F346796

General Info

Members Datasets Scaffolds Average Seq Length
234 177 468 221

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100032113|Ga0070668_1000321132
Length 258
Sequence MKWQGVTLCPAKLRRKSLVAQRKSLCNDEPNRKLRDTGMTPTTCSTSYLIFSASMRHDSLNSRLAQLAATTVSGRGGTVDIAGMRDFECPSYDGDVDHADGPPLGAHALCRRIQAADAFIIASPEYNASMPGALKNAVDWASRFRPQPFNGKQALLLSASPSMVGGNRGLWSLRIPFEHLGARVYPDMFSLAQAHQAFNADGALVDKTLQDRFESTIGCFIDLVEAAKHYPTMKKQWVEFLGEHPDARIDRVETAPAA

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
101 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
102 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0.85
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.71
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100032113 3300005347 Bacteria 3995
2 Ga0070658_10019201 3300005327 Bacteria 5476
3 Ga0070676_10323980 3300005328 Unclassified 1052
4 Ga0070683_100083242 3300005329 Unclassified 2997
5 Ga0070683_100667688 3300005329 Bacteria 995
6 Ga0070670_100322597 3300005331 Bacteria 1353
7 Ga0070682_100000832 3300005337 Bacteria 18004
8 Ga0070682_100532783 3300005337 Unclassified 916
9 Ga0070660_100028251 3300005339 Bacteria 4195
10 Ga0070687_100006083 3300005343 Bacteria 4925
11 Ga0070661_100049013 3300005344 Bacteria 3093
12 Ga0070675_100075954 3300005354 Bacteria 2794
13 Ga0070675_100440183 3300005354 Bacteria 1168
14 Ga0070673_100431667 3300005364 Unclassified 1183
15 Ga0070667_100285933 3300005367 Unclassified 1482
16 Ga0070709_10019183 3300005434 Bacteria 3948
17 Ga0070710_10013976 3300005437 Bacteria 4033
18 Ga0070694_100208174 3300005444 Bacteria 1461
19 Ga0070708_100549193 3300005445 Bacteria 1090
20 Ga0070678_100438948 3300005456 Unclassified 1141
21 Ga0070662_100001012 3300005457 Bacteria 17182
22 Ga0070662_100023747 3300005457 Unclassified 4216
23 Ga0068867_100258472 3300005459 Unclassified 1419
24 Ga0070706_100477558 3300005467 Bacteria 1160
25 Ga0070707_100035491 3300005468 Bacteria 4756
26 Ga0070707_100118271 3300005468 Bacteria 2572
27 Ga0070707_100267892 3300005468 Bacteria 1661
28 Ga0070707_100632168 3300005468 Unclassified 1033
29 Ga0070698_100001572 3300005471 Bacteria 25363
30 Ga0070698_100010502 3300005471 Bacteria 9873
31 Ga0070698_100073149 3300005471 Unclassified 3435
32 Ga0070699_100025851 3300005518 Bacteria 5060
33 Ga0070699_100048594 3300005518 Bacteria 3672
34 Ga0070699_100156572 3300005518 Bacteria 2016
35 Ga0070684_100002068 3300005535 Bacteria 14796
36 Ga0070684_100046881 3300005535 Bacteria 3745
37 Ga0070672_100011601 3300005543 Bacteria 6148
38 Ga0070696_100077135 3300005546 Bacteria 2354
39 Ga0070704_100141127 3300005549 Bacteria 1881
40 Ga0068855_100648746 3300005563 Bacteria 1134
41 Ga0070664_100023372 3300005564 Bacteria 5105
42 Ga0068857_100051136 3300005577 Bacteria 3665
43 Ga0068861_100349610 3300005719 Unclassified 1296
44 Ga0068863_100153726 3300005841 Bacteria 2202
45 Ga0068860_100025732 3300005843 Bacteria 5676
46 Ga0068860_100040400 3300005843 Bacteria 4458
47 Ga0081538_10021479 3300005981 Bacteria 4710
48 Ga0070717_10097188 3300006028 Bacteria 2495
49 Ga0070716_100004436 3300006173 Bacteria 6711
50 Ga0097621_100367962 3300006237 Bacteria 1282
