F346923

General Info

Members Datasets Scaffolds Average Seq Length
234 156 468 179

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100000651|Ga0068863_10000065128
Length 216
Sequence MSGAKPGPIPACSGAIRMSGIRRCERKEWRYNAPMTGKIVTPGRPQPGEYGQYYEKYIALVPATDILGALEAQRLVMSQLLGARSEREGNFRYAPDKWTVKEVIGHLADSERIFAYRALRFARGDQTPLSGFEQDDYVKGGGFSERTLADLAEEFAEVRGANISLFSGLDAAAWQKRGVANKSEITVRALAYIIAGHELHHRRILEEKYLPAIPRA

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.99
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 33.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100000651 3300005841 Bacteria 35181
2 JGI25406J46586_10010347 3300003203 Bacteria 4140
3 Ga0065712_10120143 3300005290 Bacteria 1682
4 Ga0065715_10392881 3300005293 Bacteria 854
5 Ga0070690_100444568 3300005330 Bacteria 960
6 Ga0070670_100164108 3300005331 Unclassified 1926
7 Ga0068869_100173297 3300005334 Unclassified 1687
8 Ga0068869_100328767 3300005334 Bacteria 1241
9 Ga0070680_100026326 3300005336 Unclassified 4652
10 Ga0070680_100036529 3300005336 Bacteria 3969
11 Ga0070680_100106706 3300005336 Unclassified 2329
12 Ga0070682_100007914 3300005337 Bacteria 5981
13 Ga0070682_100271041 3300005337 Bacteria 1233
14 Ga0068868_100762998 3300005338 Unclassified 870
15 Ga0070691_10226052 3300005341 Bacteria 994
16 Ga0070687_100236265 3300005343 Bacteria 1127
17 Ga0070661_100007045 3300005344 Bacteria 7754
18 Ga0070659_100195640 3300005366 Bacteria 1663
19 Ga0070667_100503093 3300005367 Unclassified 1111
20 Ga0070713_100234795 3300005436 Unclassified 1668
21 Ga0070701_10002708 3300005438 Bacteria 6871
22 Ga0070711_100002919 3300005439 Bacteria 9849
23 Ga0070711_100575143 3300005439 Bacteria 937
24 Ga0070705_100008994 3300005440 Bacteria 4957
25 Ga0070694_100086781 3300005444 Bacteria 2187
26 Ga0070708_100001249 3300005445 Bacteria 19527
27 Ga0070708_100866148 3300005445 Bacteria 849
28 Ga0070678_100116371 3300005456 Bacteria 2100
29 Ga0070681_10004671 3300005458 Bacteria 13095
30 Ga0070681_10035693 3300005458 Bacteria 4993
31 Ga0070681_10965546 3300005458 Bacteria 771
32 Ga0068867_100063086 3300005459 Bacteria 2754
33 Ga0070685_10145163 3300005466 Viruses 1498
34 Ga0070706_100039206 3300005467 Bacteria 4373
35 Ga0070706_100398775 3300005467 Unclassified 1281
36 Ga0070706_100810624 3300005467 Unclassified 866
37 Ga0070707_100005367 3300005468 Bacteria 11989
38 Ga0070707_100306548 3300005468 Bacteria 1543
39 Ga0070707_101605450 3300005468 Bacteria 617
40 Ga0070698_100066557 3300005471 Unclassified 3626
41 Ga0070698_100134007 3300005471 Unclassified 2432
42 Ga0070698_100158271 3300005471 Unclassified 2210
43 Ga0070679_100034371 3300005530 Bacteria 5024
44 Ga0070679_100034580 3300005530 Bacteria 5009
45 Ga0070684_100000363 3300005535 Bacteria 31171
46 Ga0070697_100000901 3300005536 Bacteria 22370
47 Ga0070697_100139152 3300005536 Unclassified 2040
48 Ga0070697_100444223 3300005536 Bacteria 1129
49 Ga0070697_100725555 3300005536 Unclassified 877
50 Ga0070686_100000004 3300005544 Bacteria 262514
51 Ga0070695_100031355 3300005545 Bacteria 3315
52 Ga0070695_100149153 3300005545 Unclassified 1630
