F347072

General Info

Members Datasets Scaffolds Average Seq Length
234 134 468 368

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10172990|Ga0105239_101729903
Length 383
Sequence MKPNHVLPGEPDTGAPRLTRLAELSALGQSVWIDFLSRDLIESGGLARAVEDDAVVGVTSNPSIFGKALSQGSSYDDQIESSIGDLVSVYHALAMRDVAAACDVMRPVWERTGGRDGYVSIEVDPNLAADTHGSIAQATQFHETIARPNLLVKIPATDAGVPAIEEMTARGYSINVTLIFSLERHRQVADAYLRGLERLIAVDGDPALVHSVASFFVSRVDSETDRRLAAHGRDDLRGQLAIANANLAYQQYKELFAGARWQVLAARGATTQRCLWASTSTKDPSYRDTLYVDELIGPETITTMPAETIAAFQDHGRVESRLASDLKAAHQVFRELHAAGVDYDDVVATLEREGIEKFDAAFDELLKGIADKRAVRTPASSHR

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
83 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
84 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 4.7
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10172990 3300010375 Bacteria 2415
2 Ga0070658_10093845 3300005327 Bacteria 2475
3 Ga0070683_100245607 3300005329 Bacteria 1703
4 Ga0070682_100015498 3300005337 Bacteria 4418
5 Ga0070682_100152852 3300005337 Bacteria 1586
6 Ga0070660_100089267 3300005339 Bacteria 2428
7 Ga0070675_100267826 3300005354 Bacteria 1498
8 Ga0070659_100020625 3300005366 Bacteria 5010
9 Ga0070709_10275816 3300005434 Bacteria 1220
10 Ga0070678_100175821 3300005456 Bacteria 1748
11 Ga0070685_10122871 3300005466 Bacteria 1614
12 Ga0070707_100031110 3300005468 Bacteria 5082
13 Ga0070698_100312677 3300005471 Bacteria 1502
14 Ga0070699_100070995 3300005518 Bacteria 3028
15 Ga0070679_100073752 3300005530 Bacteria 3404
16 Ga0070679_100077841 3300005530 Bacteria 3305
17 Ga0070684_100012521 3300005535 Bacteria 6803
18 Ga0070684_100023277 3300005535 Bacteria 5178
19 Ga0070684_100027735 3300005535 Bacteria 4783
20 Ga0068853_100038154 3300005539 Bacteria 4091
21 Ga0070696_100032974 3300005546 Bacteria 3556
22 Ga0070693_100143787 3300005547 Bacteria 1504
23 Ga0070664_100244465 3300005564 Bacteria 1612
24 Ga0068857_100003821 3300005577 Bacteria 12675
25 Ga0068857_100126770 3300005577 Bacteria 2300
26 Ga0068856_100031071 3300005614 Bacteria 5223
27 Ga0068856_100147248 3300005614 Bacteria 2362
28 Ga0068856_100217707 3300005614 Bacteria 1925
29 Ga0068866_10035289 3300005718 Bacteria 2442
30 Ga0081455_10057038 3300005937 Bacteria 3312
31 Ga0081538_10000175 3300005981 Bacteria 69198
32 Ga0075365_10004741 3300006038 Bacteria 7249
33 Ga0070712_100072400 3300006175 Bacteria 2469
34 Ga0075428_100020270 3300006844 Bacteria 7363
35 Ga0075430_100006007 3300006846 Bacteria 10247
36 Ga0075431_100021108 3300006847 Bacteria 6656
37 Ga0075433_10154143 3300006852 Bacteria 2044
38 Ga0075429_100000256 3300006880 Bacteria 36808
39 Ga0075429_100155365 3300006880 Bacteria 2003
40 Ga0111539_10145967 3300009094 Bacteria 2770
41 Ga0105245_10065244 3300009098 Bacteria 3292
42 Ga0105245_10386065 3300009098 Bacteria 1396
43 Ga0114129_10001418 3300009147 Bacteria 32315
44 Ga0114129_10003870 3300009147 Bacteria 21112
45 Ga0105243_10105314 3300009148 Bacteria 2349
46 Ga0105243_10145019 3300009148 Bacteria 2030
47 Ga0105241_10199403 3300009174 Bacteria 1671
48 Ga0105249_10149619 3300009553 Bacteria 2246
49 Ga0105239_10099748 3300010375 Bacteria 3211
