| 132 | 3300006847 | Ga0075431_100148937 | Ga0075431_1001489373 | 159 |
| 133 | 3300006871 | Ga0075434_100010195 | Ga0075434_1000101954 | 159 |
| 134 | 3300006880 | Ga0075429_100013175 | Ga0075429_1000131753 | 159 |
| 135 | 3300006880 | Ga0075429_100170811 | Ga0075429_1001708114 | 159 |
| 136 | 3300006931 | Ga0097620_100006306 | Ga0097620_1000063063 | 159 |
| 137 | 3300006931 | Ga0097620_100462352 | Ga0097620_1004623523 | 159 |
| 138 | 3300009093 | Ga0105240_10526099 | Ga0105240_105260992 | 159 |
| 139 | 3300009094 | Ga0111539_10808594 | Ga0111539_108085942 | 159 |
| 140 | 3300009098 | Ga0105245_10017885 | Ga0105245_100178854 | 159 |
| 141 | 3300009147 | Ga0114129_10299843 | Ga0114129_102998433 | 159 |
| 142 | 3300009174 | Ga0105241_10030005 | Ga0105241_100300054 | 159 |
| 143 | 3300009177 | Ga0105248_10005447 | Ga0105248_100054473 | 159 |
| 144 | 3300009553 | Ga0105249_10348838 | Ga0105249_103488383 | 159 |
| 145 | 3300010375 | Ga0105239_10126830 | Ga0105239_101268303 | 159 |
| 146 | 3300011119 | Ga0105246_10074022 | Ga0105246_100740223 | 159 |
| 147 | 3300013100 | Ga0157373_10009506 | Ga0157373_100095064 | 159 |
| 148 | 3300013102 | Ga0157371_10008259 | Ga0157371_100082595 | 159 |
| 149 | 3300013296 | Ga0157374_10010400 | Ga0157374_100104003 | 159 |
| 150 | 3300013307 | Ga0157372_10031059 | Ga0157372_100310594 | 159 |
| 151 | 3300013307 | Ga0157372_10211189 | Ga0157372_102111893 | 159 |
| 152 | 3300013308 | Ga0157375_11271323 | Ga0157375_112713232 | 159 |
| 153 | 3300014325 | Ga0163163_10081173 | Ga0163163_100811734 | 159 |
| 154 | 3300014745 | Ga0157377_10095358 | Ga0157377_100953582 | 159 |
| 155 | 3300025908 | Ga0207643_10152784 | Ga0207643_101527842 | 159 |
| 156 | 3300025911 | Ga0207654_10336634 | Ga0207654_103366342 | 159 |
| 157 | 3300025912 | Ga0207707_10038284 | Ga0207707_100382842 | 159 |
| 158 | 3300025916 | Ga0207663_10862579 | Ga0207663_108625791 | 159 |
| 159 | 3300025917 | Ga0207660_10237788 | Ga0207660_102377882 | 159 |
| 160 | 3300025919 | Ga0207657_10065111 | Ga0207657_100651113 | 159 |
| 161 | 3300025921 | Ga0207652_10078393 | Ga0207652_100783933 | 159 |
| 162 | 3300025925 | Ga0207650_10053017 | Ga0207650_100530172 | 159 |
| 163 | 3300025927 | Ga0207687_10249361 | Ga0207687_102493612 | 159 |
| 164 | 3300025931 | Ga0207644_10666804 | Ga0207644_106668042 | 159 |
| 165 | 3300025932 | Ga0207690_10319065 | Ga0207690_103190652 | 159 |
| 166 | 3300025932 | Ga0207690_10556228 | Ga0207690_105562282 | 159 |
| 167 | 3300025933 | Ga0207706_10028079 | Ga0207706_100280793 | 159 |
| 168 | 3300025936 | Ga0207670_10332092 | Ga0207670_103320922 | 159 |
| 169 | 3300025937 | Ga0207669_10774292 | Ga0207669_107742921 | 159 |
| 170 | 3300025942 | Ga0207689_10013503 | Ga0207689_100135036 | 159 |
| 171 | 3300025944 | Ga0207661_10000796 | Ga0207661_1000079617 | 159 |
| 172 | 3300025945 | Ga0207679_10212754 | Ga0207679_102127542 | 159 |
| 173 | 3300025960 | Ga0207651_10445514 | Ga0207651_104455141 | 159 |
| 174 | 3300025961 | Ga0207712_10528953 | Ga0207712_105289532 | 159 |
| 175 | 3300026023 | Ga0207677_10042178 | Ga0207677_100421784 | 159 |
| 176 | 3300026035 | Ga0207703_10129343 | Ga0207703_101293433 | 159 |
