F346599

General Info

Members Datasets Scaffolds Average Seq Length
233 182 466 158

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2739367898|2740165903
Length 160
Sequence TFIVNGERVTVDVEDDVRLLWVLRDLLGVTGPKYGCGINVCKACTSHLNGKAINPCAVPVGRLGDDDEVTTIEGLPEQVDAGRRGAHGLHPMQEAWLDRDVAQCGYCQPGQIMAAVALVNRVAAEGGQVTEADLDGIRNICRCGTYTRIREAIRDGASRM

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 2739367898 Nocardioides sp. CF479 Isolate Unclassified
172 2558860280 Kutzneria sp. 744 Isolate Unclassified
173 2582580736 Prauserella sp. Am3 Isolate Unclassified
174 2643221615 Nocardioides sp. Root224 Isolate Unclassified
175 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
176 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
177 2862574272 Streptomyces sp. AcE210 Isolate Nodule
178 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
179 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
180 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
181 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
182 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.42
Metatranscriptomes 0.43
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0.43
Rhizoplane 3
Rhizosphere 85.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10160611 3300001989 Bacteria 663
2 JGI24737J22298_10047642 3300001990 Bacteria 1306
3 JGI24735J21928_10085240 3300002067 Bacteria 905
4 JGI24738J21930_10050289 3300002075 Bacteria 850
5 Ga0070682_100183549 3300005337 Bacteria 1463
6 Ga0070660_100079567 3300005339 Bacteria 2571
7 Ga0070689_100865871 3300005340 Bacteria 798
8 Ga0070714_100031927 3300005435 Bacteria 4396
9 Ga0070713_100053173 3300005436 Bacteria 3355
10 Ga0070713_100112899 3300005436 Bacteria 2371
11 Ga0070713_100387713 3300005436 Bacteria 1303
12 Ga0070710_10008183 3300005437 Bacteria 5085
13 Ga0070701_10463144 3300005438 Bacteria 816
14 Ga0070681_10009327 3300005458 Bacteria 9654
15 Ga0070681_10316642 3300005458 Bacteria 1470
16 Ga0070706_100329490 3300005467 Bacteria 1424
17 Ga0070706_101229703 3300005467 Bacteria 688
18 Ga0070679_100012658 3300005530 Bacteria 8069
19 Ga0070679_100073272 3300005530 Bacteria 3417
20 Ga0068853_100001738 3300005539 Bacteria 15965
21 Ga0068855_101000993 3300005563 Bacteria 878
22 Ga0068854_100532174 3300005578 Bacteria 994
23 Ga0068856_100247063 3300005614 Bacteria 1800
24 Ga0068861_101760325 3300005719 Bacteria 614
25 Ga0068860_101028344 3300005843 Bacteria 842
26 Ga0081455_10074997 3300005937 Bacteria 2792
27 Ga0070717_10248771 3300006028 Bacteria 1570
28 Ga0070717_10784917 3300006028 Bacteria 866
29 Ga0075365_10060889 3300006038 Bacteria 2519
30 Ga0075365_10147479 3300006038 Bacteria 1636
31 Ga0075368_10033028 3300006042 Bacteria 2012
32 Ga0075363_100051526 3300006048 Bacteria 2196
33 Ga0075363_100690004 3300006048 Bacteria 616
34 Ga0070712_100638656 3300006175 Bacteria 904
35 Ga0075367_10002334 3300006178 Bacteria 8631
36 Ga0075428_100323253 3300006844 Bacteria 1658