50 Ga0105246_10014052 3300011119 Bacteria 5030
51 Ga0157373_10050533 3300013100 Bacteria 2960
52 Ga0157373_10141008 3300013100 Bacteria 1695
53 Ga0157371_10130118 3300013102 Bacteria 1791
54 Ga0157370_10047363 3300013104 Bacteria 4122
55 Ga0157370_10103151 3300013104 Bacteria 2670
56 Ga0157369_10014270 3300013105 Bacteria 8975
57 Ga0157369_10022436 3300013105 Bacteria 7044
58 Ga0157374_10008554 3300013296 Bacteria 8753
59 Ga0157380_10374227 3300014326 Bacteria 1342
60 Ga0157377_10026391 3300014745 Bacteria 3108
61 Ga0207688_10068322 3300025901 Bacteria 2012
62 Ga0207699_10115377 3300025906 Bacteria 1728
63 Ga0207643_10009846 3300025908 Bacteria 5135
64 Ga0207705_10029030 3300025909 Bacteria 3944
65 Ga0207705_10129777 3300025909 Bacteria 1875
66 Ga0207707_10081785 3300025912 Bacteria 2819
67 Ga0207695_10046785 3300025913 Bacteria 4583
68 Ga0207693_10016185 3300025915 Bacteria 5964
69 Ga0207663_10080391 3300025916 Bacteria 2131
70 Ga0207657_10000871 3300025919 Bacteria 31861
71 Ga0207652_10038265 3300025921 Bacteria 4065
72 Ga0207652_10085881 3300025921 Bacteria 2758
73 Ga0207646_10194400 3300025922 Bacteria 1832
74 Ga0207687_10135824 3300025927 Bacteria 1860
75 Ga0207664_10006149 3300025929 Bacteria 8231
76 Ga0207690_10138671 3300025932 Bacteria 1789
77 Ga0207689_10066979 3300025942 Bacteria 2952
78 Ga0207661_10000511 3300025944 Bacteria 25089
79 Ga0207661_10014783 3300025944 Bacteria 5727
80 Ga0207661_10202380 3300025944 Bacteria 1746
81 Ga0207679_10023251 3300025945 Bacteria 4234
82 Ga0207679_10213614 3300025945 Bacteria 1619
83 Ga0207640_10063990 3300025981 Bacteria 2447
84 Ga0207639_10126936 3300026041 Bacteria 2105
85 Ga0207708_10018283 3300026075 Bacteria 5277
86 Ga0207702_10140083 3300026078 Bacteria 2187
87 Ga0207674_10008164 3300026116 Bacteria 12141
88 Ga0207674_10157063 3300026116 Bacteria 2230
89 Ga0207675_100058396 3300026118 Bacteria 3600
90 Ga0207683_10100013 3300026121 Bacteria 2588
91 Ga0268265_10046846 3300028380 Bacteria 3235
92 Ga0268264_10418616 3300028381 Bacteria 1291
93 Ga0307409_100022269 3300031995 Bacteria 4365
94 Ga0307409_100063362 3300031995 Bacteria 2899
95 Ga0307416_100002864 3300032002 Bacteria 10045
96 Ga0307416_100077066 3300032002 Bacteria 2798
97 Ga0307415_100009541 3300032126 Bacteria 5447
98 Ga0307415_100010469 3300032126 Bacteria 5256
99 Ga0373943_0006935 3300035170 Bacteria 5082
100 Ga0373947_0046193 3300035725 Bacteria 2607
101 Ga0395899_0063021 3300037312 Bacteria 2729
102 Ga0395900_0012790 3300037418 Bacteria 8578
103 Ga0395900_0018253 3300037418 Bacteria 7156
104 Ga0395900_0033759 3300037418 Bacteria 5265
105 Ga0395900_0059577 3300037418 Bacteria 3931
106 Ga0395900_0072955 3300037418 Bacteria 3528
107 Ga0395900_0310087 3300037418 Bacteria 1561
108 Ga0395898_0009307 3300037466 Bacteria 10330
109 Ga0395898_0014609 3300037466 Bacteria 8064
110 Ga0395898_0032862 3300037466 Bacteria 5179
111 Ga0395898_0067035 3300037466 Bacteria 3476
112 Ga0395898_0282099 3300037466 Bacteria 1585
113 Ga0395905_0010627 3300037471 Bacteria 8933
114 Ga0395905_0035583 3300037471 Bacteria 4676
115 Ga0395905_0086982 3300037471 Bacteria 2930
116 Ga0395905_0298751 3300037471 Bacteria 1497