| 177 | 3300026041 | Ga0207639_10062338 | Ga0207639_100623382 | 159 |
| 178 | 3300026041 | Ga0207639_10209880 | Ga0207639_102098802 | 159 |
| 179 | 3300026067 | Ga0207678_10065026 | Ga0207678_100650265 | 159 |
| 180 | 3300026078 | Ga0207702_10012961 | Ga0207702_100129614 | 159 |
| 181 | 3300026078 | Ga0207702_11134305 | Ga0207702_111343052 | 159 |
| 182 | 3300026088 | Ga0207641_10033286 | Ga0207641_100332864 | 159 |
| 183 | 3300026095 | Ga0207676_10021368 | Ga0207676_100213683 | 159 |
| 184 | 3300026116 | Ga0207674_10000736 | Ga0207674_1000073635 | 159 |
| 185 | 3300027471 | Ga0209995_1000365 | Ga0209995_10003658 | 159 |
| 186 | 3300027543 | Ga0209999_1005858 | Ga0209999_10058582 | 159 |
| 187 | 3300027695 | Ga0209966_1002289 | Ga0209966_10022892 | 159 |
| 188 | 3300028379 | Ga0268266_10000649 | Ga0268266_1000064925 | 159 |
| 189 | 3300028381 | Ga0268264_10039966 | Ga0268264_100399663 | 159 |
| 190 | 3300028794 | Ga0307515_10000024 | Ga0307515_10000024237 | 159 |
| 191 | 3300031240 | Ga0265320_10056768 | Ga0265320_100567682 | 159 |
| 192 | 3300031241 | Ga0265325_10043911 | Ga0265325_100439113 | 159 |
| 193 | 3300031242 | Ga0265329_10124302 | Ga0265329_101243021 | 159 |
| 194 | 3300031250 | Ga0265331_10027178 | Ga0265331_100271783 | 159 |
| 195 | 3300031344 | Ga0265316_10003739 | Ga0265316_1000373914 | 159 |
| 196 | 3300031595 | Ga0265313_10002143 | Ga0265313_1000214316 | 159 |
| 197 | 3300031731 | Ga0307405_10201501 | Ga0307405_102015013 | 159 |
| 198 | 3300031903 | Ga0307407_10083347 | Ga0307407_100833473 | 159 |
| 199 | 3300032002 | Ga0307416_100188572 | Ga0307416_1001885722 | 159 |
| 200 | 3300032004 | Ga0307414_10266591 | Ga0307414_102665912 | 159 |
| 201 | 3300032005 | Ga0307411_10283253 | Ga0307411_102832533 | 159 |
| 202 | 3300032126 | Ga0307415_100055775 | Ga0307415_1000557754 | 159 |
| 203 | 3300035170 | Ga0373943_0527423 | Ga0373943_0527423_32_547 | 159 |
| 204 | 3300035724 | Ga0373933_0360054 | Ga0373933_0360054_313_831 | 159 |
| 205 | 3300036401 | Ga0373937_0603681 | Ga0373937_0603681_315_833 | 159 |
| 206 | 3300037418 | Ga0395900_0948120 | Ga0395900_0948120_95_622 | 159 |
| 207 | 3300037471 | Ga0395905_0094025 | Ga0395905_0094025_1525_2106 | 159 |
| 208 | 3300037471 | Ga0395905_0587952 | Ga0395905_0587952_418_945 | 159 |
| 209 | 3300038443 | Ga0395901_0557137 | Ga0395901_0557137_344_856 | 159 |
| 210 | 3300041486 | Ga0451807_0928212 | Ga0451807_0928212_393_923 | 159 |
| 211 | 3300044673 | Ga0453683_0389973 | Ga0453683_0389973_108_626 | 159 |
| 212 | 3300046543 | Ga0495645_0037684 | Ga0495645_0037684_2360_2884 | 159 |
| 213 | 3300047472 | Ga0495686_0192480 | Ga0495686_0192480_660_1163 | 159 |
| 214 | 3300048918 | Ga0496115_0177561 | Ga0496115_0177561_642_1145 | 159 |
| 215 | 3300049577 | Ga0501041_0362033 | Ga0501041_0362033_327_842 | 159 |
| 216 | 3300049583 | Ga0501067_0179403 | Ga0501067_0179403_137_691 | 159 |
| 217 | 3300049589 | Ga0501073_0001776 | Ga0501073_0001776_8995_9549 | 159 |
| 218 | 3300049592 | Ga0501076_0865837 | Ga0501076_0865837_186_701 | 159 |
| 219 | 3300049593 | Ga0501077_0098717 | Ga0501077_0098717_65_571 | 159 |
