F347191

General Info

Members Datasets Scaffolds Average Seq Length
234 181 234 168

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10528953|Ga0207712_105289532
Length 196
Sequence MAESVDCVWLAWQSERRDMPQQSNNLSGSGLERLNEMSEPEAHEMLIAVCGSKQWVDRMIARRPFASADALYAAADETWFALEKQSWLEAFSHHPRIGERNLARAKFAATAAQSSKEQSGMAGATEAVRTEFASGNAEYEKKFGHVFLICATGKTGEEMLDSLRERTENDAATELRNAANEQSKIVRIRLGKLVEA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
153 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
154 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
155 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
156 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
157 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
158 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
159 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
160 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
161 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
167 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
168 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
169 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
170 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
171 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0.85
Rhizosphere 97.44
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10080407 3300003320 Bacteria 3283
2 Ga0065712_10379133 3300005290 Bacteria 754
3 Ga0065715_10435577 3300005293 Bacteria 842
4 Ga0070683_100072561 3300005329 Bacteria 3213
5 Ga0070690_100122729 3300005330 Unclassified 1745
6 Ga0070670_100003527 3300005331 Bacteria 13006
7 Ga0070670_100137747 3300005331 Bacteria 2110
8 Ga0070670_101231251 3300005331 Bacteria 684
9 Ga0068869_100035065 3300005334 Bacteria 3554
10 Ga0070666_10525912 3300005335 Bacteria 859
11 Ga0070680_100004200 3300005336 Bacteria 10799
12 Ga0070682_100008101 3300005337 Bacteria 5923
13 Ga0070689_100098387 3300005340 Bacteria 2314
14 Ga0070687_100452392 3300005343 Bacteria 854
15 Ga0070692_10137408 3300005345 Bacteria 1380
16 Ga0070675_100002385 3300005354 Bacteria 13992
17 Ga0070675_100693465 3300005354 Unclassified 927
18 Ga0070671_100683415 3300005355 Bacteria 890
19 Ga0070674_100556348 3300005356 Bacteria 963
20 Ga0070673_100348788 3300005364 Bacteria 1313
21 Ga0070688_100131496 3300005365 Bacteria 1689
22 Ga0070659_100046796 3300005366 Bacteria 3391
23 Ga0070711_100686702 3300005439 Unclassified 861
24 Ga0070705_100315008 3300005440 Bacteria 1127
25 Ga0070681_10037260 3300005458 Bacteria 4881
26 Ga0070706_100057052 3300005467 Bacteria 3603
27 Ga0070706_100098220 3300005467 Bacteria 2721
28 Ga0070707_100186931 3300005468 Bacteria 2020
29 Ga0070698_100028379 3300005471 Bacteria 5813
30 Ga0070698_100111199 3300005471 Bacteria 2704
31 Ga0070698_100131437 3300005471 Bacteria 2459
32 Ga0070699_100000932 3300005518 Bacteria 27306
33 Ga0070699_100299808 3300005518 Unclassified 1442
34 Ga0070679_100004341 3300005530 Bacteria 13095
35 Ga0070684_100035141 3300005535 Bacteria 4288
36 Ga0068853_100199576 3300005539 Unclassified 1820
37 Ga0068853_100232239 3300005539 Bacteria 1688
38 Ga0068853_101134211 3300005539 Bacteria 754
39 Ga0070695_100030737 3300005545 Bacteria 3345
40 Ga0070696_100020415 3300005546 Bacteria 4490
41 Ga0070693_100012705 3300005547 Bacteria 4268
42 Ga0070665_100000085 3300005548 Bacteria 180238
43 Ga0068855_100013905 3300005563 Bacteria 9707
44 Ga0070664_100033768 3300005564 Bacteria 4288
45 Ga0068854_100751466 3300005578 Unclassified 846
46 Ga0068856_100000688 3300005614 Bacteria 36724
47 Ga0068856_101207972 3300005614 Bacteria 772
