F346873

General Info

Members Datasets Scaffolds Average Seq Length
234 160 468 260

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100199538|Ga0070698_1001995383
Length 259
Sequence VTTNQGEKAEAFRALHAGEPFVIPNPWDAGSARVLGALGFKALATTSSGFAFTLGRVDGAATLEEVVEHVGTLDRAADLPVSVDLENGYGPDPESVVIAVTRVAAAGAVGASIEDWDPGGHIYDLGHAVERVAHRLPFPFVLTARAENHIRGNPDLDDTIERLRAFEAAGADVLYAPGLRTTAEIRTLCAAVSKPVNVLARADLSLEEIVDAGAQRISVGGALTWAAVNAFVAAATAIRDRGDFALLGASPPLRDWFGG

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
95 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 3.42
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100199538 3300005471 Bacteria 1937
2 Ga0070658_10013859 3300005327 Bacteria 6471
3 Ga0070683_100030458 3300005329 Bacteria 4899
4 Ga0068868_100340802 3300005338 Bacteria 1282
5 Ga0070660_100033599 3300005339 Bacteria 3867
6 Ga0070687_100421044 3300005343 Bacteria 881
7 Ga0070661_100131236 3300005344 Bacteria 1882
8 Ga0070668_100063890 3300005347 Bacteria 2853
9 Ga0070714_100239820 3300005435 Unclassified 1673
10 Ga0070713_100260277 3300005436 Bacteria 1585
11 Ga0070700_100064495 3300005441 Bacteria 2320
12 Ga0070694_100054849 3300005444 Bacteria 2701
13 Ga0070708_100174681 3300005445 Bacteria 2007
14 Ga0070662_100118893 3300005457 Bacteria 2023
15 Ga0068867_100123197 3300005459 Bacteria 2006
16 Ga0070707_100389387 3300005468 Bacteria 1354
17 Ga0070707_100452249 3300005468 Bacteria 1245
18 Ga0070698_100001207 3300005471 Bacteria 28694
19 Ga0070698_100275560 3300005471 Bacteria 1614
20 Ga0070699_100085322 3300005518 Bacteria 2756
21 Ga0070684_100004838 3300005535 Bacteria 10291
22 Ga0070695_100086027 3300005545 Bacteria 2088
23 Ga0070704_100009395 3300005549 Bacteria 5905
24 Ga0070704_100221226 3300005549 Bacteria 1539
25 Ga0068857_100026890 3300005577 Bacteria 5073
26 Ga0070702_100103270 3300005615 Bacteria 1753
27 Ga0068852_100282067 3300005616 Bacteria 1602
28 Ga0068859_100276966 3300005617 Bacteria 1770
29 Ga0068866_10103251 3300005718 Bacteria 1577
30 Ga0068861_100385986 3300005719 Bacteria 1239
31 Ga0068870_10001243 3300005840 Bacteria 10222
32 Ga0068862_100363362 3300005844 Bacteria 1346
33 Ga0075365_10170271 3300006038 Bacteria 1520
34 Ga0075428_100042890 3300006844 Bacteria 4974
35 Ga0075428_100406902 3300006844 Unclassified 1458
36 Ga0075430_100015681 3300006846 Bacteria 6454
37 Ga0075430_100018796 3300006846 Bacteria 5879
38 Ga0075431_100029794 3300006847 Bacteria 5619
39 Ga0075431_100117768 3300006847 Bacteria 2741
40 Ga0075429_100014448 3300006880 Bacteria 6841
41 Ga0075429_100060815 3300006880 Bacteria 3290
42 Ga0097620_100276960 3300006931 Bacteria 1770
43 Ga0075435_100034052 3300007076 Bacteria 4033
44 Ga0105240_10256579 3300009093 Bacteria 2019
45 Ga0111539_10020863 3300009094 Bacteria 8067
46 Ga0105245_10035476 3300009098 Bacteria 4426
47 Ga0114129_10012294 3300009147 Bacteria 12181
48 Ga0114129_10328512 3300009147 Bacteria 2031
49 Ga0114129_10665436 3300009147 Bacteria 1342
50 Ga0105243_10006188 3300009148 Bacteria 9256
51 Ga0105242_10021840 3300009176 Bacteria 5030