51 Ga0068871_100120364 3300006358 Bacteria 2217
52 Ga0068871_100538975 3300006358 Unclassified 1056
53 Ga0075428_100012217 3300006844 Bacteria 9548
54 Ga0075428_100311489 3300006844 Bacteria 1692
55 Ga0075430_100007414 3300006846 Bacteria 9263
56 Ga0075433_10015869 3300006852 Bacteria 6193
57 Ga0075433_10053626 3300006852 Bacteria 3516
58 Ga0075433_10223885 3300006852 Bacteria 1671
59 Ga0075434_100024290 3300006871 Bacteria 5925
60 Ga0075434_100477152 3300006871 Unclassified 1268
61 Ga0075434_100978568 3300006871 Bacteria 860
62 Ga0075429_100000256 3300006880 Bacteria 36808
63 Ga0068865_100642232 3300006881 Unclassified 901
64 Ga0075436_100002835 3300006914 Bacteria 11872
65 Ga0075435_100102206 3300007076 Bacteria 2376
66 Ga0099794_10035299 3300007265 Bacteria 2359
67 Ga0105240_10171768 3300009093 Bacteria 2567
68 Ga0105240_10263339 3300009093 Unclassified 1988
69 Ga0105240_11063832 3300009093 Bacteria 862
70 Ga0114129_10022538 3300009147 Bacteria 8935
71 Ga0114129_10023515 3300009147 Bacteria 8734
72 Ga0114129_10088775 3300009147 Bacteria 4286
73 Ga0114129_10183779 3300009147 Bacteria 2843
74 Ga0114129_10516465 3300009147 Unclassified 1558
75 Ga0105241_10223372 3300009174 Bacteria 1584
76 Ga0105241_10348890 3300009174 Bacteria 1284
77 Ga0105248_10471812 3300009177 Bacteria 1414
78 Ga0105248_10672874 3300009177 Bacteria 1168
79 Ga0105238_10752344 3300009551 Bacteria 988
80 Ga0157370_10016837 3300013104 Bacteria 7389
81 Ga0157369_10346347 3300013105 Bacteria 1543
82 Ga0157369_10703241 3300013105 Unclassified 1041
83 Ga0157374_10701092 3300013296 Unclassified 1025
84 Ga0157378_10031779 3300013297 Bacteria 4663
85 Ga0157378_10400147 3300013297 Bacteria 1353
86 Ga0157372_10158337 3300013307 Bacteria 2616
87 Ga0157372_10395227 3300013307 Bacteria 1611
88 Ga0157372_11018821 3300013307 Bacteria 959
89 Ga0157375_10232248 3300013308 Bacteria 2003
90 Ga0182008_10007773 3300014497 Bacteria 5899
91 Ga0157376_10204662 3300014969 Bacteria 1819
92 Ga0157376_10443628 3300014969 Bacteria 1264
93 Ga0197907_10074997 3300020069 Bacteria 1038
94 Ga0206355_1630154 3300020076 Bacteria 992
95 Ga0207656_10020556 3300025321 Bacteria 2626
96 Ga0207682_10025776 3300025893 Bacteria 2332
97 Ga0207688_10196890 3300025901 Bacteria 1207
98 Ga0207645_10491700 3300025907 Unclassified 830
99 Ga0207684_10129337 3300025910 Unclassified 2167
100 Ga0207684_10283817 3300025910 Bacteria 1428
101 Ga0207707_10004442 3300025912 Bacteria 12358
102 Ga0207707_10184834 3300025912 Bacteria 1819
103 Ga0207662_10011612 3300025918 Bacteria 4890
104 Ga0207657_10062752 3300025919 Bacteria 3180
105 Ga0207657_10148703 3300025919 Bacteria 1909
106 Ga0207652_10092980 3300025921 Bacteria 2653
107 Ga0207646_10102403 3300025922 Unclassified 2567
108 Ga0207646_10401708 3300025922 Bacteria 1237
109 Ga0207681_10102757 3300025923 Bacteria 2064
110 Ga0207650_10322048 3300025925 Unclassified 1266
111 Ga0207644_10644184 3300025931 Unclassified 882
112 Ga0207706_10000085 3300025933 Bacteria 95383
113 Ga0207706_10041271 3300025933 Bacteria 4090
114 Ga0207665_10005026 3300025939 Bacteria 8828
115 Ga0207691_10000645 3300025940 Bacteria 34491