48 Ga0070702_100313136 3300005615 Bacteria 1090
49 Ga0068852_100044250 3300005616 Bacteria 3780
50 Ga0068859_100006306 3300005617 Bacteria 12028
51 Ga0068859_100052500 3300005617 Bacteria 4099
52 Ga0068859_100462308 3300005617 Bacteria 1365
53 Ga0068864_100003639 3300005618 Bacteria 12740
54 Ga0068870_10028396 3300005840 Bacteria 2809
55 Ga0068863_100065951 3300005841 Bacteria 3425
56 Ga0068858_100243448 3300005842 Bacteria 1707
57 Ga0081539_10000559 3300005985 Bacteria 76871
58 Ga0097621_100062657 3300006237 Bacteria 3054
59 Ga0068871_101813555 3300006358 Unclassified 579
60 Ga0075428_100035989 3300006844 Bacteria 5456
61 Ga0075430_100097958 3300006846 Bacteria 2450
62 Ga0075431_100022855 3300006847 Bacteria 6392
63 Ga0075431_100148937 3300006847 Bacteria 2410
64 Ga0075434_100010195 3300006871 Bacteria 8799
65 Ga0075429_100013175 3300006880 Bacteria 7173
66 Ga0075429_100068526 3300006880 Bacteria 3088
67 Ga0075429_100170811 3300006880 Bacteria 1904
68 Ga0097620_100006306 3300006931 Bacteria 12028
69 Ga0097620_100052500 3300006931 Bacteria 4099
70 Ga0097620_100462352 3300006931 Bacteria 1365
71 Ga0105240_10526099 3300009093 Bacteria 1312
72 Ga0111539_10055596 3300009094 Bacteria 4705
73 Ga0111539_10808594 3300009094 Bacteria 1091
74 Ga0105245_10017885 3300009098 Bacteria 6191
75 Ga0114129_10234723 3300009147 Bacteria 2469
76 Ga0114129_10299843 3300009147 Bacteria 2142
77 Ga0105241_10030005 3300009174 Bacteria 4061
78 Ga0105242_10173526 3300009176 Bacteria 1896
79 Ga0105248_10005447 3300009177 Bacteria 13986
80 Ga0105249_10348838 3300009553 Bacteria 1499
81 Ga0105239_10126830 3300010375 Bacteria 2837
82 Ga0105246_10074022 3300011119 Bacteria 2406
83 Ga0157373_10009506 3300013100 Bacteria 7181
84 Ga0157371_10008259 3300013102 Bacteria 8317
85 Ga0157374_10010400 3300013296 Bacteria 8000
86 Ga0157374_10279644 3300013296 Bacteria 1648
87 Ga0157372_10031059 3300013307 Bacteria 5847
88 Ga0157372_10211189 3300013307 Bacteria 2249
89 Ga0157375_11271323 3300013308 Bacteria 864
90 Ga0163163_10081173 3300014325 Bacteria 3244
91 Ga0157380_10236786 3300014326 Bacteria 1643
92 Ga0182008_10085265 3300014497 Bacteria 1556
93 Ga0157377_10095358 3300014745 Bacteria 1763
94 Ga0207643_10152784 3300025908 Bacteria 1385
95 Ga0207684_10136523 3300025910 Bacteria 2106
96 Ga0207684_10156858 3300025910 Bacteria 1959
97 Ga0207654_10336634 3300025911 Bacteria 1036
98 Ga0207707_10038284 3300025912 Bacteria 4191
99 Ga0207663_10862579 3300025916 Unclassified 723
100 Ga0207660_10237788 3300025917 Bacteria 1434
101 Ga0207657_10065111 3300025919 Bacteria 3108
102 Ga0207652_10078393 3300025921 Bacteria 2884
103 Ga0207646_10053183 3300025922 Bacteria 3622
104 Ga0207650_10053017 3300025925 Bacteria 3005
105 Ga0207659_10509067 3300025926 Bacteria 1020
106 Ga0207687_10249361 3300025927 Bacteria 1411
107 Ga0207644_10666804 3300025931 Bacteria 866
108 Ga0207690_10319065 3300025932 Bacteria 1221
109 Ga0207690_10556228 3300025932 Bacteria 933
110 Ga0207706_10028079 3300025933 Bacteria 5027
111 Ga0207686_10208263 3300025934 Bacteria 1404
112 Ga0207670_10332092 3300025936 Bacteria 1199
113 Ga0207669_10774292 3300025937 Bacteria 794
114 Ga0207689_10013503 3300025942 Bacteria 6974
115 Ga0207661_10000796 3300025944 Bacteria 20630
116 Ga0207679_10212754 3300025945 Bacteria 1622
117 Ga0207651_10445514 3300025960 Bacteria 1110
118 Ga0207712_10528953 3300025961 Bacteria 1011
119 Ga0207677_10042178 3300026023 Bacteria 3024
120 Ga0207703_10129343 3300026035 Bacteria 2178
121 Ga0207639_10062338 3300026041 Bacteria 2883
122 Ga0207639_10209880 3300026041 Unclassified 1675