52 Ga0105242_10208735 3300009176 Bacteria 1739
53 Ga0105249_10076355 3300009553 Bacteria 3105
54 Ga0105239_10177722 3300010375 Bacteria 2381
55 Ga0105239_10358617 3300010375 Bacteria 1646
56 Ga0157324_1006491 3300012506 Bacteria 882
57 Ga0157370_10003852 3300013104 Bacteria 17496
58 Ga0163162_10063837 3300013306 Bacteria 3727
59 Ga0163161_10032693 3300017792 Bacteria 3716
60 Ga0163161_10082589 3300017792 Bacteria 2367
61 Ga0213874_10001827 3300021377 Bacteria 4465
62 Ga0213871_10019594 3300021441 Bacteria 1667
63 Ga0207688_10041455 3300025901 Bacteria 2561
64 Ga0207643_10002058 3300025908 Bacteria 11093
65 Ga0207705_10050530 3300025909 Bacteria 2993
66 Ga0207693_10015932 3300025915 Bacteria 6019
67 Ga0207663_10107102 3300025916 Bacteria 1890
68 Ga0207657_10004070 3300025919 Bacteria 15518
69 Ga0207687_10123597 3300025927 Bacteria 1939
70 Ga0207706_10002083 3300025933 Bacteria 19570
71 Ga0207686_10030781 3300025934 Bacteria 3182
72 Ga0207709_10028821 3300025935 Bacteria 3213
73 Ga0207669_10182268 3300025937 Bacteria 1507
74 Ga0207665_10031211 3300025939 Bacteria 3525
75 Ga0207661_10037666 3300025944 Bacteria 3784
76 Ga0207640_10447022 3300025981 Bacteria 1064
77 Ga0207674_10004252 3300026116 Bacteria 17273
78 Ga0207674_10004372 3300026116 Bacteria 17041
79 Ga0207675_100061343 3300026118 Bacteria 3510
80 Ga0265338_10089959 3300028800 Bacteria 2542
81 Ga0307413_10362568 3300031824 Bacteria 1123
82 Ga0373956_0112835 3300035119 Bacteria 1266
83 Ga0373937_0009055 3300036401 Bacteria 8640
84 Ga0395899_0018271 3300037312 Bacteria 5332
85 Ga0395899_0021553 3300037312 Bacteria 4886
86 Ga0395899_0161187 3300037312 Bacteria 1584
87 Ga0395900_0012655 3300037418 Bacteria 8625
88 Ga0395900_0177898 3300037418 Bacteria 2163
89 Ga0395900_0440513 3300037418 Bacteria 1260
90 Ga0395898_0015216 3300037466 Bacteria 7898
91 Ga0395898_0168383 3300037466 Bacteria 2094
92 Ga0395905_0016600 3300037471 Bacteria 6997
93 Ga0395905_0029213 3300037471 Bacteria 5196
94 Ga0395901_0108335 3300038443 Bacteria 2916
95 Ga0395901_0132812 3300038443 Bacteria 2616
96 Ga0395901_1015498 3300038443 Bacteria 804
97 Ga0436365_1043958 3300039437 Bacteria 4609
98 Ga0436360_0556044 3300039438 Bacteria 6644
99 Ga0436363_0490223 3300039450 Bacteria 45099
100 Ga0436362_0797836 3300039453 Bacteria 3479
101 Ga0466965_0118429 3300044683 Bacteria 1366
102 Ga0466966_0107878 3300044684 Bacteria 1718
103 Ga0466966_0122830 3300044684 Bacteria 1594
104 Ga0466961_0025858 3300044693 Bacteria 3773
105 Ga0466961_0199089 3300044693 Unclassified 1239
106 Ga0466970_0104693 3300044765 Bacteria 1543
107 Ga0466957_0086943 3300044842 Bacteria 1954
108 Ga0495603_0044132 3300046455 Bacteria 2660
109 Ga0495629_0010602 3300046459 Bacteria 6704
110 Ga0495653_0010236 3300046463 Bacteria 7674
111 Ga0495653_0248961 3300046463 Bacteria 1180
112 Ga0495582_0031584 3300046473 Bacteria 2911
113 Ga0495582_0238244 3300046473 Bacteria 1043
114 Ga0495664_0473273 3300046477 Unclassified 749
115 Ga0495584_0164320 3300046491 Bacteria 1128
116 Ga0495594_0130957 3300046499 Bacteria 1421
