F346999

General Info

Members Datasets Scaffolds Average Seq Length
234 127 468 322

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100267240|Ga0075429_1002672402
Length 376
Sequence MLDEGVELYHRPTVRTPHIGYERRSDTSRQDDQGRGQTVTPRDVTPVMQRYGMTIPFDGVPLHEQRDWIVELADLGYTDVWSSEANGADAFTPLALASAWAPSLRLGTAIVPAFTRGPGCLAQSVGSLAQAAPGRVALGVGTSSDVIVEGWNGIPFQRPYERTRDIVRFLRQALTGEKVTAEYETFSVRGFRLGVVPPEPVPILVAALREGMLRLAGREGDGAIVNWLSADDVATVAPVVRRAAEGKAGTPDAAPTPEIAARIFVAASDDADTVRSMGRFAIAAYLNVPVYAAFHEWLGRGDRLGDMWRLWKEGDRKGALAAIPDDVVDELIVWGSPEQCREHIQRYVDNGVSTPALALLPFGYDQRQAIRDLAPR

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
60 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
64 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
65 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
66 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
67 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
68 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
69 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
70 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
76 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
122 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 2.56
Rhizosphere 90.6
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100267240 3300006880 Bacteria 1498
2 JGI25407J50210_10002150 3300003373 Bacteria 4602
3 Ga0070671_100001643 3300005355 Bacteria 16904
4 Ga0070671_100185331 3300005355 Bacteria 1763
5 Ga0070713_100029004 3300005436 Bacteria 4376
6 Ga0070678_100113899 3300005456 Bacteria 2121
7 Ga0070681_10147527 3300005458 Bacteria 2280
8 Ga0068867_100141693 3300005459 Bacteria 1880
9 Ga0070706_100056286 3300005467 Bacteria 3629
10 Ga0070698_100019127 3300005471 Bacteria 7199
11 Ga0070696_100047865 3300005546 Bacteria 2968
12 Ga0070696_100139276 3300005546 Bacteria 1772
13 Ga0070665_100010141 3300005548 Bacteria 9528
14 Ga0068855_100055351 3300005563 Bacteria 4660
15 Ga0068861_100213973 3300005719 Bacteria 1625
16 Ga0068863_100016726 3300005841 Bacteria 7038
17 Ga0068863_100180473 3300005841 Bacteria 2026
18 Ga0068863_100405090 3300005841 Unclassified 1334
19 Ga0068860_100014010 3300005843 Bacteria 7865
20 Ga0081455_10002603 3300005937 Bacteria 21399
21 Ga0081455_10011231 3300005937 Bacteria 9011
22 Ga0081455_10071936 3300005937 Bacteria 2865
23 Ga0081455_10146843 3300005937 Bacteria 1823
24 Ga0081538_10000061 3300005981 Bacteria 101171
25 Ga0081538_10048050 3300005981 Bacteria 2608
26 Ga0081538_10073436 3300005981 Bacteria 1869
27 Ga0081538_10086143 3300005981 Bacteria 1646
28 Ga0075365_10035002 3300006038 Bacteria 3247
29 Ga0075365_10150666 3300006038 Bacteria 1618
30 Ga0075365_10178245 3300006038 Bacteria 1485
31 Ga0075428_100000151 3300006844 Bacteria 62789
32 Ga0075428_100008912 3300006844 Bacteria 11133
33 Ga0075428_100009635 3300006844 Bacteria 10724
34 Ga0075428_100019234 3300006844 Bacteria 7554
35 Ga0075428_100030372 3300006844 Bacteria 5976
36 Ga0075428_100236467 3300006844 Bacteria 1971
37 Ga0075428_100515205 3300006844 Bacteria 1279
38 Ga0075430_100000300 3300006846 Bacteria 34980
39 Ga0075430_100017254 3300006846 Bacteria 6149
40 Ga0075431_100000476 3300006847 Bacteria 33258