123 Ga0207678_10065026 3300026067 Bacteria 3133
124 Ga0207702_10012961 3300026078 Bacteria 6935
125 Ga0207702_11134305 3300026078 Bacteria 776
126 Ga0207641_10033286 3300026088 Bacteria 4282
127 Ga0207676_10021368 3300026095 Bacteria 4746
128 Ga0207674_10000736 3300026116 Bacteria 42809
129 Ga0209995_1000365 3300027471 Bacteria 7041
130 Ga0209999_1005858 3300027543 Bacteria 2209
131 Ga0209966_1002289 3300027695 Bacteria 3193
132 Ga0209998_10000087 3300027717 Bacteria 36016
133 Ga0268266_10000649 3300028379 Bacteria 47110
134 Ga0268264_10039966 3300028381 Bacteria 3875
135 Ga0307515_10000024 3300028794 Bacteria 393119
136 Ga0265320_10056768 3300031240 Bacteria 1880
137 Ga0265325_10043911 3300031241 Bacteria 2330
138 Ga0265329_10124302 3300031242 Unclassified 828
139 Ga0265331_10027178 3300031250 Bacteria 2871
140 Ga0265316_10003739 3300031344 Bacteria 15289
141 Ga0307408_100033768 3300031548 Bacteria 3577
142 Ga0265313_10002143 3300031595 Bacteria 17555
143 Ga0307405_10201501 3300031731 Bacteria 1446
144 Ga0307405_10366739 3300031731 Bacteria 1116
145 Ga0307410_10430528 3300031852 Bacteria 1072
146 Ga0307406_10723027 3300031901 Bacteria 833
147 Ga0307407_10083347 3300031903 Bacteria 1940
148 Ga0307407_10382495 3300031903 Unclassified 1005
149 Ga0307407_10407377 3300031903 Unclassified 977
150 Ga0307412_10553877 3300031911 Unclassified 966
151 Ga0307412_10718950 3300031911 Unclassified 859
152 Ga0307409_100226754 3300031995 Bacteria 1690
153 Ga0307409_100454555 3300031995 Bacteria 1237
154 Ga0307409_100987397 3300031995 Unclassified 859
155 Ga0307409_101479512 3300031995 Unclassified 706
156 Ga0307416_100016847 3300032002 Bacteria 5093
157 Ga0307416_100071126 3300032002 Bacteria 2888
158 Ga0307416_100188572 3300032002 Bacteria 1942
159 Ga0307414_10266591 3300032004 Bacteria 1432
160 Ga0307411_10140289 3300032005 Bacteria 1781
161 Ga0307411_10283253 3300032005 Bacteria 1320
162 Ga0307411_10413976 3300032005 Bacteria 1118
163 Ga0307415_100055775 3300032126 Bacteria 2706
164 Ga0307415_100378200 3300032126 Bacteria 1201
165 Ga0307415_100559780 3300032126 Unclassified 1010
166 Ga0307415_100993180 3300032126 Bacteria 780
167 Ga0373943_0527423 3300035170 Bacteria 692
168 Ga0373933_0360054 3300035724 Bacteria 946
169 Ga0373937_0603681 3300036401 Bacteria 1042
170 Ga0395900_0948120 3300037418 Bacteria 782
171 Ga0395905_0021861 3300037471 Bacteria 6050
172 Ga0395905_0094025 3300037471 Bacteria 2812
173 Ga0395905_0587952 3300037471 Unclassified 1015
174 Ga0395901_0557137 3300038443 Unclassified 1161
175 Ga0439453_0013715 3300041408 Bacteria 1381
176 Ga0451807_0928212 3300041486 Bacteria 1019
177 Ga0451853_3939986 3300041512 Unclassified 530
178 Ga0439435_0029827 3300042436 Bacteria 1475
179 Ga0439444_0097088 3300042437 Unclassified 664
180 Ga0453683_0389973 3300044673 Bacteria 897
181 Ga0495629_0004571 3300046459 Bacteria 10353
182 Ga0495645_0037684 3300046543 Bacteria 3526
183 Ga0495658_0043625 3300046683 Bacteria 2509
184 Ga0495581_0011938 3300047315 Bacteria 5025
185 Ga0495686_0192480 3300047472 Bacteria 1175
186 Ga0496115_0177561 3300048918 Unclassified 1761
187 Ga0501292_002776 3300049515 Bacteria 2285
188 Ga0501041_0362033 3300049577 Bacteria 917
189 Ga0501067_0179403 3300049583 Bacteria 1179
190 Ga0501073_0001776 3300049589 Bacteria 16033
191 Ga0501076_0865837 3300049592 Bacteria 745
192 Ga0501077_0098717 3300049593 Bacteria 1851
193 Ga0501077_0541823 3300049593 Bacteria 747
194 Ga0501202_119263 3300049652 Bacteria 661
195 Ga0501216_073105 3300049660 Unclassified 712
196 Ga0501224_005757 3300049664 Bacteria 1786