117 Ga0495608_0002437 3300046511 Bacteria 13381
118 Ga0495608_0034323 3300046511 Bacteria 3425
119 Ga0495628_0047077 3300046516 Bacteria 3424
120 Ga0495630_0014945 3300046517 Bacteria 5662
121 Ga0495630_0035028 3300046517 Bacteria 3751
122 Ga0495663_0110988 3300046525 Bacteria 911
123 Ga0495642_0174222 3300046528 Bacteria 935
124 Ga0495652_0062348 3300046529 Bacteria 3144
125 Ga0495665_0332288 3300046531 Bacteria 775
126 Ga0495640_0007777 3300046533 Bacteria 8435
127 Ga0495586_0063618 3300046535 Bacteria 2010
128 Ga0495667_0002769 3300046559 Bacteria 11702
129 Ga0495667_0027018 3300046559 Bacteria 3868
130 Ga0495634_0119740 3300046642 Bacteria 1686
131 Ga0495588_0120064 3300046674 Unclassified 1386
132 Ga0495657_0133101 3300046675 Bacteria 1556
133 Ga0495647_0082091 3300046681 Bacteria 1308
134 Ga0495658_0004937 3300046683 Bacteria 6542
135 Ga0495613_0047103 3300046689 Bacteria 3185
136 Ga0495613_0275933 3300046689 Bacteria 1168
137 Ga0495600_0039082 3300046809 Bacteria 3090
138 Ga0495600_0080953 3300046809 Bacteria 2120
139 Ga0495581_0013110 3300047315 Bacteria 4806
140 Ga0495674_0003615 3300047319 Bacteria 15050
141 Ga0495680_0000298 3300047322 Bacteria 55499
142 Ga0495680_0032504 3300047322 Bacteria 4234
143 Ga0495680_0076510 3300047322 Bacteria 2537
144 Ga0495684_0045561 3300047471 Bacteria 3356
145 Ga0495614_0011706 3300048089 Bacteria 3857
146 Ga0496107_0030288 3300048910 Bacteria 3857
147 Ga0496108_0011152 3300048911 Bacteria 7304
148 Ga0496108_0015786 3300048911 Bacteria 6156
149 Ga0496109_0278866 3300048912 Bacteria 1575
150 Ga0496112_0039644 3300048915 Bacteria 4604
151 Ga0496113_0019037 3300048916 Bacteria 4796
152 Ga0496114_0233942 3300048917 Bacteria 1615
153 Ga0496115_0190557 3300048918 Bacteria 1694
154 Ga0496121_0023805 3300048924 Bacteria 5880
155 Ga0501031_0007447 3300049568 Bacteria 7129
156 Ga0501031_0013981 3300049568 Bacteria 5227
157 Ga0501031_0027502 3300049568 Bacteria 3708
158 Ga0501032_0021981 3300049569 Bacteria 4428
159 Ga0501033_0001873 3300049570 Bacteria 18293
160 Ga0501036_0020688 3300049572 Bacteria 5527
161 Ga0501036_0088206 3300049572 Bacteria 2622
162 Ga0501037_0016351 3300049573 Bacteria 5459
163 Ga0501038_0017270 3300049574 Bacteria 6522
164 Ga0501039_0002478 3300049575 Bacteria 13750
165 Ga0501039_0003429 3300049575 Bacteria 11836
166 Ga0501039_0030826 3300049575 Bacteria 4135
167 Ga0501040_0011330 3300049576 Bacteria 5834
168 Ga0501040_0022688 3300049576 Bacteria 4204
169 Ga0501040_0033583 3300049576 Bacteria 3476
170 Ga0501041_0021514 3300049577 Bacteria 3863
171 Ga0501041_0039263 3300049577 Bacteria 2872
172 Ga0501042_0003308 3300049578 Bacteria 10084
173 Ga0501042_0011938 3300049578 Bacteria 5871
174 Ga0501043_0000332 3300049579 Bacteria 42786
175 Ga0501046_0008214 3300049580 Bacteria 9115
176 Ga0501048_0003830 3300049582 Bacteria 11473
177 Ga0501048_0014109 3300049582 Bacteria 5921
178 Ga0501048_0077498 3300049582 Bacteria 2346
179 Ga0501067_0014421 3300049583 Bacteria 4376
180 Ga0501068_0002427 3300049584 Bacteria 9891
181 Ga0501068_0075937 3300049584 Bacteria 2056