41 Ga0075431_100028433 3300006847 Bacteria 5745
42 Ga0075431_100082158 3300006847 Bacteria 3326
43 Ga0075431_100096294 3300006847 Bacteria 3055
44 Ga0075431_100476298 3300006847 Bacteria 1241
45 Ga0075431_100503047 3300006847 Bacteria 1203
46 Ga0075429_100001371 3300006880 Bacteria 19931
47 Ga0075429_100011237 3300006880 Bacteria 7750
48 Ga0111539_10004630 3300009094 Bacteria 17964
49 Ga0111539_10044415 3300009094 Bacteria 5324
50 Ga0111539_10097622 3300009094 Bacteria 3451
51 Ga0111539_10224603 3300009094 Bacteria 2187
52 Ga0105245_10135441 3300009098 Bacteria 2314
53 Ga0114129_10001081 3300009147 Bacteria 35757
54 Ga0114129_10038467 3300009147 Bacteria 6747
55 Ga0114129_10064426 3300009147 Bacteria 5115
56 Ga0114129_10127713 3300009147 Bacteria 3494
57 Ga0114129_10328170 3300009147 Bacteria 2032
58 Ga0105242_10131773 3300009176 Bacteria 2159
59 Ga0105239_10503083 3300010375 Bacteria 1378
60 Ga0157369_10354908 3300013105 Bacteria 1523
61 Ga0157378_10630884 3300013297 Bacteria 1085
62 Ga0207684_10072363 3300025910 Bacteria 2928
63 Ga0207681_10276739 3300025923 Bacteria 1320
64 Ga0207687_10003711 3300025927 Bacteria 10276
65 Ga0207644_10016471 3300025931 Bacteria 4973
66 Ga0207686_10070200 3300025934 Bacteria 2250
67 Ga0207667_10099844 3300025949 Bacteria 2995
68 Ga0207668_10110281 3300025972 Bacteria 2063
69 Ga0207703_10373136 3300026035 Bacteria 1318
70 Ga0207641_10116620 3300026088 Bacteria 2376
71 Ga0207641_10376203 3300026088 Unclassified 1359
72 Ga0207648_10146796 3300026089 Bacteria 2080
73 Ga0207675_100083442 3300026118 Bacteria 2997
74 Ga0207428_10172756 3300027907 Bacteria 1636
75 Ga0268266_10016536 3300028379 Bacteria 6306
76 Ga0268264_10008498 3300028381 Bacteria 8533
77 Ga0265338_10064849 3300028800 Bacteria 3173
78 Ga0307512_10052912 3300030522 Bacteria 3233
79 Ga0265327_10023968 3300031251 Bacteria 3596
80 Ga0307513_10034290 3300031456 Bacteria 5697
81 Ga0307513_10200228 3300031456 Bacteria 1839
82 Ga0316576_10035808 3300031727 Bacteria 3546
83 Ga0316576_10069663 3300031727 Bacteria 2594
84 Ga0307405_10260987 3300031731 Bacteria 1294
85 Ga0316577_10071777 3300031733 Bacteria 1932
86 Ga0307410_10112386 3300031852 Bacteria 1973
87 Ga0307410_10141541 3300031852 Bacteria 1780
88 Ga0307406_10176761 3300031901 Bacteria 1550
89 Ga0307407_10262242 3300031903 Bacteria 1189
90 Ga0307409_100009117 3300031995 Bacteria 6076
91 Ga0307416_100163881 3300032002 Bacteria 2059
92 Ga0307416_100172993 3300032002 Bacteria 2013
93 Ga0307416_100390842 3300032002 Bacteria 1425
94 Ga0307411_10005855 3300032005 Bacteria 6094
95 Ga0307415_100052344 3300032126 Bacteria 2776
96 Ga0373955_0272851 3300035172 Bacteria 1017
97 Ga0316574_0090064 3300035398 Bacteria 1955
98 Ga0373924_0109471 3300035410 Bacteria 1193
99 Ga0316582_0016494 3300036647 Bacteria 4249
100 Ga0316584_0041425 3300036712 Bacteria 3432
101 Ga0316584_0097674 3300036712 Bacteria 2199
102 Ga0436365_0311713 3300039437 Bacteria 1080
103 Ga0436365_0549121 3300039437 Bacteria 13504
104 Ga0436365_1697303 3300039437 Bacteria 1888
105 Ga0436360_0449470 3300039438 Bacteria 3649
106 Ga0436362_0475222 3300039453 Bacteria 5122
107 Ga0439448_0006469 3300042005 Bacteria 3371
108 Ga0439450_000930 3300042008 Bacteria 4070