37 Ga0075428_100612377 3300006844 Bacteria 1163
38 Ga0075430_100286749 3300006846 Bacteria 1362
39 Ga0075431_100327905 3300006847 Bacteria 1542
40 Ga0075429_100293045 3300006880 Bacteria 1425
41 Ga0068865_101024274 3300006881 Bacteria 724
42 Ga0105240_10469353 3300009093 Bacteria 1405
43 Ga0111539_11123829 3300009094 Bacteria 913
44 Ga0111539_11692093 3300009094 Bacteria 734
45 Ga0105245_10014363 3300009098 Bacteria 6900
46 Ga0105245_10233761 3300009098 Bacteria 1779
47 Ga0114129_11327900 3300009147 Bacteria 890
48 Ga0105241_10166390 3300009174 Bacteria 1817
49 Ga0105242_10028346 3300009176 Bacteria 4457
50 Ga0105238_10134812 3300009551 Bacteria 2447
51 Ga0105239_10473832 3300010375 Bacteria 1422
52 Ga0105239_10960054 3300010375 Bacteria 982
53 Ga0105239_11656162 3300010375 Bacteria 740
54 Ga0105246_10057141 3300011119 Bacteria 2699
55 Ga0157369_12048932 3300013105 Bacteria 580
56 Ga0157374_10786133 3300013296 Bacteria 967
57 Ga0157378_10519198 3300013297 Bacteria 1192
58 Ga0157372_11412514 3300013307 Bacteria 802
59 Ga0182006_1183155 3300015261 Bacteria 698
60 Ga0206353_10230177 3300020082 Bacteria 1026
61 Ga0207692_10861336 3300025898 Bacteria 595
62 Ga0207647_10456245 3300025904 Bacteria 716
63 Ga0207684_10353493 3300025910 Bacteria 1265
64 Ga0207684_11018951 3300025910 Bacteria 692
65 Ga0207654_10142515 3300025911 Bacteria 1530
66 Ga0207707_10039723 3300025912 Bacteria 4113
67 Ga0207707_10055153 3300025912 Bacteria 3458
68 Ga0207707_10617918 3300025912 Bacteria 916
69 Ga0207693_10006490 3300025915 Bacteria 9687
70 Ga0207693_10727538 3300025915 Bacteria 768
71 Ga0207660_10175001 3300025917 Bacteria 1664
72 Ga0207657_10018141 3300025919 Bacteria 6733
73 Ga0207652_10202915 3300025921 Bacteria 1784
74 Ga0207694_10186602 3300025924 Bacteria 1683
75 Ga0207687_10181827 3300025927 Bacteria 1630
76 Ga0207700_10312729 3300025928 Bacteria 1359
77 Ga0207664_10020191 3300025929 Bacteria 4934
78 Ga0207690_11006086 3300025932 Bacteria 693
79 Ga0207686_10015117 3300025934 Bacteria 4310
80 Ga0207670_10572742 3300025936 Bacteria 925
81 Ga0207667_10892776 3300025949 Bacteria 881
82 Ga0207639_10229780 3300026041 Bacteria 1607
83 Ga0207702_10495548 3300026078 Bacteria 1190
84 Ga0207698_10495037 3300026142 Bacteria 1188
85 Ga0209813_10171087 3300027866 Bacteria 789
86 Ga0307512_10015854 3300030522 Bacteria 6974
87 Ga0307408_101665381 3300031548 Bacteria 607
88 Ga0307508_10006280 3300031616 Bacteria 11188
89 Ga0307405_10022156 3300031731 Bacteria 3587
90 Ga0307518_10032940 3300031838 Bacteria 3758
91 Ga0307410_10508118 3300031852 Bacteria 993
92 Ga0307406_10366788 3300031901 Bacteria 1131
93 Ga0307407_10095605 3300031903 Bacteria 1832
94 Ga0307407_11011750 3300031903 Bacteria 642
95 Ga0307409_100093108 3300031995 Bacteria 2475
96 Ga0307409_100101337 3300031995 Bacteria 2389
97 Ga0307416_101016154 3300032002 Bacteria 932
98 Ga0307411_10030180 3300032005 Bacteria 3321
99 Ga0307415_100267875 3300032126 Bacteria 1398