53 Ga0070693_100528137 3300005547 Unclassified 841
54 Ga0070665_100019942 3300005548 Bacteria 6734
55 Ga0070704_100048906 3300005549 Unclassified 2962
56 Ga0070664_100055393 3300005564 Bacteria 3366
57 Ga0068857_100033017 3300005577 Bacteria 4576
58 Ga0068856_101643228 3300005614 Unclassified 655
59 Ga0070702_100139152 3300005615 Bacteria 1544
60 Ga0068859_100079612 3300005617 Viruses 3317
61 Ga0068859_100747453 3300005617 Bacteria 1067
62 Ga0068859_101666043 3300005617 Unclassified 704
63 Ga0068861_100135848 3300005719 Unclassified 2001
64 Ga0068870_10001482 3300005840 Bacteria 9506
65 Ga0068863_100026308 3300005841 Bacteria 5551
66 Ga0068863_100175524 3300005841 Viruses 2056
67 Ga0068860_100291599 3300005843 Bacteria 1597
68 Ga0068862_100652758 3300005844 Bacteria 1015
69 Ga0081540_1141876 3300005983 Bacteria 962
70 Ga0081539_10000033 3300005985 Bacteria 309306
71 Ga0081539_10002351 3300005985 Bacteria 27174
72 Ga0070717_10276138 3300006028 Bacteria 1489
73 Ga0070715_10145410 3300006163 Bacteria 1156
74 Ga0070716_100101901 3300006173 Unclassified 1762
75 Ga0075431_100027905 3300006847 Bacteria 5793
76 Ga0075433_10001882 3300006852 Bacteria 15777
77 Ga0075434_100037573 3300006871 Unclassified 4795
78 Ga0075434_100039692 3300006871 Bacteria 4664
79 Ga0075434_100097471 3300006871 Bacteria 2945
80 Ga0075434_100836307 3300006871 Unclassified 936
81 Ga0068865_100576428 3300006881 Bacteria 948
82 Ga0075436_100146275 3300006914 Bacteria 1662
83 Ga0075436_100666441 3300006914 Unclassified 769
84 Ga0075436_100823425 3300006914 Unclassified 692
85 Ga0097620_100079612 3300006931 Viruses 3317
86 Ga0097620_100747268 3300006931 Bacteria 1067
87 Ga0097620_101666627 3300006931 Unclassified 704
88 Ga0075435_100048963 3300007076 Unclassified 3397
89 Ga0075435_100614197 3300007076 Unclassified 943
90 Ga0105245_10301224 3300009098 Unclassified 1573
91 Ga0105245_10397350 3300009098 Bacteria 1377
92 Ga0105247_10098452 3300009101 Unclassified 1867
93 Ga0105247_10159361 3300009101 Unclassified 1493
94 Ga0105243_11263989 3300009148 Unclassified 754
95 Ga0105242_10090053 3300009176 Unclassified 2580
96 Ga0105248_10057951 3300009177 Bacteria 4349
97 Ga0105237_10922907 3300009545 Unclassified 880
98 Ga0105238_12206932 3300009551 Unclassified 585
99 Ga0105249_10164341 3300009553 Viruses 2148
100 Ga0105239_10167499 3300010375 Bacteria 2457
101 Ga0157373_10066734 3300013100 Bacteria 2544
102 Ga0157374_10373498 3300013296 Bacteria 1420
103 Ga0157378_10064876 3300013297 Bacteria 3267
104 Ga0157378_10122016 3300013297 Bacteria 2403
105 Ga0157378_10485929 3300013297 Unclassified 1231
106 Ga0163162_10011499 3300013306 Bacteria 8631
107 Ga0163162_10564957 3300013306 Unclassified 1265
108 Ga0163163_10094342 3300014325 Bacteria 3010
109 Ga0163163_10142120 3300014325 Bacteria 2443
110 Ga0157379_10010641 3300014968 Bacteria 8019
111 Ga0157379_10011477 3300014968 Bacteria 7732
112 Ga0157379_10047475 3300014968 Bacteria 3830
113 Ga0157379_10217438 3300014968 Bacteria 1731
114 Ga0207710_10131635 3300025900 Unclassified 1201
115 Ga0207685_10210381 3300025905 Unclassified 919
116 Ga0207685_10282835 3300025905 Bacteria 814