197 Ga0501233_001771 3300049668 Bacteria 3728
198 Ga0501235_026166 3300049669 Bacteria 1306
199 Ga0501239_002076 3300049672 Bacteria 1788
200 Ga0501239_013419 3300049672 Unclassified 938
201 Ga0501250_018666 3300049680 Unclassified 880
202 Ga0501256_051809 3300049685 Bacteria 507
203 Ga0501259_008820 3300049688 Bacteria 1630
204 Ga0501261_039769 3300049690 Unclassified 738
205 Ga0501225_0004652 3300049705 Bacteria 4073
206 Ga0501225_0013109 3300049705 Bacteria 2321
207 Ga0501079_0282217 3300049741 Bacteria 1299
208 Ga0501080_0079323 3300049742 Bacteria 3052
209 Ga0501083_0142453 3300049744 Bacteria 1569
210 Ga0501265_014176 3300049762 Unclassified 1011
211 Ga0501266_008171 3300049763 Bacteria 1317
212 Ga0501267_009151 3300049764 Bacteria 986
213 Ga0501268_006456 3300049765 Bacteria 1721
214 Ga0501274_010934 3300049771 Bacteria 842
215 Ga0501212_041102 3300049851 Bacteria 765
216 nmdc:mga0k408_32609_c2 3300050493 Unclassified 2025
217 nmdc:mga05p37_126339_c1 3300050507 Bacteria 3140
218 nmdc:mga05p37_220569_c1 3300050507 Bacteria 2289
219 nmdc:mga05p37_322155_c1 3300050507 Bacteria 1829
220 nmdc:mga09592_1343_c2 3300050508 Bacteria 11749
221 nmdc:mga09592_410587_c1 3300050508 Bacteria 1170
222 nmdc:mga09592_64515_c1 3300050508 Bacteria 3101
223 nmdc:mga09592_687190_c1 3300050508 Bacteria 872
224 nmdc:mga0qj67_47529_c1 3300050509 Bacteria 3390
225 nmdc:mga0qj67_79593_c1 3300050509 Bacteria 2625
226 nmdc:mga06r32_101529_c1 3300050510 Bacteria 2823
227 nmdc:mga06r32_263_c5 3300050510 Bacteria 13218
228 nmdc:mga06r32_79510_c1 3300050510 Bacteria 3190
229 nmdc:mga08y16_63648_c1 3300050511 Bacteria 3852
230 nmdc:mga0rr50_95169_c1 3300050513 Bacteria 2327
231 nmdc:mga0a205_11425_c1 3300050515 Bacteria 8174
232 Ga0501084_0053643 3300054114 Bacteria 3373
233 Ga0501082_0266755 3300060353 Bacteria 1490
234 Ga0501082_1087481 3300060353 Unclassified 699

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100686702 Ga0070711_1006867022 129
2 3300005539 Ga0068853_101134211 Ga0068853_1011342112 129
3 3300049660 Ga0501216_073105 Ga0501216_073105_66_464 129
4 3300049690 Ga0501261_039769 Ga0501261_039769_325_723 129
5 3300060353 Ga0501082_1087481 Ga0501082_1087481_29_454 135
6 3300046459 Ga0495629_0004571 Ga0495629_0004571_9329_9859 149
7 3300046683 Ga0495658_0043625 Ga0495658_0043625_1237_1767 149
8 3300047315 Ga0495581_0011938 Ga0495581_0011938_3986_4516 149
9 3300005467 Ga0070706_100098220 Ga0070706_1000982202 150
10 3300005467 Ga0070706_100057052 Ga0070706_1000570523 151
11 3300005471 Ga0070698_100111199 Ga0070698_1001111993 151
12 3300005518 Ga0070699_100299808 Ga0070699_1002998083 151
13 3300025910 Ga0207684_10136523 Ga0207684_101365233 151
14 3300027717 Ga0209998_10000087 Ga0209998_1000008730 151
15 3300031731 Ga0307405_10366739 Ga0307405_103667391 151
16 3300031903 Ga0307407_10407377 Ga0307407_104073772 151
17 3300031911 Ga0307412_10553877 Ga0307412_105538772 151
18 3300031911 Ga0307412_10718950 Ga0307412_107189502 151
19 3300031995 Ga0307409_100226754 Ga0307409_1002267543 151
20 3300031995 Ga0307409_100987397 Ga0307409_1009873972 151
21 3300031995 Ga0307409_101479512 Ga0307409_1014795122 151
22 3300032002 Ga0307416_100016847 Ga0307416_1000168472 151
23 3300032005 Ga0307411_10413976 Ga0307411_104139762 151
24 3300032126 Ga0307415_100378200 Ga0307415_1003782002 151
25 3300032126 Ga0307415_100559780 Ga0307415_1005597801 151
26 3300041512 Ga0451853_3939986 Ga0451853_3939986_23_502 151
27 3300049664 Ga0501224_005757 Ga0501224_005757_575_1033 151
28 3300049668 Ga0501233_001771 Ga0501233_001771_1032_1490 151