109 Ga0439463_014767 3300042016 Bacteria 1927
110 Ga0439434_0026488 3300042435 Bacteria 1751
111 Ga0439464_0022014 3300042439 Bacteria 1753
112 Ga0439440_0004596 3300042993 Bacteria 2715
113 Ga0466967_0424832 3300045976 Bacteria 1296
114 Ga0466967_0511696 3300045976 Bacteria 1179
115 Ga0466967_0605215 3300045976 Bacteria 1082
116 Ga0495653_0061824 3300046463 Bacteria 2832
117 Ga0495580_0307993 3300046472 Bacteria 1078
118 Ga0495618_0122681 3300046514 Bacteria 1664
119 Ga0495621_0054202 3300046539 Bacteria 1441
120 Ga0495656_0032407 3300046615 Bacteria 2126
121 Ga0496102_0342910 3300048905 Bacteria 1407
122 Ga0496102_0382368 3300048905 Bacteria 1325
123 Ga0496108_0495887 3300048911 Bacteria 1067
124 Ga0496110_0024800 3300048913 Bacteria 5117
125 Ga0496114_0316547 3300048917 Bacteria 1379
126 Ga0496114_0362723 3300048917 Bacteria 1282
127 Ga0501032_0001072 3300049569 Bacteria 21888
128 Ga0501033_0027694 3300049570 Bacteria 4261
129 Ga0501033_0172467 3300049570 Bacteria 1553
130 Ga0501033_0270117 3300049570 Bacteria 1202
131 Ga0501034_0026666 3300049571 Bacteria 5880
132 Ga0501036_0066230 3300049572 Bacteria 3056
133 Ga0501037_0016990 3300049573 Bacteria 5354
134 Ga0501037_0044974 3300049573 Bacteria 3241
135 Ga0501038_0076805 3300049574 Bacteria 2821
136 Ga0501038_0345382 3300049574 Bacteria 1160
137 Ga0501039_0007810 3300049575 Bacteria 8156
138 Ga0501039_0026467 3300049575 Bacteria 4457
139 Ga0501039_0103510 3300049575 Bacteria 2222
140 Ga0501041_0006292 3300049577 Bacteria 6950
141 Ga0501041_0046427 3300049577 Bacteria 2642
142 Ga0501042_0013095 3300049578 Bacteria 5640
143 Ga0501042_0352160 3300049578 Bacteria 1065
144 Ga0501043_0030391 3300049579 Bacteria 4245
145 Ga0501046_0046297 3300049580 Bacteria 3453
146 Ga0501047_0065864 3300049581 Bacteria 3492
147 Ga0501047_0228933 3300049581 Bacteria 1713
148 Ga0501048_0035383 3300049582 Bacteria 3595
149 Ga0501048_0201649 3300049582 Bacteria 1410
150 Ga0501067_0045540 3300049583 Bacteria 2436
151 Ga0501067_0088484 3300049583 Bacteria 1719
152 Ga0501068_0011820 3300049584 Bacteria 4936
153 Ga0501068_0051341 3300049584 Bacteria 2494
154 Ga0501069_0001991 3300049585 Bacteria 10224
155 Ga0501070_0008153 3300049586 Bacteria 8862
156 Ga0501070_0101503 3300049586 Bacteria 2379
157 Ga0501071_0016898 3300049587 Bacteria 5021
158 Ga0501071_0142653 3300049587 Bacteria 1784
159 Ga0501072_0003733 3300049588 Bacteria 11494
160 Ga0501072_0004793 3300049588 Bacteria 10306
161 Ga0501072_0067004 3300049588 Bacteria 2832
162 Ga0501072_0083128 3300049588 Bacteria 2538
163 Ga0501072_0317483 3300049588 Bacteria 1238
164 Ga0501073_0085863 3300049589 Bacteria 2189
165 Ga0501073_0094572 3300049589 Bacteria 2075
166 Ga0501073_0274211 3300049589 Bacteria 1164
167 Ga0501074_0011978 3300049590 Bacteria 6305
168 Ga0501074_0027648 3300049590 Bacteria 4113
169 Ga0501074_0081004 3300049590 Bacteria 2328
170 Ga0501074_0105669 3300049590 Bacteria 2016
171 Ga0501075_0000686 3300049591 Bacteria 20948
172 Ga0501075_0008595 3300049591 Bacteria 7119
173 Ga0501075_0009737 3300049591 Bacteria 6734
174 Ga0501075_0014828 3300049591 Bacteria 5589
175 Ga0501076_0014027 3300049592 Bacteria 6023
176 Ga0501076_0124746 3300049592 Bacteria 2086