117 Ga0207643_10002725 3300025908 Bacteria 9553
118 Ga0207684_10000509 3300025910 Bacteria 48380
119 Ga0207684_10009236 3300025910 Bacteria 8712
120 Ga0207684_10335593 3300025910 Unclassified 1302
121 Ga0207654_10109249 3300025911 Bacteria 1718
122 Ga0207707_10017126 3300025912 Bacteria 6314
123 Ga0207707_10023752 3300025912 Bacteria 5361
124 Ga0207707_10307604 3300025912 Bacteria 1370
125 Ga0207695_10052185 3300025913 Unclassified 4286
126 Ga0207693_10259129 3300025915 Bacteria 1364
127 Ga0207663_10000022 3300025916 Bacteria 134855
128 Ga0207660_10025612 3300025917 Bacteria 4007
129 Ga0207660_10057617 3300025917 Bacteria 2783
130 Ga0207662_10083249 3300025918 Bacteria 1955
131 Ga0207649_10009182 3300025920 Bacteria 5408
132 Ga0207652_10022458 3300025921 Bacteria 5220
133 Ga0207652_10308511 3300025921 Bacteria 1428
134 Ga0207646_10014542 3300025922 Bacteria 7470
135 Ga0207646_10305456 3300025922 Bacteria 1437
136 Ga0207646_10369766 3300025922 Unclassified 1295
137 Ga0207650_10281217 3300025925 Unclassified 1355
138 Ga0207687_10375148 3300025927 Unclassified 1164
139 Ga0207687_10721434 3300025927 Bacteria 847
140 Ga0207700_10226743 3300025928 Unclassified 1587
141 Ga0207690_10166531 3300025932 Bacteria 1647
142 Ga0207704_10244995 3300025938 Unclassified 1342
143 Ga0207665_10031393 3300025939 Bacteria 3514
144 Ga0207665_10093909 3300025939 Unclassified 2083
145 Ga0207711_10101201 3300025941 Bacteria 2550
146 Ga0207661_10006075 3300025944 Bacteria 8527
147 Ga0207658_10733720 3300025986 Unclassified 894
148 Ga0207703_10069093 3300026035 Bacteria 2912
149 Ga0207641_10003825 3300026088 Bacteria 13184
150 Ga0207648_10086173 3300026089 Bacteria 2740
151 Ga0207675_100027331 3300026118 Bacteria 5314
152 Ga0268266_10000194 3300028379 Bacteria 106020
153 Ga0268264_10337810 3300028381 Bacteria 1430
154 Ga0268264_10419880 3300028381 Unclassified 1289
155 Ga0268264_10499082 3300028381 Unclassified 1187
156 Ga0307513_10000211 3300031456 Bacteria 84413
157 Ga0307416_101603018 3300032002 Bacteria 756
158 Ga0307411_11031431 3300032005 Bacteria 738
159 Ga0307415_100022417 3300032126 Bacteria 3897
160 Ga0316212_1003100 3300033547 Bacteria 2395
161 Ga0373943_0662121 3300035170 Bacteria 617
162 Ga0373955_0283571 3300035172 Unclassified 997
163 Ga0373931_0098140 3300035691 Bacteria 1644
164 Ga0373927_0226545 3300035695 Bacteria 1228
165 Ga0373927_0579869 3300035695 Bacteria 741
166 Ga0373933_0608502 3300035724 Bacteria 718
167 Ga0373937_0146851 3300036401 Unclassified 2208
168 Ga0373937_0530036 3300036401 Bacteria 1119
169 Ga0436362_0435570 3300039453 Bacteria 5939
170 Ga0451577_0073576 3300042876 Unclassified 3049
171 Ga0453684_0217910 3300044712 Unclassified 2213
172 Ga0451576_0015453 3300045051 Bacteria 8455
173 Ga0495592_0246434 3300046454 Unclassified 1183
174 Ga0495651_0461348 3300046462 Bacteria 819
175 Ga0495653_0413696 3300046463 Unclassified 854
176 Ga0495580_0010660 3300046472 Bacteria 7140
177 Ga0495580_0024693 3300046472 Unclassified 4398
178 Ga0495580_0228474 3300046472 Bacteria 1278
179 Ga0495582_0064366 3300046473 Unclassified 2024