182 Ga0501068_0131443 3300049584 Bacteria 1565
183 Ga0501069_0000057 3300049585 Bacteria 64652
184 Ga0501069_0033162 3300049585 Bacteria 2843
185 Ga0501070_0001915 3300049586 Bacteria 18377
186 Ga0501070_0262631 3300049586 Bacteria 1411
187 Ga0501071_0017456 3300049587 Bacteria 4949
188 Ga0501071_0026034 3300049587 Bacteria 4102
189 Ga0501071_0028742 3300049587 Bacteria 3920
190 Ga0501072_0013642 3300049588 Bacteria 6221
191 Ga0501072_0015579 3300049588 Bacteria 5827
192 Ga0501072_0078341 3300049588 Bacteria 2616
193 Ga0501073_0001913 3300049589 Bacteria 15506
194 Ga0501074_0001213 3300049590 Bacteria 16973
195 Ga0501074_0055758 3300049590 Bacteria 2848
196 Ga0501074_0192809 3300049590 Bacteria 1453
197 Ga0501075_0009983 3300049591 Bacteria 6657
198 Ga0501075_0112358 3300049591 Bacteria 2071
199 Ga0501076_0069922 3300049592 Bacteria 2805
200 Ga0501076_0076878 3300049592 Bacteria 2677
201 Ga0501076_0293542 3300049592 Bacteria 1332
202 Ga0501077_0010280 3300049593 Bacteria 5825
203 Ga0501077_0043655 3300049593 Bacteria 2849
204 Ga0501077_0047478 3300049593 Bacteria 2728
205 Ga0501079_0053348 3300049741 Bacteria 3118
206 Ga0501079_0080501 3300049741 Bacteria 2518
207 Ga0501080_0030545 3300049742 Bacteria 5020
208 Ga0501080_0055532 3300049742 Bacteria 3689
209 Ga0501080_0243712 3300049742 Bacteria 1640
210 Ga0501081_0006109 3300049743 Bacteria 7806
211 Ga0501081_0006158 3300049743 Bacteria 7770
212 Ga0501081_0026090 3300049743 Bacteria 3936
213 Ga0501083_0005857 3300049744 Bacteria 8700
214 Ga0501035_0002693 3300049822 Bacteria 17280
215 Ga0501044_0032861 3300049823 Bacteria 5454
216 Ga0501045_0010082 3300049824 Bacteria 6609
217 Ga0501045_0010886 3300049824 Bacteria 6374
218 Ga0501045_0129167 3300049824 Bacteria 1878
219 nmdc:mga05p37_422225_c1 3300050507 Bacteria 1551
220 nmdc:mga05p37_4506_c1 3300050507 Bacteria 16283
221 nmdc:mga09592_19121_c1 3300050508 Bacteria 5622
222 nmdc:mga0qj67_36190_c1 3300050509 Bacteria 3862
223 nmdc:mga0qj67_458667_c1 3300050509 Bacteria 1026
224 nmdc:mga06r32_341433_c1 3300050510 Bacteria 1482
225 nmdc:mga08y16_487793_c1 3300050511 Bacteria 1253
226 nmdc:mga08y16_927871_c1 3300050511 Unclassified 855
227 Ga0495595_0035088 3300053084 Bacteria 2271
228 Ga0501084_0087439 3300054114 Bacteria 2616
229 Ga0501082_0015131 3300060353 Bacteria 6647
230 Ga0501082_0060012 3300060353 Bacteria 3276
231 Ga0501082_0371637 3300060353 Bacteria 1247
232 Ga0530510_0000648 3300061734 Bacteria 22473
233 Ga0530510_0005490 3300061734 Bacteria 8781
234 Ga0530510_0013764 3300061734 Bacteria 5695
235 Ga0070698_100199538
236 Ga0070658_10013859
237 Ga0070683_100030458
238 Ga0068868_100340802
239 Ga0070660_100033599
240 Ga0070687_100421044
241 Ga0070661_100131236
242 Ga0070668_100063890
243 Ga0070714_100239820
244 Ga0070713_100260277
245 Ga0070700_100064495
246 Ga0070694_100054849
247 Ga0070708_100174681
248 Ga0070662_100118893
249 Ga0068867_100123197
250 Ga0070707_100389387
251 Ga0070707_100452249
252 Ga0070698_100001207
253 Ga0070698_100275560
254 Ga0070699_100085322
255 Ga0070684_100004838
256 Ga0070695_100086027