116 Ga0207711_10192832 3300025941 Bacteria 1857
117 Ga0207711_10699029 3300025941 Unclassified 946
118 Ga0207661_10016760 3300025944 Bacteria 5409
119 Ga0207661_10154712 3300025944 Unclassified 1985
120 Ga0207679_10026917 3300025945 Bacteria 3970
121 Ga0207679_10059394 3300025945 Bacteria 2837
122 Ga0207679_10081553 3300025945 Bacteria 2474
123 Ga0207651_10180401 3300025960 Bacteria 1675
124 Ga0207648_10158571 3300026089 Bacteria 1998
125 Ga0207683_10130613 3300026121 Bacteria 2259
126 Ga0207683_10782055 3300026121 Unclassified 886
127 Ga0268264_10029905 3300028381 Bacteria 4466
128 Ga0307408_100105775 3300031548 Bacteria 2152
129 Ga0307408_100641317 3300031548 Bacteria 949
130 Ga0307405_10141182 3300031731 Bacteria 1680
131 Ga0307406_10159908 3300031901 Bacteria 1618
132 Ga0307407_10026573 3300031903 Bacteria 3068
133 Ga0307407_10371098 3300031903 Bacteria 1019
134 Ga0307409_100019608 3300031995 Bacteria 4584
135 Ga0307409_100221797 3300031995 Bacteria 1707
136 Ga0307414_10011790 3300032004 Bacteria 5144
137 Ga0307411_10120561 3300032005 Bacteria 1897
138 Ga0373929_0060449 3300035085 Bacteria 886
139 Ga0373931_0003463 3300035691 Bacteria 7087
140 Ga0373933_0244709 3300035724 Bacteria 1154
141 Ga0373947_0346523 3300035725 Bacteria 996
142 Ga0373937_0178426 3300036401 Bacteria 1994
143 Ga0436365_1590189 3300039437 Bacteria 2849
144 Ga0436362_0493921 3300039453 Bacteria 1992
145 Ga0439439_0072615 3300041406 Bacteria 923
146 Ga0439433_0002852 3300041999 Bacteria 3694
147 Ga0439462_0044638 3300042015 Bacteria 1186
148 Ga0451576_0071412 3300045051 Bacteria 3613
149 Ga0495629_0074188 3300046459 Bacteria 2376
150 Ga0495629_0350183 3300046459 Bacteria 1008
151 Ga0495651_0051194 3300046462 Bacteria 3185
152 Ga0495653_0019103 3300046463 Bacteria 5560
153 Ga0495639_0236894 3300046475 Bacteria 900
154 Ga0495664_0022666 3300046477 Bacteria 3642
155 Ga0495608_0030499 3300046511 Bacteria 3650
156 Ga0495618_0032111 3300046514 Bacteria 3289
157 Ga0495628_0041479 3300046516 Bacteria 3674
158 Ga0495630_0038803 3300046517 Bacteria 3562
159 Ga0495652_0180191 3300046529 Bacteria 1622
160 Ga0495665_0112125 3300046531 Bacteria 1430
161 Ga0495640_0074801 3300046533 Bacteria 2263
162 Ga0495586_0063135 3300046535 Bacteria 2017
163 Ga0495586_0151828 3300046535 Bacteria 1303
164 Ga0495587_0068419 3300046536 Bacteria 2068
165 Ga0495667_0059828 3300046559 Bacteria 2499
166 Ga0495634_0023259 3300046642 Bacteria 4357
167 Ga0495635_0037499 3300046663 Bacteria 3355
168 Ga0495657_0010608 3300046675 Bacteria 6926
169 Ga0495623_0057281 3300046679 Bacteria 2452
170 Ga0495646_0045809 3300046680 Bacteria 2669
171 Ga0495613_0049284 3300046689 Bacteria 3109
172 Ga0495613_0172311 3300046689 Bacteria 1535
173 Ga0495624_0210202 3300046690 Bacteria 1180
174 Ga0495600_0042997 3300046809 Bacteria 2945
175 Ga0495581_0090837 3300047315 Bacteria 1772
176 Ga0495604_0076829 3300047317 Bacteria 2511
177 Ga0495674_0077693 3300047319 Bacteria 2853
178 Ga0495676_0100393 3300047321 Bacteria 2142
179 Ga0495680_0015367 3300047322 Bacteria 6605
180 Ga0495675_0038161 3300047444 Bacteria 3059
181 Ga0495593_0122766 3300047673 Bacteria 1321