180 Ga0495664_0119085 3300046477 Bacteria 1597
181 Ga0495608_0025596 3300046511 Bacteria 4028
182 Ga0495608_0110683 3300046511 Unclassified 1766
183 Ga0495630_0039605 3300046517 Bacteria 3523
184 Ga0495630_0126787 3300046517 Unclassified 1937
185 Ga0495630_0201401 3300046517 Unclassified 1519
186 Ga0495652_0042380 3300046529 Bacteria 3925
187 Ga0495665_0106688 3300046531 Bacteria 1470
188 Ga0495640_0093500 3300046533 Bacteria 1981
189 Ga0495586_0066759 3300046535 Bacteria 1961
190 Ga0495645_0620554 3300046543 Unclassified 663
191 Ga0495634_0544483 3300046642 Unclassified 677
192 Ga0495635_0085639 3300046663 Bacteria 2156
193 Ga0495635_0365059 3300046663 Bacteria 962
194 Ga0495657_0116915 3300046675 Bacteria 1683
195 Ga0495657_0392193 3300046675 Unclassified 818
196 Ga0495646_0192190 3300046680 Unclassified 1115
197 Ga0495647_0214566 3300046681 Unclassified 848
198 Ga0495658_0215760 3300046683 Unclassified 1200
199 Ga0495613_0021139 3300046689 Bacteria 4852
200 Ga0495600_0066265 3300046809 Bacteria 2361
201 Ga0495604_0033307 3300047317 Unclassified 4080
202 Ga0495604_0109734 3300047317 Unclassified 2014
203 Ga0495674_0032839 3300047319 Bacteria 4704
204 Ga0495674_0065708 3300047319 Unclassified 3150
205 Ga0495674_0277260 3300047319 Bacteria 1374
206 Ga0495674_0393849 3300047319 Bacteria 1119
207 Ga0495680_0083093 3300047322 Bacteria 2415
208 Ga0495680_0294160 3300047322 Unclassified 1141
209 Ga0495675_0153736 3300047444 Unclassified 1420
210 Ga0495675_0276974 3300047444 Unclassified 1001
211 Ga0495684_0001568 3300047471 Bacteria 18313
212 Ga0495684_0050393 3300047471 Bacteria 3179
213 Ga0495684_0156882 3300047471 Bacteria 1699
214 Ga0495602_0070818 3300048088 Bacteria 2981
215 Ga0496102_0000688 3300048905 Bacteria 33768
216 Ga0496103_0014766 3300048906 Bacteria 4642
217 Ga0496104_0024819 3300048907 Bacteria 5519
218 Ga0496106_0041339 3300048909 Bacteria 3454
219 Ga0496106_0370549 3300048909 Bacteria 1151
220 Ga0496107_0096650 3300048910 Unclassified 2162
221 Ga0496114_0024390 3300048917 Bacteria 4937
222 Ga0501202_152546 3300049652 Bacteria 606
223 nmdc:mga09592_459617_c1 3300050508 Bacteria 1098
224 nmdc:mga06r32_155782_c1 3300050510 Bacteria 2266
225 nmdc:mga0n895_26982_c1 3300050512 Bacteria 5449
226 nmdc:mga0n895_277913_c1 3300050512 Unclassified 1698
227 nmdc:mga0n895_556808_c1 3300050512 Unclassified 1152
228 nmdc:mga0n895_780182_c1 3300050512 Unclassified 947
229 nmdc:mga0rr50_169387_c1 3300050513 Bacteria 1778
230 nmdc:mga0rr50_842465_c1 3300050513 Unclassified 782
231 nmdc:mga08x19_16764_c1 3300050514 Bacteria 4473
232 nmdc:mga08x19_269617_c1 3300050514 Bacteria 1178
233 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
234 nmdc:mga0a205_1684_c1 3300050515 Bacteria 19076
235 Ga0068863_100000651
236 JGI25406J46586_10010347
237 Ga0065712_10120143
238 Ga0065715_10392881
239 Ga0070690_100444568
240 Ga0070670_100164108
241 Ga0068869_100173297
242 Ga0068869_100328767
243 Ga0070680_100026326
244 Ga0070680_100036529
245 Ga0070680_100106706
246 Ga0070682_100007914
247 Ga0070682_100271041
248 Ga0068868_100762998
249 Ga0070691_10226052
250 Ga0070687_100236265