29 3300049669 Ga0501235_026166 Ga0501235_026166_338_796 151
30 3300049672 Ga0501239_002076 Ga0501239_002076_988_1446 151
31 3300049680 Ga0501250_018666 Ga0501250_018666_256_714 151
32 3300049685 Ga0501256_051809 Ga0501256_051809_12_470 151
33 3300049688 Ga0501259_008820 Ga0501259_008820_493_951 151
34 3300049705 Ga0501225_0004652 Ga0501225_0004652_2499_2957 151
35 3300049762 Ga0501265_014176 Ga0501265_014176_269_727 151
36 3300049763 Ga0501266_008171 Ga0501266_008171_36_494 151
37 3300049764 Ga0501267_009151 Ga0501267_009151_511_969 151
38 3300049765 Ga0501268_006456 Ga0501268_006456_682_1140 151
39 3300049771 Ga0501274_010934 Ga0501274_010934_163_621 151
40 3300037471 Ga0395905_0021861 Ga0395905_0021861_536_1075 153
41 3300009176 Ga0105242_10173526 Ga0105242_101735262 156
42 3300025934 Ga0207686_10208263 Ga0207686_102082633 156
43 3300006358 Ga0068871_101813555 Ga0068871_1018135551 157
44 3300013296 Ga0157374_10279644 Ga0157374_102796444 157
45 3300014326 Ga0157380_10236786 Ga0157380_102367862 157
46 3300005290 Ga0065712_10379133 Ga0065712_103791332 158
47 3300005343 Ga0070687_100452392 Ga0070687_1004523921 158
48 3300005354 Ga0070675_100693465 Ga0070675_1006934652 158
49 3300005365 Ga0070688_100131496 Ga0070688_1001314962 158
50 3300005468 Ga0070707_100186931 Ga0070707_1001869312 158
51 3300005471 Ga0070698_100131437 Ga0070698_1001314373 158
52 3300005546 Ga0070696_100020415 Ga0070696_1000204154 158
53 3300005578 Ga0068854_100751466 Ga0068854_1007514662 158
54 3300005617 Ga0068859_100052500 Ga0068859_1000525002 158
55 3300005985 Ga0081539_10000559 Ga0081539_1000055929 158
56 3300006844 Ga0075428_100035989 Ga0075428_1000359896 158
57 3300006847 Ga0075431_100022855 Ga0075431_1000228556 158
58 3300006880 Ga0075429_100068526 Ga0075429_1000685262 158
59 3300006931 Ga0097620_100052500 Ga0097620_1000525002 158
60 3300009094 Ga0111539_10055596 Ga0111539_100555962 158
61 3300009147 Ga0114129_10234723 Ga0114129_102347233 158
62 3300014497 Ga0182008_10085265 Ga0182008_100852651 158
63 3300025910 Ga0207684_10156858 Ga0207684_101568582 158
64 3300025922 Ga0207646_10053183 Ga0207646_100531834 158
65 3300025926 Ga0207659_10509067 Ga0207659_105090671 158
66 3300031548 Ga0307408_100033768 Ga0307408_1000337681 158
67 3300031852 Ga0307410_10430528 Ga0307410_104305282 158
68 3300031901 Ga0307406_10723027 Ga0307406_107230272 158
69 3300031903 Ga0307407_10382495 Ga0307407_103824952 158
70 3300031995 Ga0307409_100454555 Ga0307409_1004545551 158
71 3300032002 Ga0307416_100071126 Ga0307416_1000711262 158
72 3300032005 Ga0307411_10140289 Ga0307411_101402892 158
73 3300032126 Ga0307415_100993180 Ga0307415_1009931802 158
74 3300041408 Ga0439453_0013715 Ga0439453_0013715_788_1291 158
75 3300042436 Ga0439435_0029827 Ga0439435_0029827_86_589 158
76 3300042437 Ga0439444_0097088 Ga0439444_0097088_97_600 158
77 3300049515 Ga0501292_002776 Ga0501292_002776_1430_1933 158
78 3300049652 Ga0501202_119263 Ga0501202_119263_65_568 158
79 3300049705 Ga0501225_0013109 Ga0501225_0013109_1530_2033 158
80 3300049851 Ga0501212_041102 Ga0501212_041102_184_687 158
81 3300050507 nmdc:mga05p37_126339_c1 nmdc:mga05p37_126339_c1_24_527 158
82 3300050507 nmdc:mga05p37_220569_c1 nmdc:mga05p37_220569_c1_1299_1802 158
83 3300050508 nmdc:mga09592_1343_c2 nmdc:mga09592_1343_c2_2652_3155 158
84 3300050508 nmdc:mga09592_410587_c1 nmdc:mga09592_410587_c1_350_853 158
85 3300050509 nmdc:mga0qj67_79593_c1 nmdc:mga0qj67_79593_c1_662_1165 158
86 3300050510 nmdc:mga06r32_79510_c1 nmdc:mga06r32_79510_c1_1891_2394 158
87 3300050511 nmdc:mga08y16_63648_c1 nmdc:mga08y16_63648_c1_2016_2519 158