100 Ga0316580_10054781 3300032139 Bacteria 1227
101 Ga0373954_0116915 3300035118 Bacteria 1293
102 Ga0373935_0867585 3300035692 Bacteria 668
103 Ga0373937_0213734 3300036401 Bacteria 1815
104 Ga0373925_1399939 3300037068 Bacteria 573
105 Ga0395899_0541212 3300037312 Bacteria 750
106 Ga0395900_0652266 3300037418 Bacteria 989
107 Ga0395898_0001427 3300037466 Bacteria 33941
108 Ga0395898_0147009 3300037466 Bacteria 2256
109 Ga0395901_1441335 3300038443 Bacteria 646
110 Ga0451843_0508223 3300041509 Bacteria 587
111 Ga0451853_2555685 3300041512 Bacteria 637
112 Ga0466969_0039971 3300044656 Bacteria 2352
113 Ga0466972_0013358 3300044658 Bacteria 4123
114 Ga0466965_0232702 3300044683 Bacteria 985
115 Ga0466966_0003179 3300044684 Bacteria 10806
116 Ga0466966_0627702 3300044684 Bacteria 647
117 Ga0466961_0002160 3300044693 Bacteria 12237
118 Ga0466961_0020509 3300044693 Bacteria 4254
119 Ga0466961_0167400 3300044693 Bacteria 1368
120 Ga0466971_0040464 3300044719 Bacteria 2094
121 Ga0466970_0020552 3300044765 Bacteria 3432
122 Ga0466970_0172397 3300044765 Bacteria 1199
123 Ga0466970_0410039 3300044765 Bacteria 774
124 Ga0466957_0030872 3300044842 Bacteria 3200
125 Ga0466960_0002098 3300044901 Bacteria 7425
126 Ga0466960_0213940 3300044901 Bacteria 1058
127 Ga0466960_0265201 3300044901 Bacteria 958
128 Ga0466959_0002237 3300045049 Bacteria 12325
129 Ga0466958_0412126 3300045836 Bacteria 873
130 Ga0466967_0040466 3300045976 Bacteria 4013
131 Ga0466967_0137516 3300045976 Bacteria 2273
132 Ga0495603_0003132 3300046455 Bacteria 9830
133 Ga0495603_0017549 3300046455 Bacteria 4332
134 Ga0495603_0043926 3300046455 Bacteria 2667
135 Ga0495629_0042435 3300046459 Bacteria 3196
136 Ga0495629_0592434 3300046459 Bacteria 742
137 Ga0495641_0135339 3300046461 Bacteria 1100
138 Ga0495580_0070029 3300046472 Bacteria 2450
139 Ga0495585_0051590 3300046492 Bacteria 2279
140 Ga0495585_0497041 3300046492 Bacteria 580
141 Ga0495594_0000385 3300046499 Bacteria 22179
142 Ga0495594_0234931 3300046499 Bacteria 1045
143 Ga0495607_0088816 3300046501 Bacteria 1679
144 Ga0495628_0030496 3300046516 Bacteria 4366
145 Ga0495630_0022924 3300046517 Bacteria 4612
146 Ga0495666_0188459 3300046526 Bacteria 951
147 Ga0495640_0075598 3300046533 Bacteria 2249
148 Ga0495587_0233719 3300046536 Bacteria 1036
149 Ga0495597_0379934 3300046542 Bacteria 539
150 Ga0495622_0015061 3300046557 Bacteria 3595
151 Ga0495668_0209682 3300046616 Bacteria 1067
152 Ga0495668_0700011 3300046616 Bacteria 560
153 Ga0495634_0008120 3300046642 Bacteria 7825
154 Ga0495611_0100602 3300046648 Bacteria 1342
155 Ga0495611_0329974 3300046648 Bacteria 701
156 Ga0495635_0431394 3300046663 Bacteria 873
157 Ga0495588_0024212 3300046674 Bacteria 3014
158 Ga0495599_0335044 3300046678 Bacteria 909
159 Ga0495623_0059888 3300046679 Bacteria 2390
160 Ga0495658_0369004 3300046683 Bacteria 913
161 Ga0495613_0000128 3300046689 Bacteria 74734
162 Ga0495613_0099497 3300046689 Bacteria 2101