117 Ga0395901_0002763 3300038443 Bacteria 17686
118 Ga0395901_0063157 3300038443 Bacteria 3854
119 Ga0395901_0065407 3300038443 Bacteria 3786
120 Ga0439448_0014276 3300042005 Bacteria 2394
121 Ga0450906_003264 3300042145 Bacteria 3504
122 Ga0439458_0013220 3300042157 Bacteria 1858
123 Ga0466966_0075938 3300044684 Bacteria 2099
124 Ga0466967_0178472 3300045976 Bacteria 2002
125 Ga0495629_0062133 3300046459 Bacteria 2610
126 Ga0496101_0064478 3300048904 Bacteria 2669
127 Ga0496101_0097645 3300048904 Bacteria 2194
128 Ga0496102_0052715 3300048905 Bacteria 3708
129 Ga0496103_0013004 3300048906 Bacteria 4935
130 Ga0496108_0008705 3300048911 Bacteria 8226
131 Ga0496109_0005123 3300048912 Bacteria 10942
132 Ga0496109_0064209 3300048912 Bacteria 3359
133 Ga0496110_0000652 3300048913 Bacteria 23664
134 Ga0496111_0035940 3300048914 Bacteria 3542
135 Ga0496111_0103418 3300048914 Bacteria 2095
136 Ga0496114_0016150 3300048917 Bacteria 6008
137 Ga0501031_0007869 3300049568 Bacteria 6937
138 Ga0501031_0008153 3300049568 Bacteria 6820
139 Ga0501032_0014666 3300049569 Bacteria 5548
140 Ga0501033_0008845 3300049570 Bacteria 7778
141 Ga0501033_0163475 3300049570 Bacteria 1601
142 Ga0501034_0011899 3300049571 Bacteria 9001
143 Ga0501034_0055506 3300049571 Bacteria 3986
144 Ga0501036_0001231 3300049572 Bacteria 19566
145 Ga0501036_0026991 3300049572 Bacteria 4853
146 Ga0501036_0203482 3300049572 Bacteria 1665
147 Ga0501037_0006318 3300049573 Bacteria 8665
148 Ga0501038_0032417 3300049574 Bacteria 4610
149 Ga0501038_0067634 3300049574 Bacteria 3039
150 Ga0501038_0092476 3300049574 Bacteria 2532
151 Ga0501038_0148484 3300049574 Bacteria 1912
152 Ga0501039_0009746 3300049575 Bacteria 7317
153 Ga0501039_0035591 3300049575 Bacteria 3842
154 Ga0501039_0050250 3300049575 Bacteria 3225
155 Ga0501039_0078458 3300049575 Bacteria 2569
156 Ga0501039_0144847 3300049575 Bacteria 1867
157 Ga0501039_0172333 3300049575 Bacteria 1701
158 Ga0501040_0000048 3300049576 Bacteria 55371
159 Ga0501040_0002008 3300049576 Bacteria 13119
160 Ga0501040_0003603 3300049576 Bacteria 10018
161 Ga0501041_0061981 3300049577 Bacteria 2290
162 Ga0501042_0000660 3300049578 Bacteria 18529
163 Ga0501043_0039825 3300049579 Bacteria 3693
164 Ga0501046_0001772 3300049580 Bacteria 20615
165 Ga0501046_0078054 3300049580 Bacteria 2562
166 Ga0501046_0215674 3300049580 Bacteria 1423
167 Ga0501048_0002779 3300049582 Bacteria 13358
168 Ga0501048_0006018 3300049582 Bacteria 9237
169 Ga0501048_0176584 3300049582 Bacteria 1514
170 Ga0501067_0054405 3300049583 Bacteria 2218
171 Ga0501068_0003813 3300049584 Bacteria 8171
172 Ga0501068_0048424 3300049584 Bacteria 2566
173 Ga0501068_0102852 3300049584 Bacteria 1771
174 Ga0501069_0000713 3300049585 Bacteria 15508
175 Ga0501070_0072246 3300049586 Bacteria 2856
176 Ga0501071_0006520 3300049587 Bacteria 7577
177 Ga0501071_0042175 3300049587 Bacteria 3268
178 Ga0501072_0067292 3300049588 Bacteria 2826
179 Ga0501072_0171128 3300049588 Bacteria 1733
180 Ga0501072_0183110 3300049588 Bacteria 1671
181 Ga0501073_0000742 3300049589 Bacteria 23084
182 Ga0501073_0018629 3300049589 Bacteria 5018
183 Ga0501074_0049705 3300049590 Bacteria 3027