88 3300050515 nmdc:mga0a205_11425_c1 nmdc:mga0a205_11425_c1_2597_3100 158
89 3300003320 rootH2_10080407 rootH2_100804076 159
90 3300005293 Ga0065715_10435577 Ga0065715_104355771 159
91 3300005329 Ga0070683_100072561 Ga0070683_1000725613 159
92 3300005330 Ga0070690_100122729 Ga0070690_1001227292 159
93 3300005331 Ga0070670_100003527 Ga0070670_1000035273 159
94 3300005331 Ga0070670_100137747 Ga0070670_1001377473 159
95 3300005331 Ga0070670_101231251 Ga0070670_1012312512 159
96 3300005334 Ga0068869_100035065 Ga0068869_1000350654 159
97 3300005335 Ga0070666_10525912 Ga0070666_105259122 159
98 3300005336 Ga0070680_100004200 Ga0070680_1000042004 159
99 3300005337 Ga0070682_100008101 Ga0070682_1000081014 159
100 3300005340 Ga0070689_100098387 Ga0070689_1000983872 159
101 3300005345 Ga0070692_10137408 Ga0070692_101374082 159
102 3300005354 Ga0070675_100002385 Ga0070675_10000238510 159
103 3300005355 Ga0070671_100683415 Ga0070671_1006834152 159
104 3300005356 Ga0070674_100556348 Ga0070674_1005563482 159
105 3300005364 Ga0070673_100348788 Ga0070673_1003487881 159
106 3300005366 Ga0070659_100046796 Ga0070659_1000467962 159
107 3300005440 Ga0070705_100315008 Ga0070705_1003150082 159
108 3300005458 Ga0070681_10037260 Ga0070681_100372604 159
109 3300005471 Ga0070698_100028379 Ga0070698_1000283793 159
110 3300005518 Ga0070699_100000932 Ga0070699_1000009327 159
111 3300005530 Ga0070679_100004341 Ga0070679_1000043414 159
112 3300005535 Ga0070684_100035141 Ga0070684_1000351415 159
113 3300005539 Ga0068853_100199576 Ga0068853_1001995762 159
114 3300005539 Ga0068853_100232239 Ga0068853_1002322392 159
115 3300005545 Ga0070695_100030737 Ga0070695_1000307372 159
116 3300005547 Ga0070693_100012705 Ga0070693_1000127055 159
117 3300005548 Ga0070665_100000085 Ga0070665_100000085142 159
118 3300005563 Ga0068855_100013905 Ga0068855_1000139054 159
119 3300005564 Ga0070664_100033768 Ga0070664_1000337682 159
120 3300005614 Ga0068856_100000688 Ga0068856_10000068833 159
121 3300005614 Ga0068856_101207972 Ga0068856_1012079721 159
122 3300005615 Ga0070702_100313136 Ga0070702_1003131362 159
123 3300005616 Ga0068852_100044250 Ga0068852_1000442502 159
124 3300005617 Ga0068859_100006306 Ga0068859_1000063063 159
125 3300005617 Ga0068859_100462308 Ga0068859_1004623083 159
126 3300005618 Ga0068864_100003639 Ga0068864_10000363910 159
127 3300005840 Ga0068870_10028396 Ga0068870_100283962 159
128 3300005841 Ga0068863_100065951 Ga0068863_1000659513 159
129 3300005842 Ga0068858_100243448 Ga0068858_1002434482 159
130 3300006237 Ga0097621_100062657 Ga0097621_1000626571 159
131 3300006846 Ga0075430_100097958 Ga0075430_1000979581 159
132 3300006847 Ga0075431_100148937 Ga0075431_1001489373 159
133 3300006871 Ga0075434_100010195 Ga0075434_1000101954 159
134 3300006880 Ga0075429_100013175 Ga0075429_1000131753 159
135 3300006880 Ga0075429_100170811 Ga0075429_1001708114 159
136 3300006931 Ga0097620_100006306 Ga0097620_1000063063 159
137 3300006931 Ga0097620_100462352 Ga0097620_1004623523 159
138 3300009093 Ga0105240_10526099 Ga0105240_105260992 159
139 3300009094 Ga0111539_10808594 Ga0111539_108085942 159
140 3300009098 Ga0105245_10017885 Ga0105245_100178854 159
141 3300009147 Ga0114129_10299843 Ga0114129_102998433 159
142 3300009174 Ga0105241_10030005 Ga0105241_100300054 159
143 3300009177 Ga0105248_10005447 Ga0105248_100054473 159
144 3300009553 Ga0105249_10348838 Ga0105249_103488383 159
145 3300010375 Ga0105239_10126830 Ga0105239_101268303 159
146 3300011119 Ga0105246_10074022 Ga0105246_100740223 159
147 3300013100 Ga0157373_10009506 Ga0157373_100095064 159