| 220 | 3300049593 | Ga0501077_0541823 | Ga0501077_0541823_50_565 | 159 |
| 221 | 3300049672 | Ga0501239_013419 | Ga0501239_013419_423_917 | 159 |
| 222 | 3300049741 | Ga0501079_0282217 | Ga0501079_0282217_45_551 | 159 |
| 223 | 3300049742 | Ga0501080_0079323 | Ga0501080_0079323_631_1185 | 159 |
| 224 | 3300049744 | Ga0501083_0142453 | Ga0501083_0142453_804_1358 | 159 |
| 225 | 3300050493 | nmdc:mga0k408_32609_c2 | nmdc:mga0k408_32609_c2_973_1494 | 159 |
| 226 | 3300050507 | nmdc:mga05p37_322155_c1 | nmdc:mga05p37_322155_c1_139_675 | 159 |
| 227 | 3300050508 | nmdc:mga09592_64515_c1 | nmdc:mga09592_64515_c1_835_1347 | 159 |
| 228 | 3300050508 | nmdc:mga09592_687190_c1 | nmdc:mga09592_687190_c1_151_663 | 159 |
| 229 | 3300050509 | nmdc:mga0qj67_47529_c1 | nmdc:mga0qj67_47529_c1_2809_3321 | 159 |
| 230 | 3300050510 | nmdc:mga06r32_101529_c1 | nmdc:mga06r32_101529_c1_1757_2269 | 159 |
| 231 | 3300050510 | nmdc:mga06r32_263_c5 | nmdc:mga06r32_263_c5_4335_4886 | 159 |
| 232 | 3300050513 | nmdc:mga0rr50_95169_c1 | nmdc:mga0rr50_95169_c1_252_761 | 159 |
| 233 | 3300054114 | Ga0501084_0053643 | Ga0501084_0053643_1743_2297 | 159 |
| 234 | 3300060353 | Ga0501082_0266755 | Ga0501082_0266755_438_953 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o7k-assembly1.cif.gz_A | crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae | 0.9351 | 2 | 156 |
| 2q37-assembly1.cif.gz_A-2 | crystal structure of ohcu decarboxylase in the presence of (s)-allantoin | 0.9299 | 19 | 158 |
| 3o7j-assembly1.cif.gz_A | crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae | 0.9023 | 1 | 156 |
| 3o7k-assembly1.cif.gz_A | crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae | 0.8904 | 2 | 156 |
| 3o7j-assembly1.cif.gz_A | crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae | 0.8813 | 1 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MM35_6_163_1.10.3330.10 | Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | 0.9488 | 15 | 158 | 1.10.3330.10 |
| 2q37A00 | Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | 0.915 | 19 | 158 | 1.10.3330.10 |
| 3o7jA00 | Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | 0.9023 | 1 | 156 | 1.10.3330.10 |
| 3o7jA00 | Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | 0.8813 | 1 | 156 | 1.10.3330.10 |
| 3o7iB00 | Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | 0.8777 | 2 | 156 | 1.10.3330.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7RUN7-F1-model_v4 | allantoinase (EC 3.5.2.5) | 0.9959 | 3 | 158 |
GO:0000256
GO:0004038 GO:0005737 GO:0006145 GO:0008270 GO:0050897 |
| AF-A0A0L8QSP9-F1-model_v4 | deleted | 0.9936 | 79 | 157 |
|
| AF-A0A843SSS9-F1-model_v4 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) | 0.9934 | 1 | 159 |
GO:0005777
GO:0006144 GO:0019628 GO:0051997 |
| AF-A0A1I0R7Z9-F1-model_v4 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) | 0.9927 | 5 | 158 |
GO:0005777
GO:0006144 GO:0019628 GO:0051997 |
| AF-A0A522YS02-F1-model_v4 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) | 0.9922 | 1 | 158 |
GO:0005777
GO:0006144 GO:0019628 GO:0051997 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar