F346921

General Info

Members Datasets Scaffolds Average Seq Length
234 168 233 334

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100329054|Ga0068864_1003290542
Length 364
Sequence MKKLIAFCTLAALCAAGCGKKKDEGSGAAPAADDKAVPAKPAESGQVSLNASGSTFQKPYQEIAIEGFTKSHKGVTINYGGGGSGKGRQDLADQVVDFAGADSPYKDADLAKNKGGDVLYFPILLGAITISYNLDGVDKLQLSPATIAKIFQRDIKKWNDKDIAADNPGAKLPDADIVVAHRSDGSGTTDNFTKYLDKTAKDVWRLKSGSTVEWPADTQAGNGNPGVAQIVKSTKGSVGYVDLSDAKASGLHFASIKNQAGKYVEPSSDTASAAGAGIEVKDNLLFSALDPQGDAAYPITYQSWVIAYAKQSDATKGAALKSYIRYLVTEGQSQLKSLDFAALPKNLADKAVAQIDKIQVPGAQ

Samples

Sample ID Description Type Environment
1 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
79 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
153 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
160 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
161 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
162 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
166 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
167 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
168 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.43
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.26
Nodule 0
Rhizoplane 4.27
Rhizosphere 81.2
Stem 0
Stem Tuber 0
Unclassified 7.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10001201 3300005327 Bacteria 22187
2 Ga0070683_100001426 3300005329 Bacteria 18347
3 Ga0070680_100168302 3300005336 Bacteria 1843
4 Ga0070682_100044198 3300005337 Bacteria 2758
5 Ga0070682_100100362 3300005337 Bacteria 1910
6 Ga0070689_100133093 3300005340 Bacteria 1995
7 Ga0070709_10008995 3300005434 Bacteria 5502
8 Ga0070714_100000826 3300005435 Bacteria 21909
9 Ga0070714_100017958 3300005435 Bacteria 5736
10 Ga0070714_100062181 3300005435 Bacteria 3208
11 Ga0070713_100068104 3300005436 Bacteria 2999
12 Ga0070710_10000369 3300005437 Bacteria 21100
13 Ga0070711_100011933 3300005439 Bacteria 5409
14 Ga0070678_100003023 3300005456 Bacteria 9320
15 Ga0070681_10103517 3300005458 Bacteria 2791
16 Ga0070681_10147419 3300005458 Bacteria 2281
17 Ga0070679_100058238 3300005530 Bacteria 3849
18 Ga0070684_100045703 3300005535 Bacteria 3792
19 Ga0068853_100000622 3300005539 Bacteria 24335
20 Ga0070665_100020369 3300005548 Bacteria 6661
21 Ga0068855_100135920 3300005563 Bacteria 2805
22 Ga0068856_100058603 3300005614 Bacteria 3803
23 Ga0068852_100300480 3300005616 Bacteria 1554
24 Ga0068859_100017136 3300005617 Bacteria 7275
25 Ga0068864_100233940 3300005618 Bacteria 1700
26 Ga0068864_100329054 3300005618 Bacteria 1437
27 Ga0068861_100091808 3300005719 Bacteria 2398
28 Ga0068863_100014759 3300005841 Bacteria 7514
29 Ga0068863_100046754 3300005841 Bacteria 4108
30 Ga0068860_100173606 3300005843 Bacteria 2083
31 Ga0070717_10001727 3300006028 Bacteria 15244
32 Ga0070717_10240762 3300006028 Bacteria 1595
33 Ga0070716_100000339 3300006173 Bacteria 18942
34 Ga0097620_100017136 3300006931 Bacteria 7275
35 Ga0105240_10001207 3300009093 Bacteria 45060
36 Ga0105245_10071787 3300009098 Bacteria 3145
37 Ga0105245_10075676 3300009098 Bacteria 3065
38 Ga0105237_10000062 3300009545 Bacteria 144236
39 Ga0105237_10356307 3300009545 Bacteria 1467
40 Ga0105238_10001818 3300009551 Bacteria 21399
41 Ga0105238_10053651 3300009551 Bacteria 4050
42 Ga0105239_10037110 3300010375 Bacteria 5345
43 Ga0105239_10102213 3300010375 Bacteria 3172
44 Ga0157374_10102633 3300013296 Bacteria 2743
45 Ga0157374_10258875 3300013296 Bacteria 1713
46 Ga0157378_10018508 3300013297 Bacteria 6121
47 Ga0157378_10046871 3300013297 Bacteria 3842
48 Ga0163163_10290624 3300014325 Bacteria 1687
49 Ga0213875_10007510 3300021388 Bacteria 5621
50 Ga0207692_10000108 3300025898 Bacteria 24597
51 Ga0207699_10006241 3300025906 Bacteria 5755
52 Ga0207707_10246462 3300025912 Bacteria 1552
53 Ga0207695_10017766 3300025913 Bacteria 8255
54 Ga0207671_10000140 3300025914 Bacteria 111643
55 Ga0207663_10004545 3300025916 Bacteria 6911
56 Ga0207652_10002200 3300025921 Bacteria 16631
57 Ga0207694_10010843 3300025924 Bacteria 6879
58 Ga0207694_10097919 3300025924 Bacteria 2321
59 Ga0207700_10001223 3300025928 Bacteria 14707
60 Ga0207664_10001872 3300025929 Bacteria 13842
61 Ga0207664_10062041 3300025929 Bacteria 2984
62 Ga0207709_10241839 3300025935 Bacteria 1313
63 Ga0207665_10001014 3300025939 Bacteria 18945
64 Ga0207661_10011865 3300025944 Bacteria 6329
65 Ga0207661_10198663 3300025944 Bacteria 1762
66 Ga0207667_10047207 3300025949 Bacteria 4558
67 Ga0207639_10001770 3300026041 Bacteria 14534
68 Ga0207702_10134853 3300026078 Bacteria 2226
69 Ga0207641_10016006 3300026088 Bacteria 6141
70 Ga0207641_10039615 3300026088 Bacteria 3942
71 Ga0207683_10003575 3300026121 Bacteria 13559
72 Ga0268266_10002141 3300028379 Bacteria 21728
73 Ga0268264_10117728 3300028381 Bacteria 2337
74 Ga0265319_1017876 3300028563 Bacteria 2687
75 Ga0265318_10000042 3300028577 Bacteria 130384
76 Ga0307517_10015153 3300028786 Bacteria 10267
77 Ga0307515_10011336 3300028794 Bacteria 16921
78 Ga0265338_10013561 3300028800 Bacteria 9183
79 Ga0265338_10017119 3300028800 Bacteria 7834
80 Ga0265330_10000026 3300031235 Bacteria 140332
81 Ga0265332_10000257 3300031238 Bacteria 42299
82 Ga0265332_10008702 3300031238 Bacteria 4547
83 Ga0265328_10006162 3300031239 Bacteria 5101
84 Ga0265320_10000079 3300031240 Bacteria 83732
85 Ga0265329_10008371 3300031242 Bacteria 3926
86 Ga0265340_10068426 3300031247 Bacteria 1686
87 Ga0265331_10000010 3300031250 Bacteria 312076
88 Ga0265316_10003805 3300031344 Bacteria 15160
89 Ga0307513_10038586 3300031456 Bacteria 5302
90 Ga0307509_10000227 3300031507 Bacteria 90633
91 Ga0307509_10001018 3300031507 Bacteria 48218
92 Ga0307509_10009075 3300031507 Bacteria 12510
93 Ga0307509_10031903 3300031507 Bacteria 5810
94 Ga0265313_10002533 3300031595 Bacteria 15672
95 Ga0307508_10010266 3300031616 Bacteria 8568
96 Ga0307508_10144243 3300031616 Bacteria 1985
97 Ga0307508_10206532 3300031616 Bacteria 1565
98 Ga0265314_10000035 3300031711 Bacteria 240629
99 Ga0265314_10172030 3300031711 Bacteria 1306
100 Ga0265342_10003999 3300031712 Bacteria 11798
101 Ga0265342_10061328 3300031712 Bacteria 2216
102 Ga0307516_10053581 3300031730 Bacteria 3944
103 Ga0307516_10143002 3300031730 Bacteria 2159
104 Ga0307507_10048714 3300033179 Bacteria 4117
105 Ga0316214_1002158 3300033545 Bacteria 2406
106 Ga0373934_0000453 3300035086 Bacteria 14355
107 Ga0373949_0000176 3300035090 Bacteria 24528
108 Ga0373949_0003025 3300035090 Bacteria 4129
109 Ga0373936_0000028 3300035113 Bacteria 118834
110 Ga0373936_0000085 3300035113 Bacteria 34909
111 Ga0373945_0053598 3300035116 Bacteria 1489
112 Ga0373953_0000923 3300035117 Bacteria 8227
113 Ga0373953_0029424 3300035117 Bacteria 2124
114 Ga0373954_0015728 3300035118 Bacteria 3384
115 Ga0373956_0000847 3300035119 Bacteria 12728
116 Ga0373955_0000515 3300035172 Bacteria 16465
117 Ga0373927_0083650 3300035695 Bacteria 2069
118 Ga0373933_0000507 3300035724 Bacteria 24320
119 Ga0373947_0032721 3300035725 Bacteria 3066
120 Ga0373937_0001460 3300036401 Bacteria 19784
121 Ga0373937_0127864 3300036401 Bacteria 2371
122 Ga0372808_002944 3300036459 Bacteria 2031
123 Ga0373925_0013740 3300037068 Bacteria 5860
124 Ga0395899_0014770 3300037312 Bacteria 5959
125 Ga0395899_0101528 3300037312 Bacteria 2076
126 Ga0395900_0088498 3300037418 Bacteria 3184
127 Ga0395900_0126033 3300037418 Bacteria 2626
128 Ga0395898_0031468 3300037466 Bacteria 5301
129 Ga0395901_0159410 3300038443 Bacteria 2369
130 Ga0495592_0002671 3300046454 Bacteria 12603
131 Ga0495592_0004469 3300046454 Bacteria 10228
132 Ga0495603_0038611 3300046455 Bacteria 2863
133 Ga0495629_0003864 3300046459 Bacteria 11294
134 Ga0495641_0004654 3300046461 Bacteria 9591
135 Ga0495651_0000798 3300046462 Bacteria 24389
136 Ga0495651_0002496 3300046462 Bacteria 14228
137 Ga0495653_0004643 3300046463 Bacteria 11110
138 Ga0495653_0008354 3300046463 Bacteria 8485
139 Ga0495650_0021093 3300046471 Bacteria 3158
140 Ga0495580_0009989 3300046472 Bacteria 7421
141 Ga0495582_0003757 3300046473 Bacteria 8560
142 Ga0495606_0000632 3300046507 Bacteria 55347
143 Ga0495608_0000630 3300046511 Bacteria 24324
144 Ga0495608_0026049 3300046511 Bacteria 3990
145 Ga0495618_0104847 3300046514 Bacteria 1810
146 Ga0495628_0001397 3300046516 Bacteria 22153
147 Ga0495628_0007939 3300046516 Bacteria 9142
148 Ga0495630_0014354 3300046517 Bacteria 5770
149 Ga0495630_0015723 3300046517 Bacteria 5529
150 Ga0495630_0061521 3300046517 Bacteria 2819
151 Ga0495652_0003271 3300046529 Bacteria 16138
152 Ga0495652_0003576 3300046529 Bacteria 15253
153 Ga0495665_0017145 3300046531 Bacteria 3896
154 Ga0495640_0009138 3300046533 Bacteria 7737
155 Ga0495587_0000605 3300046536 Bacteria 24467
156 Ga0495587_0017195 3300046536 Bacteria 4496
157 Ga0495645_0001541 3300046543 Bacteria 15575
158 Ga0495667_0000537 3300046559 Bacteria 24240
159 Ga0495667_0001852 3300046559 Bacteria 14028
160 Ga0495668_0000903 3300046616 Bacteria 33414
161 Ga0495634_0003777 3300046642 Bacteria 12042
162 Ga0495634_0007391 3300046642 Bacteria 8266
163 Ga0495634_0105559 3300046642 Bacteria 1816
164 Ga0495625_0001114 3300046660 Bacteria 34828
165 Ga0495635_0007332 3300046663 Bacteria 7697
166 Ga0495657_0001623 3300046675 Bacteria 19291
167 Ga0495657_0019891 3300046675 Bacteria 4837
168 Ga0495599_0000408 3300046678 Bacteria 24589
169 Ga0495599_0000918 3300046678 Bacteria 16473
170 Ga0495623_0003230 3300046679 Bacteria 10766
171 Ga0495646_0019395 3300046680 Bacteria 4306
172 Ga0495613_0010040 3300046689 Bacteria 7033
173 Ga0495624_0151323 3300046690 Bacteria 1419
174 Ga0495600_0012611 3300046809 Bacteria 5291
175 Ga0495600_0083537 3300046809 Bacteria 2084
176 Ga0495581_0005608 3300047315 Bacteria 7275
177 Ga0495604_0001543 3300047317 Bacteria 18968
178 Ga0495674_0011185 3300047319 Bacteria 8474
179 Ga0495674_0013767 3300047319 Bacteria 7593
180 Ga0495674_0073521 3300047319 Bacteria 2946
181 Ga0495680_0003448 3300047322 Bacteria 15586
182 Ga0495680_0009581 3300047322 Bacteria 8699
183 Ga0495675_0006489 3300047444 Bacteria 7159
184 Ga0495684_0003448 3300047471 Bacteria 12381
185 Ga0495684_0113678 3300047471 Bacteria 2041
186 Ga0495593_0003416 3300047673 Bacteria 9511
187 Ga0495602_0001263 3300048088 Bacteria 24919
188 Ga0495602_0172651 3300048088 Bacteria 1676
189 Ga0495614_0018606 3300048089 Bacteria 3009
190 Ga0495626_0000604 3300048091 Bacteria 35052
191 Ga0496102_0163175 3300048905 Bacteria 2096
192 Ga0496107_0216507 3300048910 Bacteria 1424
193 Ga0496108_0123832 3300048911 Bacteria 2218
194 Ga0496109_0038035 3300048912 Bacteria 4349
195 Ga0496110_0127621 3300048913 Bacteria 2295
196 Ga0496110_0204493 3300048913 Bacteria 1794
197 Ga0496111_0026353 3300048914 Bacteria 4104
198 Ga0496112_0144078 3300048915 Bacteria 2351
199 Ga0496114_0002038 3300048917 Bacteria 15386
200 Ga0496114_0054261 3300048917 Bacteria 3342
201 Ga0496126_0119944 3300048929 Bacteria 2282
202 Ga0501046_0269250 3300049580 Bacteria 1250
203 Ga0501047_0010362 3300049581 Bacteria 8819
204 Ga0501047_0094617 3300049581 Bacteria 2866
205 Ga0501070_0024064 3300049586 Bacteria 5106
206 Ga0501070_0097478 3300049586 Bacteria 2432
207 Ga0501070_0176719 3300049586 Bacteria 1757
208 Ga0501074_0016283 3300049590 Bacteria 5399
209 Ga0501227_011488 3300049665 Bacteria 1929
210 Ga0501233_001603 3300049668 Bacteria 3892
211 Ga0501044_0033916 3300049823 Bacteria 5358
212 Ga0501044_0116045 3300049823 Bacteria 2683
213 Ga0500635_0001580 3300053080 Bacteria 5492
214 Ga0495595_0000843 3300053084 Bacteria 11740
215 Ga0495595_0014565 3300053084 Bacteria 3340
216 Ga0495619_0043514 3300053085 Bacteria 2944
217 Ga0495619_0153564 3300053085 Bacteria 1588
218 Ga0500566_0002058 3300053094 Bacteria 11880
219 Ga0500566_0002198 3300053094 Bacteria 11505
220 Ga0500566_0009267 3300053094 Bacteria 5820
221 Ga0500554_001490 3300053102 Bacteria 4523
222 Ga0500595_000279 3300053119 Bacteria 33910
223 Ga0500614_000162 3300053123 Bacteria 16873
224 Ga0500614_002960 3300053123 Bacteria 3709
225 Ga0500614_004417 3300053123 Bacteria 2972
226 Ga0500614_017137 3300053123 Bacteria 1634
227 Ga0500642_0022239 3300053130 Bacteria 2527
228 Ga0500658_0026258 3300053134 Bacteria 2243
229 Ga0500568_0010521 3300053139 Bacteria 4327
230 Ga0500603_003995 3300053150 Bacteria 3155
231 Ga0500636_0077698 3300053177 Bacteria 1917
232 Ga0500601_002211 3300053737 Bacteria 2092
233 Ga0500661_021978 3300055283 Bacteria 1132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036459 Ga0372808_002944 Ga0372808_002944_1188_1985 263
2 3300049580 Ga0501046_0269250 Ga0501046_0269250_92_1012 300
3 3300048905 Ga0496102_0163175 Ga0496102_0163175_151_1212 304
4 3300048910 Ga0496107_0216507 Ga0496107_0216507_141_1202 304
5 3300048911 Ga0496108_0123832 Ga0496108_0123832_305_1366 304
6 3300048912 Ga0496109_0038035 Ga0496109_0038035_3087_4148 304
7 3300048913 Ga0496110_0127621 Ga0496110_0127621_764_1825 304
8 3300048914 Ga0496111_0026353 Ga0496111_0026353_2087_3148 304
9 3300048917 Ga0496114_0054261 Ga0496114_0054261_1560_2621 304
10 3300031616 Ga0307508_10206532 Ga0307508_102065322 305
11 3300037312 Ga0395899_0014770 Ga0395899_0014770_4011_4955 306
12 3300037418 Ga0395900_0126033 Ga0395900_0126033_1262_2206 306
13 3300037466 Ga0395898_0031468 Ga0395898_0031468_2810_3754 306
14 3300049586 Ga0501070_0176719 Ga0501070_0176719_368_1396 307
15 3300035086 Ga0373934_0000453 Ga0373934_0000453_1591_2673 310
16 3300035117 Ga0373953_0000923 Ga0373953_0000923_2730_3812 310
17 3300035119 Ga0373956_0000847 Ga0373956_0000847_10974_12056 310
18 3300035172 Ga0373955_0000515 Ga0373955_0000515_7300_8382 310
19 3300035724 Ga0373933_0000507 Ga0373933_0000507_8161_9243 310
20 3300036401 Ga0373937_0001460 Ga0373937_0001460_10527_11609 310
21 3300046454 Ga0495592_0002671 Ga0495592_0002671_3346_4428 310
22 3300046462 Ga0495651_0000798 Ga0495651_0000798_15257_16339 310
23 3300046511 Ga0495608_0000630 Ga0495608_0000630_15077_16159 310
24 3300046516 Ga0495628_0001397 Ga0495628_0001397_5812_6894 310
25 3300046529 Ga0495652_0003271 Ga0495652_0003271_6891_7973 310
26 3300046536 Ga0495587_0000605 Ga0495587_0000605_15210_16292 310
27 3300046559 Ga0495667_0000537 Ga0495667_0000537_8082_9164 310
28 3300046675 Ga0495657_0001623 Ga0495657_0001623_10047_11129 310
29 3300046678 Ga0495599_0000408 Ga0495599_0000408_15332_16414 310
30 3300046679 Ga0495623_0003230 Ga0495623_0003230_1537_2619 310
31 3300046809 Ga0495600_0083537 Ga0495600_0083537_128_1210 310
32 3300047317 Ga0495604_0001543 Ga0495604_0001543_2627_3709 310
33 3300047322 Ga0495680_0003448 Ga0495680_0003448_8176_9258 310
34 3300047444 Ga0495675_0006489 Ga0495675_0006489_2794_3876 310
35 3300048088 Ga0495602_0001263 Ga0495602_0001263_15662_16744 310
36 3300053084 Ga0495595_0000843 Ga0495595_0000843_6385_7467 310
37 3300031616 Ga0307508_10010266 Ga0307508_100102667 312
38 3300037312 Ga0395899_0101528 Ga0395899_0101528_944_2020 314
39 3300037418 Ga0395900_0088498 Ga0395900_0088498_604_1680 314
40 3300055283 Ga0500661_021978 Ga0500661_021978_167_1111 314
41 3300005337 Ga0070682_100100362 Ga0070682_1001003622 315
42 3300053134 Ga0500658_0026258 Ga0500658_0026258_20_967 315
43 3300035113 Ga0373936_0000028 Ga0373936_0000028_85568_86605 316
44 3300005435 Ga0070714_100017958 Ga0070714_1000179583 317
45 3300025929 Ga0207664_10062041 Ga0207664_100620412 317
46 3300049590 Ga0501074_0016283 Ga0501074_0016283_3248_4252 317
47 3300031507 Ga0307509_10001018 Ga0307509_1000101821 318
48 3300049586 Ga0501070_0024064 Ga0501070_0024064_313_1353 318
49 3300048917 Ga0496114_0002038 Ga0496114_0002038_11257_12303 319
50 3300049581 Ga0501047_0094617 Ga0501047_0094617_1369_2400 319
51 3300049586 Ga0501070_0097478 Ga0501070_0097478_44_1075 319
52 3300049823 Ga0501044_0116045 Ga0501044_0116045_351_1382 319
53 3300048929 Ga0496126_0119944 Ga0496126_0119944_131_1207 320
54 3300049665 Ga0501227_011488 Ga0501227_011488_566_1624 321
55 3300049668 Ga0501233_001603 Ga0501233_001603_2764_3822 321
56 3300005456 Ga0070678_100003023 Ga0070678_1000030238 322
57 3300026121 Ga0207683_10003575 Ga0207683_1000357510 322
58 3300046471 Ga0495650_0021093 Ga0495650_0021093_1652_2722 322
59 3300049581 Ga0501047_0010362 Ga0501047_0010362_6060_7148 322
60 3300049823 Ga0501044_0033916 Ga0501044_0033916_1149_2237 322
61 3300033545 Ga0316214_1002158 Ga0316214_10021581 323
62 3300038443 Ga0395901_0159410 Ga0395901_0159410_939_1949 323
63 3300053080 Ga0500635_0001580 Ga0500635_0001580_1667_2749 323
64 3300053094 Ga0500566_0002198 Ga0500566_0002198_6882_7964 323
65 3300053150 Ga0500603_003995 Ga0500603_003995_80_1162 323
66 3300005435 Ga0070714_100062181 Ga0070714_1000621812 324
67 3300046454 Ga0495592_0004469 Ga0495592_0004469_357_1424 324
68 3300046462 Ga0495651_0002496 Ga0495651_0002496_357_1424 324
69 3300046463 Ga0495653_0008354 Ga0495653_0008354_7309_8376 324
70 3300046516 Ga0495628_0007939 Ga0495628_0007939_7842_8909 324
71 3300046517 Ga0495630_0015723 Ga0495630_0015723_139_1206 324
72 3300046529 Ga0495652_0003576 Ga0495652_0003576_4789_5856 324
73 3300046536 Ga0495587_0017195 Ga0495587_0017195_2141_3208 324
74 3300046543 Ga0495645_0001541 Ga0495645_0001541_7380_8447 324
75 3300046642 Ga0495634_0105559 Ga0495634_0105559_556_1623 324
76 3300046675 Ga0495657_0019891 Ga0495657_0019891_971_2038 324
77 3300046678 Ga0495599_0000918 Ga0495599_0000918_7595_8662 324
78 3300046680 Ga0495646_0019395 Ga0495646_0019395_120_1187 324
79 3300046690 Ga0495624_0151323 Ga0495624_0151323_104_1171 324
80 3300046809 Ga0495600_0012611 Ga0495600_0012611_2342_3409 324
81 3300047319 Ga0495674_0011185 Ga0495674_0011185_7250_8317 324
82 3300047322 Ga0495680_0009581 Ga0495680_0009581_138_1205 324
83 3300047471 Ga0495684_0003448 Ga0495684_0003448_8805_9872 324
84 3300053085 Ga0495619_0153564 Ga0495619_0153564_52_1119 324
85 3300005434 Ga0070709_10008995 Ga0070709_100089953 325
86 3300005435 Ga0070714_100000826 Ga0070714_1000008269 325
87 3300005436 Ga0070713_100068104 Ga0070713_1000681041 325
88 3300005437 Ga0070710_10000369 Ga0070710_100003694 325
89 3300005439 Ga0070711_100011933 Ga0070711_1000119333 325
90 3300006028 Ga0070717_10001727 Ga0070717_100017273 325
91 3300006173 Ga0070716_100000339 Ga0070716_10000033918 325
92 3300025898 Ga0207692_10000108 Ga0207692_1000010810 325
93 3300025906 Ga0207699_10006241 Ga0207699_100062415 325
94 3300025916 Ga0207663_10004545 Ga0207663_100045452 325
95 3300025928 Ga0207700_10001223 Ga0207700_100012235 325
96 3300025929 Ga0207664_10001872 Ga0207664_1000187212 325
97 3300025939 Ga0207665_10001014 Ga0207665_100010143 325
98 3300028800 Ga0265338_10013561 Ga0265338_100135615 325
99 3300028800 Ga0265338_10017119 Ga0265338_100171194 325
100 3300035117 Ga0373953_0029424 Ga0373953_0029424_1032_2114 325
101 3300036401 Ga0373937_0127864 Ga0373937_0127864_715_1797 325
102 3300046511 Ga0495608_0026049 Ga0495608_0026049_2185_3267 325
103 3300046559 Ga0495667_0001852 Ga0495667_0001852_157_1239 325
104 3300048088 Ga0495602_0172651 Ga0495602_0172651_150_1232 325
105 3300053084 Ga0495595_0014565 Ga0495595_0014565_195_1277 325
106 3300021388 Ga0213875_10007510 Ga0213875_100075105 326
107 3300053102 Ga0500554_001490 Ga0500554_001490_274_1350 326
108 3300053119 Ga0500595_000279 Ga0500595_000279_30429_31505 326
109 3300053123 Ga0500614_000162 Ga0500614_000162_10407_11483 326
110 3300053737 Ga0500601_002211 Ga0500601_002211_980_2056 326
111 3300005618 Ga0068864_100233940 Ga0068864_1002339401 327
112 3300031238 Ga0265332_10008702 Ga0265332_100087022 327
113 3300035090 Ga0373949_0000176 Ga0373949_0000176_9481_10557 329
114 3300053123 Ga0500614_002960 Ga0500614_002960_39_1049 329
115 3300006028 Ga0070717_10240762 Ga0070717_102407622 330
116 3300013297 Ga0157378_10046871 Ga0157378_100468713 330
117 3300053130 Ga0500642_0022239 Ga0500642_0022239_609_1679 330
118 3300053139 Ga0500568_0010521 Ga0500568_0010521_2651_3652 330
119 3300005340 Ga0070689_100133093 Ga0070689_1001330932 331
120 3300005841 Ga0068863_100014759 Ga0068863_1000147592 331
121 3300009098 Ga0105245_10071787 Ga0105245_100717873 331
122 3300025935 Ga0207709_10241839 Ga0207709_102418391 331
123 3300026088 Ga0207641_10016006 Ga0207641_100160062 331
124 3300031730 Ga0307516_10143002 Ga0307516_101430023 331
125 3300048913 Ga0496110_0204493 Ga0496110_0204493_491_1669 331
126 3300053123 Ga0500614_004417 Ga0500614_004417_1292_2389 331
127 3300053177 Ga0500636_0077698 Ga0500636_0077698_686_1783 332
128 3300031507 Ga0307509_10009075 Ga0307509_100090752 333
129 3300035116 Ga0373945_0053598 Ga0373945_0053598_114_1187 333
130 3300035695 Ga0373927_0083650 Ga0373927_0083650_478_1551 333
131 3300035725 Ga0373947_0032721 Ga0373947_0032721_473_1546 333
132 3300046455 Ga0495603_0038611 Ga0495603_0038611_1733_2803 333
133 3300046459 Ga0495629_0003864 Ga0495629_0003864_1549_2622 333
134 3300046461 Ga0495641_0004654 Ga0495641_0004654_1385_2458 333
135 3300046463 Ga0495653_0004643 Ga0495653_0004643_2542_3615 333
136 3300046472 Ga0495580_0009989 Ga0495580_0009989_1748_2821 333
137 3300046473 Ga0495582_0003757 Ga0495582_0003757_427_1500 333
138 3300046514 Ga0495618_0104847 Ga0495618_0104847_638_1711 333
139 3300046517 Ga0495630_0061521 Ga0495630_0061521_1032_2105 333
140 3300046531 Ga0495665_0017145 Ga0495665_0017145_727_1800 333
141 3300046533 Ga0495640_0009138 Ga0495640_0009138_605_1678 333
142 3300046642 Ga0495634_0007391 Ga0495634_0007391_424_1497 333
143 3300046663 Ga0495635_0007332 Ga0495635_0007332_6448_7521 333
144 3300046689 Ga0495613_0010040 Ga0495613_0010040_5200_6273 333
145 3300047315 Ga0495581_0005608 Ga0495581_0005608_5769_6842 333
146 3300047319 Ga0495674_0073521 Ga0495674_0073521_1018_2091 333
147 3300047471 Ga0495684_0113678 Ga0495684_0113678_141_1214 333
148 3300047673 Ga0495593_0003416 Ga0495593_0003416_761_1834 333
149 3300048089 Ga0495614_0018606 Ga0495614_0018606_1014_2087 333
150 3300053085 Ga0495619_0043514 Ga0495619_0043514_114_1187 333
151 3300013297 Ga0157378_10018508 Ga0157378_100185082 335
152 3300005329 Ga0070683_100001426 Ga0070683_1000014265 336
153 3300005535 Ga0070684_100045703 Ga0070684_1000457032 336
154 3300005548 Ga0070665_100020369 Ga0070665_1000203693 336
155 3300013296 Ga0157374_10258875 Ga0157374_102588752 336
156 3300025944 Ga0207661_10011865 Ga0207661_100118653 336
157 3300028379 Ga0268266_10002141 Ga0268266_1000214114 336
158 3300028794 Ga0307515_10011336 Ga0307515_1001133614 336
159 3300031507 Ga0307509_10000227 Ga0307509_1000022785 336
160 3300035090 Ga0373949_0003025 Ga0373949_0003025_279_1292 336
161 3300005458 Ga0070681_10147419 Ga0070681_101474192 337
162 3300009545 Ga0105237_10356307 Ga0105237_103563072 337
163 3300010375 Ga0105239_10102213 Ga0105239_101022132 337
164 3300013296 Ga0157374_10102633 Ga0157374_101026332 337
165 3300025912 Ga0207707_10246462 Ga0207707_102464622 337
166 3300025944 Ga0207661_10198663 Ga0207661_101986632 337
167 3300026078 Ga0207702_10134853 Ga0207702_101348532 337
168 3300028786 Ga0307517_10015153 Ga0307517_100151536 337
169 3300031616 Ga0307508_10144243 Ga0307508_101442432 337
170 3300031730 Ga0307516_10053581 Ga0307516_100535813 337
171 3300033179 Ga0307507_10048714 Ga0307507_100487143 337
172 3300048915 Ga0496112_0144078 Ga0496112_0144078_913_1968 337
173 3300053094 Ga0500566_0009267 Ga0500566_0009267_4668_5747 337
174 3300005530 Ga0070679_100058238 Ga0070679_1000582383 338
175 3300031247 Ga0265340_10068426 Ga0265340_100684262 338
176 3300031507 Ga0307509_10031903 Ga0307509_100319033 338
177 3300031711 Ga0265314_10172030 Ga0265314_101720302 338
178 3300031712 Ga0265342_10061328 Ga0265342_100613282 338
179 3300046517 Ga0495630_0014354 Ga0495630_0014354_836_1885 338
180 3300046642 Ga0495634_0003777 Ga0495634_0003777_10312_11361 338
181 3300047319 Ga0495674_0013767 Ga0495674_0013767_1514_2563 338
182 iso_pu_bacteria 2887478801 2887482279 338
183 3300037068 Ga0373925_0013740 Ga0373925_0013740_2555_3583 339
184 3300046507 Ga0495606_0000632 Ga0495606_0000632_37729_38778 339
185 3300046616 Ga0495668_0000903 Ga0495668_0000903_20863_21912 339
186 3300046660 Ga0495625_0001114 Ga0495625_0001114_17373_18422 339
187 3300048091 Ga0495626_0000604 Ga0495626_0000604_17406_18455 339
188 3300005618 Ga0068864_100329054 Ga0068864_1003290542 340
189 3300005841 Ga0068863_100046754 Ga0068863_1000467543 340
190 3300009098 Ga0105245_10075676 Ga0105245_100756763 340
191 3300026088 Ga0207641_10039615 Ga0207641_100396153 340
192 3300028577 Ga0265318_10000042 Ga0265318_1000004235 340
193 3300031235 Ga0265330_10000026 Ga0265330_1000002646 340
194 3300031238 Ga0265332_10000257 Ga0265332_100002579 340
195 3300031239 Ga0265328_10006162 Ga0265328_100061622 340
196 3300031240 Ga0265320_10000079 Ga0265320_1000007951 340
197 3300031242 Ga0265329_10008371 Ga0265329_100083713 340
198 3300031250 Ga0265331_10000010 Ga0265331_10000010216 340
199 3300031344 Ga0265316_10003805 Ga0265316_100038055 340
200 3300031456 Ga0307513_10038586 Ga0307513_100385864 340
201 3300031595 Ga0265313_10002533 Ga0265313_100025339 340
202 3300031711 Ga0265314_10000035 Ga0265314_1000003551 340
203 3300031712 Ga0265342_10003999 Ga0265342_100039991 340
204 3300035113 Ga0373936_0000085 Ga0373936_0000085_5891_6946 340
205 3300035118 Ga0373954_0015728 Ga0373954_0015728_1759_2784 340
206 3300053123 Ga0500614_017137 Ga0500614_017137_490_1578 340
207 3300005539 Ga0068853_100000622 Ga0068853_10000062217 341
208 3300005563 Ga0068855_100135920 Ga0068855_1001359202 341
209 3300005614 Ga0068856_100058603 Ga0068856_1000586032 341
210 3300005616 Ga0068852_100300480 Ga0068852_1003004802 341
211 3300005617 Ga0068859_100017136 Ga0068859_1000171365 341
212 3300005719 Ga0068861_100091808 Ga0068861_1000918082 341
213 3300005843 Ga0068860_100173606 Ga0068860_1001736062 341
214 3300006931 Ga0097620_100017136 Ga0097620_1000171365 341
215 3300009551 Ga0105238_10001818 Ga0105238_1000181814 341
216 3300014325 Ga0163163_10290624 Ga0163163_102906242 341
217 3300025924 Ga0207694_10010843 Ga0207694_100108432 341
218 3300025949 Ga0207667_10047207 Ga0207667_100472073 341
219 3300026041 Ga0207639_10001770 Ga0207639_100017702 341
220 3300028381 Ga0268264_10117728 Ga0268264_101177282 341
221 3300053094 Ga0500566_0002058 Ga0500566_0002058_8038_9144 342
222 3300005327 Ga0070658_10001201 Ga0070658_100012018 343
223 3300005336 Ga0070680_100168302 Ga0070680_1001683022 343
224 3300005337 Ga0070682_100044198 Ga0070682_1000441981 343
225 3300005458 Ga0070681_10103517 Ga0070681_101035171 343
226 3300009093 Ga0105240_10001207 Ga0105240_1000120743 343
227 3300009545 Ga0105237_10000062 Ga0105237_1000006222 343
228 3300009551 Ga0105238_10053651 Ga0105238_100536513 343
229 3300010375 Ga0105239_10037110 Ga0105239_100371103 343
230 3300025913 Ga0207695_10017766 Ga0207695_100177663 343
231 3300025914 Ga0207671_10000140 Ga0207671_1000014078 343
232 3300025921 Ga0207652_10002200 Ga0207652_100022005 343
233 3300025924 Ga0207694_10097919 Ga0207694_100979192 343
234 3300028563 Ga0265319_1017876 Ga0265319_10178762 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

37

330

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h1x-assembly1.cif.gz_A crystal structure of a phosphate abc transporter, phosphate-binding protein (sp_2084) from streptococcus pneumoniae tigr4 at 1.77 a resolution 0.8849 30 94
4lvq-assembly2.cif.gz_B crystal structure of the m. tuberculosis phosphate binding protein psts3 0.8616 31 341
7xg8-assembly1.cif.gz_A crystal structure of psts protein from cyanophage p-ssm2 0.858 31 341
7xg8-assembly1.cif.gz_A crystal structure of psts protein from cyanophage p-ssm2 0.8528 31 341
1quj-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate 0.848 30 331
ID Description Score Start End Superfamily
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9331 111 281 3.40.190.10
4lvqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9316 109 281 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9273 110 281 3.40.190.10
4lvqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9208 109 281 3.40.190.10
4jwoA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9127 30 106 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6N4T297-F1-model_v4 PBP domain-containing protein 0.9541 108 255
AF-X7ZVU6-F1-model_v4 Phosphate-binding protein pstS 3 0.9508 113 243 GO:0016020
AF-X8C7D0-F1-model_v4 deleted 0.9474 103 242
AF-A0A069JEX9-F1-model_v4 deleted 0.944 108 217
AF-A0A378CKU9-F1-model_v4 Phosphate-binding protein PstS 0.9362 124 281 GO:0035435
GO:0042301
GO:0043190

Feature Viewer

pLDDT pTM Quality
91.78 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map