182 Ga0495602_0064916 3300048088 Bacteria 3154
183 Ga0496107_0042367 3300048910 Bacteria 3270
184 Ga0496112_0606074 3300048915 Bacteria 1027
185 Ga0496114_0020029 3300048917 Bacteria 5427
186 Ga0496115_0012171 3300048918 Bacteria 6469
187 Ga0501031_0006871 3300049568 Bacteria 7427
188 Ga0501032_0013027 3300049569 Bacteria 5923
189 Ga0501033_0022502 3300049570 Bacteria 4755
190 Ga0501034_0024153 3300049571 Bacteria 6184
191 Ga0501036_0085716 3300049572 Bacteria 2662
192 Ga0501037_0027110 3300049573 Bacteria 4232
193 Ga0501038_0017159 3300049574 Bacteria 6545
194 Ga0501039_0074593 3300049575 Bacteria 2636
195 Ga0501041_0085998 3300049577 Bacteria 1939
196 Ga0501042_0027592 3300049578 Bacteria 3993
197 Ga0501043_0031601 3300049579 Bacteria 4161
198 Ga0501046_0073833 3300049580 Bacteria 2646
199 Ga0501047_0039095 3300049581 Bacteria 4590
200 Ga0501048_0117506 3300049582 Bacteria 1878
201 Ga0501069_0050924 3300049585 Bacteria 2304
202 Ga0501070_0037286 3300049586 Bacteria 4059
203 Ga0501071_0361421 3300049587 Bacteria 1105
204 Ga0501072_0150972 3300049588 Bacteria 1852
205 Ga0501074_0067289 3300049590 Bacteria 2576
206 Ga0501076_0200199 3300049592 Bacteria 1630
207 Ga0501077_0032065 3300049593 Bacteria 3343
208 Ga0501079_0166601 3300049741 Bacteria 1718
209 Ga0501080_0024913 3300049742 Bacteria 5549
210 Ga0501081_0134146 3300049743 Bacteria 1771
211 Ga0501081_0158511 3300049743 Bacteria 1629
212 Ga0501083_0024965 3300049744 Bacteria 4139
213 Ga0501035_0044727 3300049822 Bacteria 3985
214 Ga0501045_0037970 3300049824 Bacteria 3502
215 nmdc:mga05p37_11155_c1 3300050507 Bacteria 10679
216 nmdc:mga05p37_28025_c1 3300050507 Bacteria 6863
217 nmdc:mga05p37_334606_c1 3300050507 Bacteria 1787
218 nmdc:mga05p37_47278_c1 3300050507 Bacteria 5292
219 nmdc:mga09592_59744_c1 3300050508 Bacteria 3223
220 nmdc:mga0qj67_57627_c1 3300050509 Bacteria 3080
221 nmdc:mga06r32_1376_c1 3300050510 Bacteria 21982
222 nmdc:mga06r32_43738_c1 3300050510 Bacteria 4262
223 nmdc:mga06r32_477838_c1 3300050510 Bacteria 1224
224 nmdc:mga0n895_34435_c1 3300050512 Bacteria 4874
225 nmdc:mga08x19_17957_c1 3300050514 Bacteria 4332
226 nmdc:mga0a205_112755_c1 3300050515 Bacteria 2618
227 nmdc:mga0a205_237655_c1 3300050515 Bacteria 1703
228 nmdc:mga0a205_87646_c1 3300050515 Bacteria 3007
229 Ga0495595_0154347 3300053084 Bacteria 1131
230 Ga0501084_0018258 3300054114 Bacteria 5840
231 Ga0501084_0409957 3300054114 Bacteria 1145
232 Ga0501082_0036601 3300060353 Bacteria 4227
233 Ga0530510_0105764 3300061734 Bacteria 2059
234 2554260934 2554235005 Bacteria 6457341
235 Ga0070668_100032113
236 Ga0070658_10019201
237 Ga0070676_10323980
238 Ga0070683_100083242
239 Ga0070683_100667688
240 Ga0070670_100322597
241 Ga0070682_100000832
242 Ga0070682_100532783
243 Ga0070660_100028251
244 Ga0070687_100006083
245 Ga0070661_100049013
246 Ga0070675_100075954
247 Ga0070675_100440183
248 Ga0070673_100431667
249 Ga0070667_100285933
250 Ga0070709_10019183
251 Ga0070710_10013976
252 Ga0070694_100208174
253 Ga0070708_100549193
254 Ga0070678_100438948
255 Ga0070662_100001012
256 Ga0070662_100023747
257 Ga0068867_100258472