148 3300013102 Ga0157371_10008259 Ga0157371_100082595 159
149 3300013296 Ga0157374_10010400 Ga0157374_100104003 159
150 3300013307 Ga0157372_10031059 Ga0157372_100310594 159
151 3300013307 Ga0157372_10211189 Ga0157372_102111893 159
152 3300013308 Ga0157375_11271323 Ga0157375_112713232 159
153 3300014325 Ga0163163_10081173 Ga0163163_100811734 159
154 3300014745 Ga0157377_10095358 Ga0157377_100953582 159
155 3300025908 Ga0207643_10152784 Ga0207643_101527842 159
156 3300025911 Ga0207654_10336634 Ga0207654_103366342 159
157 3300025912 Ga0207707_10038284 Ga0207707_100382842 159
158 3300025916 Ga0207663_10862579 Ga0207663_108625791 159
159 3300025917 Ga0207660_10237788 Ga0207660_102377882 159
160 3300025919 Ga0207657_10065111 Ga0207657_100651113 159
161 3300025921 Ga0207652_10078393 Ga0207652_100783933 159
162 3300025925 Ga0207650_10053017 Ga0207650_100530172 159
163 3300025927 Ga0207687_10249361 Ga0207687_102493612 159
164 3300025931 Ga0207644_10666804 Ga0207644_106668042 159
165 3300025932 Ga0207690_10319065 Ga0207690_103190652 159
166 3300025932 Ga0207690_10556228 Ga0207690_105562282 159
167 3300025933 Ga0207706_10028079 Ga0207706_100280793 159
168 3300025936 Ga0207670_10332092 Ga0207670_103320922 159
169 3300025937 Ga0207669_10774292 Ga0207669_107742921 159
170 3300025942 Ga0207689_10013503 Ga0207689_100135036 159
171 3300025944 Ga0207661_10000796 Ga0207661_1000079617 159
172 3300025945 Ga0207679_10212754 Ga0207679_102127542 159
173 3300025960 Ga0207651_10445514 Ga0207651_104455141 159
174 3300025961 Ga0207712_10528953 Ga0207712_105289532 159
175 3300026023 Ga0207677_10042178 Ga0207677_100421784 159
176 3300026035 Ga0207703_10129343 Ga0207703_101293433 159
177 3300026041 Ga0207639_10062338 Ga0207639_100623382 159
178 3300026041 Ga0207639_10209880 Ga0207639_102098802 159
179 3300026067 Ga0207678_10065026 Ga0207678_100650265 159
180 3300026078 Ga0207702_10012961 Ga0207702_100129614 159
181 3300026078 Ga0207702_11134305 Ga0207702_111343052 159
182 3300026088 Ga0207641_10033286 Ga0207641_100332864 159
183 3300026095 Ga0207676_10021368 Ga0207676_100213683 159
184 3300026116 Ga0207674_10000736 Ga0207674_1000073635 159
185 3300027471 Ga0209995_1000365 Ga0209995_10003658 159
186 3300027543 Ga0209999_1005858 Ga0209999_10058582 159
187 3300027695 Ga0209966_1002289 Ga0209966_10022892 159
188 3300028379 Ga0268266_10000649 Ga0268266_1000064925 159
189 3300028381 Ga0268264_10039966 Ga0268264_100399663 159
190 3300028794 Ga0307515_10000024 Ga0307515_10000024237 159
191 3300031240 Ga0265320_10056768 Ga0265320_100567682 159
192 3300031241 Ga0265325_10043911 Ga0265325_100439113 159
193 3300031242 Ga0265329_10124302 Ga0265329_101243021 159
194 3300031250 Ga0265331_10027178 Ga0265331_100271783 159
195 3300031344 Ga0265316_10003739 Ga0265316_1000373914 159
196 3300031595 Ga0265313_10002143 Ga0265313_1000214316 159
197 3300031731 Ga0307405_10201501 Ga0307405_102015013 159
198 3300031903 Ga0307407_10083347 Ga0307407_100833473 159
199 3300032002 Ga0307416_100188572 Ga0307416_1001885722 159
200 3300032004 Ga0307414_10266591 Ga0307414_102665912 159
201 3300032005 Ga0307411_10283253 Ga0307411_102832533 159
202 3300032126 Ga0307415_100055775 Ga0307415_1000557754 159
203 3300035170 Ga0373943_0527423 Ga0373943_0527423_32_547 159
204 3300035724 Ga0373933_0360054 Ga0373933_0360054_313_831 159
205 3300036401 Ga0373937_0603681 Ga0373937_0603681_315_833 159
206 3300037418 Ga0395900_0948120 Ga0395900_0948120_95_622 159
207 3300037471 Ga0395905_0094025 Ga0395905_0094025_1525_2106 159
208 3300037471 Ga0395905_0587952 Ga0395905_0587952_418_945 159