177 Ga0501076_0195478 3300049592 Bacteria 1651
178 Ga0501077_0004747 3300049593 Bacteria 8262
179 Ga0501077_0012196 3300049593 Bacteria 5381
180 Ga0501077_0095700 3300049593 Bacteria 1882
181 Ga0501079_0025200 3300049741 Bacteria 4562
182 Ga0501079_0049948 3300049741 Bacteria 3229
183 Ga0501080_0020912 3300049742 Bacteria 6056
184 Ga0501080_0125455 3300049742 Bacteria 2378
185 Ga0501080_0136131 3300049742 Bacteria 2273
186 Ga0501080_0138312 3300049742 Bacteria 2253
187 Ga0501081_0015989 3300049743 Bacteria 4954
188 Ga0501081_0043492 3300049743 Bacteria 3082
189 Ga0501083_0003272 3300049744 Bacteria 11312
190 Ga0501083_0029220 3300049744 Bacteria 3793
191 Ga0501035_0048936 3300049822 Bacteria 3790
192 Ga0501035_0392823 3300049822 Bacteria 1155
193 Ga0501044_0001828 3300049823 Bacteria 24774
194 Ga0501044_0005780 3300049823 Bacteria 13692
195 Ga0501044_0340007 3300049823 Bacteria 1422
196 Ga0501045_0009104 3300049824 Bacteria 6936
197 Ga0501045_0155666 3300049824 Bacteria 1700
198 nmdc:mga00v17_6365_c1 3300050491 Bacteria 6262
199 nmdc:mga0yw44_22650_c1 3300050492 Bacteria 3525
200 nmdc:mga0yw44_29305_c1 3300050492 Bacteria 3176
201 nmdc:mga05p37_224943_c1 3300050507 Bacteria 2263
202 nmdc:mga05p37_378553_c1 3300050507 Bacteria 1659
203 nmdc:mga09592_134936_c1 3300050508 Bacteria 2125
204 nmdc:mga09592_135683_c1 3300050508 Bacteria 2120
205 nmdc:mga09592_170377_c1 3300050508 Bacteria 1883
206 nmdc:mga09592_312_c1 3300050508 Bacteria 35462
207 nmdc:mga0qj67_251207_c1 3300050509 Bacteria 1435
208 nmdc:mga0qj67_361_c1 3300050509 Bacteria 31337
209 nmdc:mga06r32_100441_c1 3300050510 Bacteria 2838
210 nmdc:mga06r32_384788_c1 3300050510 Bacteria 1386
211 nmdc:mga06r32_43983_c1 3300050510 Bacteria 4251
212 nmdc:mga06r32_545_c1 3300050510 Bacteria 32695
213 nmdc:mga06r32_61589_c1 3300050510 Bacteria 3613
214 nmdc:mga06r32_61629_c1 3300050510 Bacteria 3612
215 nmdc:mga08y16_149464_c1 3300050511 Bacteria 2428
216 nmdc:mga08y16_17187_c1 3300050511 Bacteria 7613
217 nmdc:mga0n895_136315_c1 3300050512 Bacteria 2481
218 nmdc:mga0a205_525626_c1 3300050515 Bacteria 1039
219 Ga0500566_0000058 3300053094 Bacteria 53603
220 Ga0500568_0049730 3300053139 Bacteria 1654
221 Ga0500616_0147537 3300053153 Bacteria 1092
222 Ga0501084_0005393 3300054114 Bacteria 10482
223 Ga0501084_0010235 3300054114 Bacteria 7759
224 Ga0501084_0013136 3300054114 Bacteria 6851
225 Ga0501084_0067351 3300054114 Bacteria 2997
226 Ga0501084_0110453 3300054114 Bacteria 2310
227 Ga0501082_0002858 3300060353 Bacteria 15045
228 Ga0501082_0009418 3300060353 Bacteria 8407
229 Ga0501082_0036996 3300060353 Bacteria 4205
230 Ga0501082_0068601 3300060353 Bacteria 3053
231 Ga0530510_0003380 3300061734 Bacteria 10979
232 Ga0530510_0005061 3300061734 Bacteria 9096
233 Ga0530510_0024300 3300061734 Bacteria 4322
234 2915360709 2915358134 Bacteria 6050864
235 Ga0075429_100267240
236 JGI25407J50210_10002150
237 Ga0070671_100001643
238 Ga0070671_100185331
239 Ga0070713_100029004
240 Ga0070678_100113899
241 Ga0070681_10147527
242 Ga0068867_100141693
243 Ga0070706_100056286
244 Ga0070698_100019127
245 Ga0070696_100047865
246 Ga0070696_100139276
247 Ga0070665_100010141
248 Ga0068855_100055351