258 Ga0070706_100477558
259 Ga0070707_100035491
260 Ga0070707_100118271
261 Ga0070707_100267892
262 Ga0070707_100632168
263 Ga0070698_100001572
264 Ga0070698_100010502
265 Ga0070698_100073149
266 Ga0070699_100025851
267 Ga0070699_100048594
268 Ga0070699_100156572
269 Ga0070684_100002068
270 Ga0070684_100046881
271 Ga0070672_100011601
272 Ga0070696_100077135
273 Ga0070704_100141127
274 Ga0068855_100648746
275 Ga0070664_100023372
276 Ga0068857_100051136
277 Ga0068861_100349610
278 Ga0068863_100153726
279 Ga0068860_100025732
280 Ga0068860_100040400
281 Ga0081538_10021479
282 Ga0070717_10097188
283 Ga0070716_100004436
284 Ga0097621_100367962
285 Ga0068871_100120364
286 Ga0068871_100538975
287 Ga0075428_100012217
288 Ga0075428_100311489
289 Ga0075430_100007414
290 Ga0075433_10015869
291 Ga0075433_10053626
292 Ga0075433_10223885
293 Ga0075434_100024290
294 Ga0075434_100477152
295 Ga0075434_100978568
296 Ga0075429_100000256
297 Ga0068865_100642232
298 Ga0075436_100002835
299 Ga0075435_100102206
300 Ga0099794_10035299
301 Ga0105240_10171768
302 Ga0105240_10263339
303 Ga0105240_11063832
304 Ga0114129_10022538
305 Ga0114129_10023515
306 Ga0114129_10088775
307 Ga0114129_10183779
308 Ga0114129_10516465
309 Ga0105241_10223372
310 Ga0105241_10348890
311 Ga0105248_10471812
312 Ga0105248_10672874
313 Ga0105238_10752344
314 Ga0157370_10016837
315 Ga0157369_10346347
316 Ga0157369_10703241
317 Ga0157374_10701092
318 Ga0157378_10031779
319 Ga0157378_10400147
320 Ga0157372_10158337
321 Ga0157372_10395227
322 Ga0157372_11018821
323 Ga0157375_10232248
324 Ga0182008_10007773
325 Ga0157376_10204662
326 Ga0157376_10443628
327 Ga0197907_10074997
328 Ga0206355_1630154
329 Ga0207656_10020556
330 Ga0207682_10025776
331 Ga0207688_10196890
332 Ga0207645_10491700
333 Ga0207684_10129337
334 Ga0207684_10283817
335 Ga0207707_10004442
336 Ga0207707_10184834
337 Ga0207662_10011612
338 Ga0207657_10062752
339 Ga0207657_10148703
340 Ga0207652_10092980
341 Ga0207646_10102403
342 Ga0207646_10401708
343 Ga0207681_10102757
344 Ga0207650_10322048
345 Ga0207644_10644184
346 Ga0207706_10000085
347 Ga0207706_10041271
348 Ga0207665_10005026
349 Ga0207691_10000645
350 Ga0207711_10192832
351 Ga0207711_10699029
352 Ga0207661_10016760
353 Ga0207661_10154712
354 Ga0207679_10026917
355 Ga0207679_10059394
356 Ga0207679_10081553
357 Ga0207651_10180401
358 Ga0207648_10158571
359 Ga0207683_10130613
360 Ga0207683_10782055
361 Ga0268264_10029905
362 Ga0307408_100105775
363 Ga0307408_100641317
364 Ga0307405_10141182
365 Ga0307406_10159908
366 Ga0307407_10026573
367 Ga0307407_10371098
368 Ga0307409_100019608
369 Ga0307409_100221797
370 Ga0307414_10011790
371 Ga0307411_10120561
372 Ga0373929_0060449
373 Ga0373931_0003463
374 Ga0373933_0244709
375 Ga0373947_0346523
376 Ga0373937_0178426
377 Ga0436365_1590189
378 Ga0436362_0493921
379 Ga0439439_0072615
380 Ga0439433_0002852
381 Ga0439462_0044638
382 Ga0451576_0071412
383 Ga0495629_0074188
384 Ga0495629_0350183
385 Ga0495651_0051194
386 Ga0495653_0019103
387 Ga0495639_0236894
388 Ga0495664_0022666
389 Ga0495608_0030499
390 Ga0495618_0032111
391 Ga0495628_0041479
392 Ga0495630_0038803
393 Ga0495652_0180191