257 Ga0070704_100009395
258 Ga0070704_100221226
259 Ga0068857_100026890
260 Ga0070702_100103270
261 Ga0068852_100282067
262 Ga0068859_100276966
263 Ga0068866_10103251
264 Ga0068861_100385986
265 Ga0068870_10001243
266 Ga0068862_100363362
267 Ga0075365_10170271
268 Ga0075428_100042890
269 Ga0075428_100406902
270 Ga0075430_100015681
271 Ga0075430_100018796
272 Ga0075431_100029794
273 Ga0075431_100117768
274 Ga0075429_100014448
275 Ga0075429_100060815
276 Ga0097620_100276960
277 Ga0075435_100034052
278 Ga0105240_10256579
279 Ga0111539_10020863
280 Ga0105245_10035476
281 Ga0114129_10012294
282 Ga0114129_10328512
283 Ga0114129_10665436
284 Ga0105243_10006188
285 Ga0105242_10021840
286 Ga0105242_10208735
287 Ga0105249_10076355
288 Ga0105239_10177722
289 Ga0105239_10358617
290 Ga0157324_1006491
291 Ga0157370_10003852
292 Ga0163162_10063837
293 Ga0163161_10032693
294 Ga0163161_10082589
295 Ga0213874_10001827
296 Ga0213871_10019594
297 Ga0207688_10041455
298 Ga0207643_10002058
299 Ga0207705_10050530
300 Ga0207693_10015932
301 Ga0207663_10107102
302 Ga0207657_10004070
303 Ga0207687_10123597
304 Ga0207706_10002083
305 Ga0207686_10030781
306 Ga0207709_10028821
307 Ga0207669_10182268
308 Ga0207665_10031211
309 Ga0207661_10037666
310 Ga0207640_10447022
311 Ga0207674_10004252
312 Ga0207674_10004372
313 Ga0207675_100061343
314 Ga0265338_10089959
315 Ga0307413_10362568
316 Ga0373956_0112835
317 Ga0373937_0009055
318 Ga0395899_0018271
319 Ga0395899_0021553
320 Ga0395899_0161187
321 Ga0395900_0012655
322 Ga0395900_0177898
323 Ga0395900_0440513
324 Ga0395898_0015216
325 Ga0395898_0168383
326 Ga0395905_0016600
327 Ga0395905_0029213
328 Ga0395901_0108335
329 Ga0395901_0132812
330 Ga0395901_1015498
331 Ga0436365_1043958
332 Ga0436360_0556044
333 Ga0436363_0490223
334 Ga0436362_0797836
335 Ga0466965_0118429
336 Ga0466966_0107878
337 Ga0466966_0122830
338 Ga0466961_0025858
339 Ga0466961_0199089
340 Ga0466970_0104693
341 Ga0466957_0086943
342 Ga0495603_0044132
343 Ga0495629_0010602
344 Ga0495653_0010236
345 Ga0495653_0248961
346 Ga0495582_0031584
347 Ga0495582_0238244
348 Ga0495664_0473273
349 Ga0495584_0164320
350 Ga0495594_0130957
351 Ga0495608_0002437
352 Ga0495608_0034323
353 Ga0495628_0047077
354 Ga0495630_0014945
355 Ga0495630_0035028
356 Ga0495663_0110988
357 Ga0495642_0174222
358 Ga0495652_0062348
359 Ga0495665_0332288
360 Ga0495640_0007777
361 Ga0495586_0063618
362 Ga0495667_0002769
363 Ga0495667_0027018
364 Ga0495634_0119740
365 Ga0495588_0120064
366 Ga0495657_0133101
367 Ga0495647_0082091
368 Ga0495658_0004937
369 Ga0495613_0047103
370 Ga0495613_0275933
371 Ga0495600_0039082
372 Ga0495600_0080953
373 Ga0495581_0013110
374 Ga0495674_0003615
375 Ga0495680_0000298
376 Ga0495680_0032504
377 Ga0495680_0076510
378 Ga0495684_0045561
379 Ga0495614_0011706
380 Ga0496107_0030288
381 Ga0496108_0011152
382 Ga0496108_0015786
383 Ga0496109_0278866
384 Ga0496112_0039644
385 Ga0496113_0019037
386 Ga0496114_0233942
387 Ga0496115_0190557
388 Ga0496121_0023805
389 Ga0501031_0007447
390 Ga0501031_0013981
391 Ga0501031_0027502
392 Ga0501032_0021981