184 Ga0501074_0054015 3300049590 Bacteria 2897
185 Ga0501075_0001121 3300049591 Bacteria 17240
186 Ga0501075_0001969 3300049591 Bacteria 13553
187 Ga0501075_0058576 3300049591 Bacteria 2901
188 Ga0501075_0145379 3300049591 Bacteria 1807
189 Ga0501076_0000927 3300049592 Bacteria 19101
190 Ga0501076_0019416 3300049592 Bacteria 5197
191 Ga0501076_0121475 3300049592 Bacteria 2115
192 Ga0501077_0000729 3300049593 Bacteria 19889
193 Ga0501077_0061285 3300049593 Bacteria 2387
194 Ga0501077_0104237 3300049593 Bacteria 1797
195 Ga0501077_0167473 3300049593 Bacteria 1396
196 Ga0501079_0000366 3300049741 Bacteria 28952
197 Ga0501079_0033087 3300049741 Bacteria 3976
198 Ga0501079_0091480 3300049741 Bacteria 2357
199 Ga0501079_0179479 3300049741 Bacteria 1652
200 Ga0501080_0016764 3300049742 Bacteria 6766
201 Ga0501080_0136515 3300049742 Bacteria 2270
202 Ga0501080_0173093 3300049742 Bacteria 1990
203 Ga0501081_0000654 3300049743 Bacteria 19831
204 Ga0501081_0007108 3300049743 Bacteria 7274
205 Ga0501081_0106736 3300049743 Bacteria 1985
206 Ga0501081_0120155 3300049743 Bacteria 1871
207 Ga0501081_0165379 3300049743 Bacteria 1595
208 Ga0501035_0002855 3300049822 Bacteria 16694
209 Ga0501045_0000672 3300049824 Bacteria 21747
210 Ga0501045_0003335 3300049824 Bacteria 10984
211 Ga0501045_0005857 3300049824 Bacteria 8503
212 Ga0501045_0156285 3300049824 Bacteria 1697
213 nmdc:mga05p37_2248_c1 3300050507 Bacteria 22480
214 nmdc:mga05p37_3090_c1 3300050507 Bacteria 19345
215 nmdc:mga09592_106393_c1 3300050508 Bacteria 2406
216 nmdc:mga09592_211920_c1 3300050508 Bacteria 1679
217 nmdc:mga0qj67_80767_c1 3300050509 Bacteria 2606
218 nmdc:mga06r32_45391_c1 3300050510 Bacteria 4188
219 nmdc:mga08y16_55080_c1 3300050511 Bacteria 4157
220 nmdc:mga0a205_124098_c2 3300050515 Bacteria 2076
221 Ga0501084_0003652 3300054114 Bacteria 12488
222 Ga0501084_0016748 3300054114 Bacteria 6088
223 Ga0501084_0036918 3300054114 Bacteria 4082
224 Ga0501084_0095552 3300054114 Bacteria 2496
225 Ga0501084_0138283 3300054114 Bacteria 2050
226 Ga0501084_0400344 3300054114 Bacteria 1160
227 Ga0501082_0002784 3300060353 Bacteria 15267
228 Ga0501082_0010421 3300060353 Bacteria 8001
229 Ga0501082_0031821 3300060353 Bacteria 4550
230 Ga0501082_0037908 3300060353 Bacteria 4156
231 Ga0501082_0155727 3300060353 Bacteria 1985
232 Ga0530510_0004474 3300061734 Bacteria 9675
233 Ga0530510_0029886 3300061734 Bacteria 3912
234 Ga0530510_0063198 3300061734 Bacteria 2680
235 Ga0105239_10172990
236 Ga0070658_10093845
237 Ga0070683_100245607
238 Ga0070682_100015498
239 Ga0070682_100152852
240 Ga0070660_100089267
241 Ga0070675_100267826
242 Ga0070659_100020625
243 Ga0070709_10275816
244 Ga0070678_100175821
245 Ga0070685_10122871
246 Ga0070707_100031110
247 Ga0070698_100312677
248 Ga0070699_100070995
249 Ga0070679_100073752
250 Ga0070679_100077841
251 Ga0070684_100012521
252 Ga0070684_100023277
253 Ga0070684_100027735
254 Ga0068853_100038154
255 Ga0070696_100032974
256 Ga0070693_100143787
257 Ga0070664_100244465
258 Ga0068857_100003821
259 Ga0068857_100126770
260 Ga0068856_100031071
261 Ga0068856_100147248
262 Ga0068856_100217707