394 Ga0495665_0112125
395 Ga0495640_0074801
396 Ga0495586_0063135
397 Ga0495586_0151828
398 Ga0495587_0068419
399 Ga0495667_0059828
400 Ga0495634_0023259
401 Ga0495635_0037499
402 Ga0495657_0010608
403 Ga0495623_0057281
404 Ga0495646_0045809
405 Ga0495613_0049284
406 Ga0495613_0172311
407 Ga0495624_0210202
408 Ga0495600_0042997
409 Ga0495581_0090837
410 Ga0495604_0076829
411 Ga0495674_0077693
412 Ga0495676_0100393
413 Ga0495680_0015367
414 Ga0495675_0038161
415 Ga0495593_0122766
416 Ga0495602_0064916
417 Ga0496107_0042367
418 Ga0496112_0606074
419 Ga0496114_0020029
420 Ga0496115_0012171
421 Ga0501031_0006871
422 Ga0501032_0013027
423 Ga0501033_0022502
424 Ga0501034_0024153
425 Ga0501036_0085716
426 Ga0501037_0027110
427 Ga0501038_0017159
428 Ga0501039_0074593
429 Ga0501041_0085998
430 Ga0501042_0027592
431 Ga0501043_0031601
432 Ga0501046_0073833
433 Ga0501047_0039095
434 Ga0501048_0117506
435 Ga0501069_0050924
436 Ga0501070_0037286
437 Ga0501071_0361421
438 Ga0501072_0150972
439 Ga0501074_0067289
440 Ga0501076_0200199
441 Ga0501077_0032065
442 Ga0501079_0166601
443 Ga0501080_0024913
444 Ga0501081_0134146
445 Ga0501081_0158511
446 Ga0501083_0024965
447 Ga0501035_0044727
448 Ga0501045_0037970
449 nmdc:mga05p37_11155_c1
450 nmdc:mga05p37_28025_c1
451 nmdc:mga05p37_334606_c1
452 nmdc:mga05p37_47278_c1
453 nmdc:mga09592_59744_c1
454 nmdc:mga0qj67_57627_c1
455 nmdc:mga06r32_1376_c1
456 nmdc:mga06r32_43738_c1
457 nmdc:mga06r32_477838_c1
458 nmdc:mga0n895_34435_c1
459 nmdc:mga08x19_17957_c1
460 nmdc:mga0a205_112755_c1
461 nmdc:mga0a205_237655_c1
462 nmdc:mga0a205_87646_c1
463 Ga0495595_0154347
464 Ga0501084_0018258
465 Ga0501084_0409957
466 Ga0501082_0036601
467 Ga0530510_0105764
468 2554260934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

46

196

0.98

PF02525

Flavodoxin_2

Flavodoxin-like fold

46

209

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.9103 10 183
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.8908 10 183
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.8904 9 188
2fzv-assembly1.cif.gz_A crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.8811 6 193
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.8805 8 189
ID Description Score Start End Superfamily
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9103 10 183 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8908 10 183 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.88 9 193 3.40.50.360
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8725 8 189 3.40.50.360
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8544 8 189 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A4D4KT54-F1-model_v4 Oxidoreductase 0.9852 32 191 GO:0005829
GO:0010181
GO:0016491
AF-A0A2E6GLE6-F1-model_v4 NADPH-dependent FMN reductase 0.9824 10 192 GO:0005829
GO:0010181
GO:0016491
AF-A0A6N2D5G0-F1-model_v4 NADPH-dependent oxidoreductase 0.9812 6 189 GO:0005829
GO:0010181
GO:0016491
AF-A7HAX4-F1-model_v4 NADPH-dependent FMN reductase 0.9787 10 192 GO:0005829
GO:0010181
GO:0016491
AF-K2AEW2-F1-model_v4 NADPH-dependent FMN reductase 0.9786 10 189 GO:0005829
GO:0010181
GO:0016491

Map