209 3300038443 Ga0395901_0557137 Ga0395901_0557137_344_856 159
210 3300041486 Ga0451807_0928212 Ga0451807_0928212_393_923 159
211 3300044673 Ga0453683_0389973 Ga0453683_0389973_108_626 159
212 3300046543 Ga0495645_0037684 Ga0495645_0037684_2360_2884 159
213 3300047472 Ga0495686_0192480 Ga0495686_0192480_660_1163 159
214 3300048918 Ga0496115_0177561 Ga0496115_0177561_642_1145 159
215 3300049577 Ga0501041_0362033 Ga0501041_0362033_327_842 159
216 3300049583 Ga0501067_0179403 Ga0501067_0179403_137_691 159
217 3300049589 Ga0501073_0001776 Ga0501073_0001776_8995_9549 159
218 3300049592 Ga0501076_0865837 Ga0501076_0865837_186_701 159
219 3300049593 Ga0501077_0098717 Ga0501077_0098717_65_571 159
220 3300049593 Ga0501077_0541823 Ga0501077_0541823_50_565 159
221 3300049672 Ga0501239_013419 Ga0501239_013419_423_917 159
222 3300049741 Ga0501079_0282217 Ga0501079_0282217_45_551 159
223 3300049742 Ga0501080_0079323 Ga0501080_0079323_631_1185 159
224 3300049744 Ga0501083_0142453 Ga0501083_0142453_804_1358 159
225 3300050493 nmdc:mga0k408_32609_c2 nmdc:mga0k408_32609_c2_973_1494 159
226 3300050507 nmdc:mga05p37_322155_c1 nmdc:mga05p37_322155_c1_139_675 159
227 3300050508 nmdc:mga09592_64515_c1 nmdc:mga09592_64515_c1_835_1347 159
228 3300050508 nmdc:mga09592_687190_c1 nmdc:mga09592_687190_c1_151_663 159
229 3300050509 nmdc:mga0qj67_47529_c1 nmdc:mga0qj67_47529_c1_2809_3321 159
230 3300050510 nmdc:mga06r32_101529_c1 nmdc:mga06r32_101529_c1_1757_2269 159
231 3300050510 nmdc:mga06r32_263_c5 nmdc:mga06r32_263_c5_4335_4886 159
232 3300050513 nmdc:mga0rr50_95169_c1 nmdc:mga0rr50_95169_c1_252_761 159
233 3300054114 Ga0501084_0053643 Ga0501084_0053643_1743_2297 159
234 3300060353 Ga0501082_0266755 Ga0501082_0266755_438_953 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09349

OHCU_decarbox

OHCU decarboxylase

35

191

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o7k-assembly1.cif.gz_A crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae 0.9351 2 156
2q37-assembly1.cif.gz_A-2 crystal structure of ohcu decarboxylase in the presence of (s)-allantoin 0.9299 19 158
3o7j-assembly1.cif.gz_A crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae 0.9023 1 156
3o7k-assembly1.cif.gz_A crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae 0.8904 2 156
3o7j-assembly1.cif.gz_A crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae 0.8813 1 156
ID Description Score Start End Superfamily
af_I1MM35_6_163_1.10.3330.10 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.9488 15 158 1.10.3330.10
2q37A00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.915 19 158 1.10.3330.10
3o7jA00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.9023 1 156 1.10.3330.10
3o7jA00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8813 1 156 1.10.3330.10
3o7iB00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8777 2 156 1.10.3330.10
ID Description Score Start End GO Terms
AF-A0A1Q7RUN7-F1-model_v4 allantoinase (EC 3.5.2.5) 0.9959 3 158 GO:0000256
GO:0004038
GO:0005737
GO:0006145
GO:0008270
GO:0050897
AF-A0A0L8QSP9-F1-model_v4 deleted 0.9936 79 157
AF-A0A843SSS9-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9934 1 159 GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A1I0R7Z9-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9927 5 158 GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A522YS02-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9922 1 158 GO:0005777
GO:0006144
GO:0019628
GO:0051997

Feature Viewer

pLDDT pTM Quality
95.91 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map