263 Ga0068866_10035289
264 Ga0081455_10057038
265 Ga0081538_10000175
266 Ga0075365_10004741
267 Ga0070712_100072400
268 Ga0075428_100020270
269 Ga0075430_100006007
270 Ga0075431_100021108
271 Ga0075433_10154143
272 Ga0075429_100000256
273 Ga0075429_100155365
274 Ga0111539_10145967
275 Ga0105245_10065244
276 Ga0105245_10386065
277 Ga0114129_10001418
278 Ga0114129_10003870
279 Ga0105243_10105314
280 Ga0105243_10145019
281 Ga0105241_10199403
282 Ga0105249_10149619
283 Ga0105239_10099748
284 Ga0105246_10014052
285 Ga0157373_10050533
286 Ga0157373_10141008
287 Ga0157371_10130118
288 Ga0157370_10047363
289 Ga0157370_10103151
290 Ga0157369_10014270
291 Ga0157369_10022436
292 Ga0157374_10008554
293 Ga0157380_10374227
294 Ga0157377_10026391
295 Ga0207688_10068322
296 Ga0207699_10115377
297 Ga0207643_10009846
298 Ga0207705_10029030
299 Ga0207705_10129777
300 Ga0207707_10081785
301 Ga0207695_10046785
302 Ga0207693_10016185
303 Ga0207663_10080391
304 Ga0207657_10000871
305 Ga0207652_10038265
306 Ga0207652_10085881
307 Ga0207646_10194400
308 Ga0207687_10135824
309 Ga0207664_10006149
310 Ga0207690_10138671
311 Ga0207689_10066979
312 Ga0207661_10000511
313 Ga0207661_10014783
314 Ga0207661_10202380
315 Ga0207679_10023251
316 Ga0207679_10213614
317 Ga0207640_10063990
318 Ga0207639_10126936
319 Ga0207708_10018283
320 Ga0207702_10140083
321 Ga0207674_10008164
322 Ga0207674_10157063
323 Ga0207675_100058396
324 Ga0207683_10100013
325 Ga0268265_10046846
326 Ga0268264_10418616
327 Ga0307409_100022269
328 Ga0307409_100063362
329 Ga0307416_100002864
330 Ga0307416_100077066
331 Ga0307415_100009541
332 Ga0307415_100010469
333 Ga0373943_0006935
334 Ga0373947_0046193
335 Ga0395899_0063021
336 Ga0395900_0012790
337 Ga0395900_0018253
338 Ga0395900_0033759
339 Ga0395900_0059577
340 Ga0395900_0072955
341 Ga0395900_0310087
342 Ga0395898_0009307
343 Ga0395898_0014609
344 Ga0395898_0032862
345 Ga0395898_0067035
346 Ga0395898_0282099
347 Ga0395905_0010627
348 Ga0395905_0035583
349 Ga0395905_0086982
350 Ga0395905_0298751
351 Ga0395901_0002763
352 Ga0395901_0063157
353 Ga0395901_0065407
354 Ga0439448_0014276
355 Ga0450906_003264
356 Ga0439458_0013220
357 Ga0466966_0075938
358 Ga0466967_0178472
359 Ga0495629_0062133
360 Ga0496101_0064478
361 Ga0496101_0097645
362 Ga0496102_0052715
363 Ga0496103_0013004
364 Ga0496108_0008705
365 Ga0496109_0005123
366 Ga0496109_0064209
367 Ga0496110_0000652
368 Ga0496111_0035940
369 Ga0496111_0103418
370 Ga0496114_0016150
371 Ga0501031_0007869
372 Ga0501031_0008153
373 Ga0501032_0014666
374 Ga0501033_0008845
375 Ga0501033_0163475
376 Ga0501034_0011899
377 Ga0501034_0055506
378 Ga0501036_0001231
379 Ga0501036_0026991
380 Ga0501036_0203482
381 Ga0501037_0006318
382 Ga0501038_0032417
383 Ga0501038_0067634
384 Ga0501038_0092476
385 Ga0501038_0148484
386 Ga0501039_0009746
387 Ga0501039_0035591
388 Ga0501039_0050250
389 Ga0501039_0078458
390 Ga0501039_0144847
391 Ga0501039_0172333
392 Ga0501040_0000048
393 Ga0501040_0002008
394 Ga0501040_0003603
395 Ga0501041_0061981
396 Ga0501042_0000660
397 Ga0501043_0039825
398 Ga0501046_0001772
399 Ga0501046_0078054
400 Ga0501046_0215674
401 Ga0501048_0002779