251 Ga0070661_100007045
252 Ga0070659_100195640
253 Ga0070667_100503093
254 Ga0070713_100234795
255 Ga0070701_10002708
256 Ga0070711_100002919
257 Ga0070711_100575143
258 Ga0070705_100008994
259 Ga0070694_100086781
260 Ga0070708_100001249
261 Ga0070708_100866148
262 Ga0070678_100116371
263 Ga0070681_10004671
264 Ga0070681_10035693
265 Ga0070681_10965546
266 Ga0068867_100063086
267 Ga0070685_10145163
268 Ga0070706_100039206
269 Ga0070706_100398775
270 Ga0070706_100810624
271 Ga0070707_100005367
272 Ga0070707_100306548
273 Ga0070707_101605450
274 Ga0070698_100066557
275 Ga0070698_100134007
276 Ga0070698_100158271
277 Ga0070679_100034371
278 Ga0070679_100034580
279 Ga0070684_100000363
280 Ga0070697_100000901
281 Ga0070697_100139152
282 Ga0070697_100444223
283 Ga0070697_100725555
284 Ga0070686_100000004
285 Ga0070695_100031355
286 Ga0070695_100149153
287 Ga0070693_100528137
288 Ga0070665_100019942
289 Ga0070704_100048906
290 Ga0070664_100055393
291 Ga0068857_100033017
292 Ga0068856_101643228
293 Ga0070702_100139152
294 Ga0068859_100079612
295 Ga0068859_100747453
296 Ga0068859_101666043
297 Ga0068861_100135848
298 Ga0068870_10001482
299 Ga0068863_100026308
300 Ga0068863_100175524
301 Ga0068860_100291599
302 Ga0068862_100652758
303 Ga0081540_1141876
304 Ga0081539_10000033
305 Ga0081539_10002351
306 Ga0070717_10276138
307 Ga0070715_10145410
308 Ga0070716_100101901
309 Ga0075431_100027905
310 Ga0075433_10001882
311 Ga0075434_100037573
312 Ga0075434_100039692
313 Ga0075434_100097471
314 Ga0075434_100836307
315 Ga0068865_100576428
316 Ga0075436_100146275
317 Ga0075436_100666441
318 Ga0075436_100823425
319 Ga0097620_100079612
320 Ga0097620_100747268
321 Ga0097620_101666627
322 Ga0075435_100048963
323 Ga0075435_100614197
324 Ga0105245_10301224
325 Ga0105245_10397350
326 Ga0105247_10098452
327 Ga0105247_10159361
328 Ga0105243_11263989
329 Ga0105242_10090053
330 Ga0105248_10057951
331 Ga0105237_10922907
332 Ga0105238_12206932
333 Ga0105249_10164341
334 Ga0105239_10167499
335 Ga0157373_10066734
336 Ga0157374_10373498
337 Ga0157378_10064876
338 Ga0157378_10122016
339 Ga0157378_10485929
340 Ga0163162_10011499
341 Ga0163162_10564957
342 Ga0163163_10094342
343 Ga0163163_10142120
344 Ga0157379_10010641
345 Ga0157379_10011477
346 Ga0157379_10047475
347 Ga0157379_10217438
348 Ga0207710_10131635
349 Ga0207685_10210381
350 Ga0207685_10282835
351 Ga0207643_10002725
352 Ga0207684_10000509
353 Ga0207684_10009236
354 Ga0207684_10335593
355 Ga0207654_10109249
356 Ga0207707_10017126
357 Ga0207707_10023752
358 Ga0207707_10307604
359 Ga0207695_10052185
360 Ga0207693_10259129
361 Ga0207663_10000022
362 Ga0207660_10025612
363 Ga0207660_10057617
364 Ga0207662_10083249
365 Ga0207649_10009182
366 Ga0207652_10022458
367 Ga0207652_10308511
368 Ga0207646_10014542
369 Ga0207646_10305456
370 Ga0207646_10369766
371 Ga0207650_10281217
372 Ga0207687_10375148
373 Ga0207687_10721434
374 Ga0207700_10226743
375 Ga0207690_10166531
376 Ga0207704_10244995
377 Ga0207665_10031393
378 Ga0207665_10093909
379 Ga0207711_10101201
380 Ga0207661_10006075
381 Ga0207658_10733720
382 Ga0207703_10069093
383 Ga0207641_10003825