249 Ga0068861_100213973
250 Ga0068863_100016726
251 Ga0068863_100180473
252 Ga0068863_100405090
253 Ga0068860_100014010
254 Ga0081455_10002603
255 Ga0081455_10011231
256 Ga0081455_10071936
257 Ga0081455_10146843
258 Ga0081538_10000061
259 Ga0081538_10048050
260 Ga0081538_10073436
261 Ga0081538_10086143
262 Ga0075365_10035002
263 Ga0075365_10150666
264 Ga0075365_10178245
265 Ga0075428_100000151
266 Ga0075428_100008912
267 Ga0075428_100009635
268 Ga0075428_100019234
269 Ga0075428_100030372
270 Ga0075428_100236467
271 Ga0075428_100515205
272 Ga0075430_100000300
273 Ga0075430_100017254
274 Ga0075431_100000476
275 Ga0075431_100028433
276 Ga0075431_100082158
277 Ga0075431_100096294
278 Ga0075431_100476298
279 Ga0075431_100503047
280 Ga0075429_100001371
281 Ga0075429_100011237
282 Ga0111539_10004630
283 Ga0111539_10044415
284 Ga0111539_10097622
285 Ga0111539_10224603
286 Ga0105245_10135441
287 Ga0114129_10001081
288 Ga0114129_10038467
289 Ga0114129_10064426
290 Ga0114129_10127713
291 Ga0114129_10328170
292 Ga0105242_10131773
293 Ga0105239_10503083
294 Ga0157369_10354908
295 Ga0157378_10630884
296 Ga0207684_10072363
297 Ga0207681_10276739
298 Ga0207687_10003711
299 Ga0207644_10016471
300 Ga0207686_10070200
301 Ga0207667_10099844
302 Ga0207668_10110281
303 Ga0207703_10373136
304 Ga0207641_10116620
305 Ga0207641_10376203
306 Ga0207648_10146796
307 Ga0207675_100083442
308 Ga0207428_10172756
309 Ga0268266_10016536
310 Ga0268264_10008498
311 Ga0265338_10064849
312 Ga0307512_10052912
313 Ga0265327_10023968
314 Ga0307513_10034290
315 Ga0307513_10200228
316 Ga0316576_10035808
317 Ga0316576_10069663
318 Ga0307405_10260987
319 Ga0316577_10071777
320 Ga0307410_10112386
321 Ga0307410_10141541
322 Ga0307406_10176761
323 Ga0307407_10262242
324 Ga0307409_100009117
325 Ga0307416_100163881
326 Ga0307416_100172993
327 Ga0307416_100390842
328 Ga0307411_10005855
329 Ga0307415_100052344
330 Ga0373955_0272851
331 Ga0316574_0090064
332 Ga0373924_0109471
333 Ga0316582_0016494
334 Ga0316584_0041425
335 Ga0316584_0097674
336 Ga0436365_0311713
337 Ga0436365_0549121
338 Ga0436365_1697303
339 Ga0436360_0449470
340 Ga0436362_0475222
341 Ga0439448_0006469
342 Ga0439450_000930
343 Ga0439463_014767
344 Ga0439434_0026488
345 Ga0439464_0022014
346 Ga0439440_0004596
347 Ga0466967_0424832
348 Ga0466967_0511696
349 Ga0466967_0605215
350 Ga0495653_0061824
351 Ga0495580_0307993
352 Ga0495618_0122681
353 Ga0495621_0054202
354 Ga0495656_0032407
355 Ga0496102_0342910
356 Ga0496102_0382368
357 Ga0496108_0495887
358 Ga0496110_0024800
359 Ga0496114_0316547
360 Ga0496114_0362723
361 Ga0501032_0001072
362 Ga0501033_0027694
363 Ga0501033_0172467
364 Ga0501033_0270117
365 Ga0501034_0026666
366 Ga0501036_0066230
367 Ga0501037_0016990
368 Ga0501037_0044974
369 Ga0501038_0076805
370 Ga0501038_0345382
371 Ga0501039_0007810
372 Ga0501039_0026467
373 Ga0501039_0103510
374 Ga0501041_0006292
375 Ga0501041_0046427
376 Ga0501042_0013095
377 Ga0501042_0352160
378 Ga0501043_0030391
379 Ga0501046_0046297
380 Ga0501047_0065864
381 Ga0501047_0228933
382 Ga0501048_0035383
383 Ga0501048_0201649
384 Ga0501067_0045540
385 Ga0501067_0088484
386 Ga0501068_0011820
387 Ga0501068_0051341
388 Ga0501069_0001991