402 Ga0501048_0006018
403 Ga0501048_0176584
404 Ga0501067_0054405
405 Ga0501068_0003813
406 Ga0501068_0048424
407 Ga0501068_0102852
408 Ga0501069_0000713
409 Ga0501070_0072246
410 Ga0501071_0006520
411 Ga0501071_0042175
412 Ga0501072_0067292
413 Ga0501072_0171128
414 Ga0501072_0183110
415 Ga0501073_0000742
416 Ga0501073_0018629
417 Ga0501074_0049705
418 Ga0501074_0054015
419 Ga0501075_0001121
420 Ga0501075_0001969
421 Ga0501075_0058576
422 Ga0501075_0145379
423 Ga0501076_0000927
424 Ga0501076_0019416
425 Ga0501076_0121475
426 Ga0501077_0000729
427 Ga0501077_0061285
428 Ga0501077_0104237
429 Ga0501077_0167473
430 Ga0501079_0000366
431 Ga0501079_0033087
432 Ga0501079_0091480
433 Ga0501079_0179479
434 Ga0501080_0016764
435 Ga0501080_0136515
436 Ga0501080_0173093
437 Ga0501081_0000654
438 Ga0501081_0007108
439 Ga0501081_0106736
440 Ga0501081_0120155
441 Ga0501081_0165379
442 Ga0501035_0002855
443 Ga0501045_0000672
444 Ga0501045_0003335
445 Ga0501045_0005857
446 Ga0501045_0156285
447 nmdc:mga05p37_2248_c1
448 nmdc:mga05p37_3090_c1
449 nmdc:mga09592_106393_c1
450 nmdc:mga09592_211920_c1
451 nmdc:mga0qj67_80767_c1
452 nmdc:mga06r32_45391_c1
453 nmdc:mga08y16_55080_c1
454 nmdc:mga0a205_124098_c2
455 Ga0501084_0003652
456 Ga0501084_0016748
457 Ga0501084_0036918
458 Ga0501084_0095552
459 Ga0501084_0138283
460 Ga0501084_0400344
461 Ga0501082_0002784
462 Ga0501082_0010421
463 Ga0501082_0031821
464 Ga0501082_0037908
465 Ga0501082_0155727
466 Ga0530510_0004474
467 Ga0530510_0029886
468 Ga0530510_0063198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

31

369

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bbx-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase, variant k8a 0.9722 20 369
7odq-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase at 5.4 mgy dose 0.9719 20 369
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.9684 19 369
7bbw-assembly2.cif.gz_B neisseria gonorrhoeae transaldolase, variant c38s 0.9644 19 369
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.963 19 369
ID Description Score Start End Superfamily
af_I1JM01_1_306_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9727 84 372 3.20.20.70
3clmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.971 20 369 3.20.20.70
3clmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.96 20 369 3.20.20.70
af_B4FRC9_66_421_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9586 20 372 3.20.20.70
af_K7L4A2_15_219_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9577 65 262 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6G3XGD8-F1-model_v4 transaldolase (EC 2.2.1.2) 1.002 106 186 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A6B3CHQ4-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.999 147 217 GO:0004801
GO:0005737
GO:0005975
AF-T0ZI10-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9984 95 201 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-E2FSJ1-F1-model_v4 Putative transaldolase 0.9978 97 188 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A505D201-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9972 101 297 GO:0004801
GO:0005737
GO:0005975
GO:0006098

Map