384 Ga0207648_10086173
385 Ga0207675_100027331
386 Ga0268266_10000194
387 Ga0268264_10337810
388 Ga0268264_10419880
389 Ga0268264_10499082
390 Ga0307513_10000211
391 Ga0307416_101603018
392 Ga0307411_11031431
393 Ga0307415_100022417
394 Ga0316212_1003100
395 Ga0373943_0662121
396 Ga0373955_0283571
397 Ga0373931_0098140
398 Ga0373927_0226545
399 Ga0373927_0579869
400 Ga0373933_0608502
401 Ga0373937_0146851
402 Ga0373937_0530036
403 Ga0436362_0435570
404 Ga0451577_0073576
405 Ga0453684_0217910
406 Ga0451576_0015453
407 Ga0495592_0246434
408 Ga0495651_0461348
409 Ga0495653_0413696
410 Ga0495580_0010660
411 Ga0495580_0024693
412 Ga0495580_0228474
413 Ga0495582_0064366
414 Ga0495664_0119085
415 Ga0495608_0025596
416 Ga0495608_0110683
417 Ga0495630_0039605
418 Ga0495630_0126787
419 Ga0495630_0201401
420 Ga0495652_0042380
421 Ga0495665_0106688
422 Ga0495640_0093500
423 Ga0495586_0066759
424 Ga0495645_0620554
425 Ga0495634_0544483
426 Ga0495635_0085639
427 Ga0495635_0365059
428 Ga0495657_0116915
429 Ga0495657_0392193
430 Ga0495646_0192190
431 Ga0495647_0214566
432 Ga0495658_0215760
433 Ga0495613_0021139
434 Ga0495600_0066265
435 Ga0495604_0033307
436 Ga0495604_0109734
437 Ga0495674_0032839
438 Ga0495674_0065708
439 Ga0495674_0277260
440 Ga0495674_0393849
441 Ga0495680_0083093
442 Ga0495680_0294160
443 Ga0495675_0153736
444 Ga0495675_0276974
445 Ga0495684_0001568
446 Ga0495684_0050393
447 Ga0495684_0156882
448 Ga0495602_0070818
449 Ga0496102_0000688
450 Ga0496103_0014766
451 Ga0496104_0024819
452 Ga0496106_0041339
453 Ga0496106_0370549
454 Ga0496107_0096650
455 Ga0496114_0024390
456 Ga0501202_152546
457 nmdc:mga09592_459617_c1
458 nmdc:mga06r32_155782_c1
459 nmdc:mga0n895_26982_c1
460 nmdc:mga0n895_277913_c1
461 nmdc:mga0n895_556808_c1
462 nmdc:mga0n895_780182_c1
463 nmdc:mga0rr50_169387_c1
464 nmdc:mga0rr50_842465_c1
465 nmdc:mga08x19_16764_c1
466 nmdc:mga08x19_269617_c1
467 nmdc:mga08x19_2_c1
468 nmdc:mga0a205_1684_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

69

205

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.8276 30 170
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8134 29 171
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8121 30 173
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8112 30 173
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8093 30 170
ID Description Score Start End Superfamily
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8276 30 170 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8103 29 170 1.20.120.450
5cqvB01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.801 29 134 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8 22 166 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7992 30 170 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2N9LGH4-F1-model_v4 DinB-like domain-containing protein 0.9966 6 174
AF-A0A7W1GYM8-F1-model_v4 DinB family protein 0.9956 61 173
AF-A0A7Y3GR22-F1-model_v4 DinB family protein 0.9955 62 174
AF-A0A0M4FNY7-F1-model_v4 Damage-inducible protein DinB 0.994 9 172
AF-A0A0M5JAC7-F1-model_v4 Damage-inducible protein DinB 0.9926 6 173

Map