389 Ga0501070_0008153
390 Ga0501070_0101503
391 Ga0501071_0016898
392 Ga0501071_0142653
393 Ga0501072_0003733
394 Ga0501072_0004793
395 Ga0501072_0067004
396 Ga0501072_0083128
397 Ga0501072_0317483
398 Ga0501073_0085863
399 Ga0501073_0094572
400 Ga0501073_0274211
401 Ga0501074_0011978
402 Ga0501074_0027648
403 Ga0501074_0081004
404 Ga0501074_0105669
405 Ga0501075_0000686
406 Ga0501075_0008595
407 Ga0501075_0009737
408 Ga0501075_0014828
409 Ga0501076_0014027
410 Ga0501076_0124746
411 Ga0501076_0195478
412 Ga0501077_0004747
413 Ga0501077_0012196
414 Ga0501077_0095700
415 Ga0501079_0025200
416 Ga0501079_0049948
417 Ga0501080_0020912
418 Ga0501080_0125455
419 Ga0501080_0136131
420 Ga0501080_0138312
421 Ga0501081_0015989
422 Ga0501081_0043492
423 Ga0501083_0003272
424 Ga0501083_0029220
425 Ga0501035_0048936
426 Ga0501035_0392823
427 Ga0501044_0001828
428 Ga0501044_0005780
429 Ga0501044_0340007
430 Ga0501045_0009104
431 Ga0501045_0155666
432 nmdc:mga00v17_6365_c1
433 nmdc:mga0yw44_22650_c1
434 nmdc:mga0yw44_29305_c1
435 nmdc:mga05p37_224943_c1
436 nmdc:mga05p37_378553_c1
437 nmdc:mga09592_134936_c1
438 nmdc:mga09592_135683_c1
439 nmdc:mga09592_170377_c1
440 nmdc:mga09592_312_c1
441 nmdc:mga0qj67_251207_c1
442 nmdc:mga0qj67_361_c1
443 nmdc:mga06r32_100441_c1
444 nmdc:mga06r32_384788_c1
445 nmdc:mga06r32_43983_c1
446 nmdc:mga06r32_545_c1
447 nmdc:mga06r32_61589_c1
448 nmdc:mga06r32_61629_c1
449 nmdc:mga08y16_149464_c1
450 nmdc:mga08y16_17187_c1
451 nmdc:mga0n895_136315_c1
452 nmdc:mga0a205_525626_c1
453 Ga0500566_0000058
454 Ga0500568_0049730
455 Ga0500616_0147537
456 Ga0501084_0005393
457 Ga0501084_0010235
458 Ga0501084_0013136
459 Ga0501084_0067351
460 Ga0501084_0110453
461 Ga0501082_0002858
462 Ga0501082_0009418
463 Ga0501082_0036996
464 Ga0501082_0068601
465 Ga0530510_0003380
466 Ga0530510_0005061
467 Ga0530510_0024300
468 2915360709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

37

354

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.8113 2 327
1ezw-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri 0.8067 2 327
1ezw-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri 0.7978 2 327
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.7965 3 327
3c8n-assembly1.cif.gz_B crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.7922 2 323
ID Description Score Start End Superfamily
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.856 9 324 3.20.20.30
af_P9WM03_11_339_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8463 7 324 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8459 9 324 3.20.20.30
af_O53565_5_346_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8384 1 327 3.20.20.30
af_O53565_5_346_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8313 1 327 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A1C5F662-F1-model_v4 Luciferase-like monooxygenase 0.9734 3 152 GO:0004497
GO:0016705
AF-A0A6L6CTH4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9711 1 143 GO:0016705
AF-A0A6L6CTH4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9579 1 143 GO:0016705
AF-A0A2V7F1Y7-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9477 2 328 GO:0016705
AF-A0A3N1LFL5-F1-model_v4 deleted 0.9464 2 329

Map