393 Ga0501033_0001873
394 Ga0501036_0020688
395 Ga0501036_0088206
396 Ga0501037_0016351
397 Ga0501038_0017270
398 Ga0501039_0002478
399 Ga0501039_0003429
400 Ga0501039_0030826
401 Ga0501040_0011330
402 Ga0501040_0022688
403 Ga0501040_0033583
404 Ga0501041_0021514
405 Ga0501041_0039263
406 Ga0501042_0003308
407 Ga0501042_0011938
408 Ga0501043_0000332
409 Ga0501046_0008214
410 Ga0501048_0003830
411 Ga0501048_0014109
412 Ga0501048_0077498
413 Ga0501067_0014421
414 Ga0501068_0002427
415 Ga0501068_0075937
416 Ga0501068_0131443
417 Ga0501069_0000057
418 Ga0501069_0033162
419 Ga0501070_0001915
420 Ga0501070_0262631
421 Ga0501071_0017456
422 Ga0501071_0026034
423 Ga0501071_0028742
424 Ga0501072_0013642
425 Ga0501072_0015579
426 Ga0501072_0078341
427 Ga0501073_0001913
428 Ga0501074_0001213
429 Ga0501074_0055758
430 Ga0501074_0192809
431 Ga0501075_0009983
432 Ga0501075_0112358
433 Ga0501076_0069922
434 Ga0501076_0076878
435 Ga0501076_0293542
436 Ga0501077_0010280
437 Ga0501077_0043655
438 Ga0501077_0047478
439 Ga0501079_0053348
440 Ga0501079_0080501
441 Ga0501080_0030545
442 Ga0501080_0055532
443 Ga0501080_0243712
444 Ga0501081_0006109
445 Ga0501081_0006158
446 Ga0501081_0026090
447 Ga0501083_0005857
448 Ga0501035_0002693
449 Ga0501044_0032861
450 Ga0501045_0010082
451 Ga0501045_0010886
452 Ga0501045_0129167
453 nmdc:mga05p37_422225_c1
454 nmdc:mga05p37_4506_c1
455 nmdc:mga09592_19121_c1
456 nmdc:mga0qj67_36190_c1
457 nmdc:mga0qj67_458667_c1
458 nmdc:mga06r32_341433_c1
459 nmdc:mga08y16_487793_c1
460 nmdc:mga08y16_927871_c1
461 Ga0495595_0035088
462 Ga0501084_0087439
463 Ga0501082_0015131
464 Ga0501082_0060012
465 Ga0501082_0371637
466 Ga0530510_0000648
467 Ga0530510_0005490
468 Ga0530510_0013764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

12

239

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9411 2 230
2ze3-assembly1.cif.gz_A-2 crystal structure of dfa0005 complexed with alpha-ketoglutarate: a novel member of the icl/pepm superfamily from alkali-tolerant deinococcus ficus 0.9379 2 219
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9347 2 231
4mg4-assembly1.cif.gz_A crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9328 2 210
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9293 2 230
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9559 2 193 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9346 2 210 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9319 2 191 3.20.20.60
1oqfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8612 4 230 3.20.20.60
2hrwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8541 2 231 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A7Y7Y737-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9781 64 170 GO:0016829
AF-A0A536KAH7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9701 35 178 GO:0016491
AF-A0A5R2MZN5-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9698 44 170 GO:0016829
AF-A0A436LTC5-F1-model_v4 deleted 0.9694 2 201
AF-A0A524Q9N9-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.968 2 157 GO:0016829

Map