163 Ga0495670_0114779 3300046691 Bacteria 1396
164 Ga0495589_0002198 3300046794 Bacteria 10980
165 Ga0495589_0020348 3300046794 Bacteria 3394
166 Ga0495581_0106113 3300047315 Bacteria 1633
167 Ga0495636_0066497 3300047318 Bacteria 1532
168 Ga0495674_0251974 3300047319 Bacteria 1453
169 Ga0495676_0004028 3300047321 Bacteria 13368
170 Ga0495676_0094794 3300047321 Bacteria 2222
171 Ga0495676_0104669 3300047321 Bacteria 2087
172 Ga0495676_0897587 3300047321 Bacteria 568
173 Ga0495680_0242333 3300047322 Bacteria 1280
174 Ga0495683_0060973 3300047323 Bacteria 1868
175 Ga0495683_0222505 3300047323 Bacteria 841
176 Ga0495685_007277 3300047447 Bacteria 3649
177 Ga0495685_120506 3300047447 Bacteria 861
178 Ga0495684_0271707 3300047471 Bacteria 1226
179 Ga0495593_0062388 3300047673 Bacteria 1948
180 Ga0495602_0116715 3300048088 Bacteria 2156
181 Ga0496103_0387576 3300048906 Bacteria 898
182 Ga0496104_0333229 3300048907 Bacteria 1430
183 Ga0496104_1222793 3300048907 Bacteria 654
184 Ga0496105_0137620 3300048908 Bacteria 2011
185 Ga0496109_0691073 3300048912 Bacteria 958
186 Ga0496112_0252485 3300048915 Bacteria 1714
187 Ga0496115_0965477 3300048918 Bacteria 653
188 Ga0501033_0069870 3300049570 Bacteria 2580
189 Ga0501033_0147934 3300049570 Bacteria 1696
190 Ga0501034_0183999 3300049571 Bacteria 2053
191 Ga0501036_1055182 3300049572 Bacteria 664
192 Ga0501038_0004815 3300049574 Bacteria 12536
193 Ga0501038_0252715 3300049574 Bacteria 1396
194 Ga0501039_0281178 3300049575 Bacteria 1308
195 Ga0501040_0255580 3300049576 Bacteria 1250
196 Ga0501043_0239612 3300049579 Bacteria 1399
197 Ga0501047_0089347 3300049581 Bacteria 2958
198 Ga0501067_0484197 3300049583 Bacteria 692
199 Ga0501070_0303982 3300049586 Bacteria 1299
200 Ga0501073_0272409 3300049589 Bacteria 1168
201 Ga0501076_0441545 3300049592 Bacteria 1071
202 Ga0501080_0219283 3300049742 Bacteria 1741
203 Ga0501080_0645607 3300049742 Bacteria 937
204 Ga0501044_0008514 3300049823 Bacteria 11238
205 Ga0501044_0023165 3300049823 Bacteria 6608
206 Ga0501044_0047233 3300049823 Bacteria 4454
207 Ga0501044_1122729 3300049823 Bacteria 655
208 nmdc:mga0yw44_25076_c1 3300050492 Bacteria 3384
209 nmdc:mga0yw44_391169_c1 3300050492 Bacteria 939
210 nmdc:mga06z11_2430_c1 3300050494 Bacteria 7101
211 nmdc:mga04h51_121045_c1 3300050495 Bacteria 975
212 nmdc:mga05p37_666401_c1 3300050507 Bacteria 1162
213 nmdc:mga09592_1464300_c1 3300050508 Bacteria 557
214 nmdc:mga0qj67_363641_c1 3300050509 Bacteria 1169
215 nmdc:mga08y16_682504_c1 3300050511 Bacteria 1028
216 Ga0495601_0024730 3300053077 Bacteria 3699
217 Ga0495612_0385670 3300053078 Bacteria 635
218 Ga0495619_0248072 3300053085 Bacteria 1234
219 Ga0500566_0000510 3300053094 Bacteria 21690
220 Ga0500566_0118786 3300053094 Bacteria 1428
221 Ga0466962_0007995 3300061719 Bacteria 5074
222 2740165903 2739367898 Bacteria 4367674
223 2559431123 2558860280 Bacteria 11429938
224 2583150025 2582580736 Bacteria 5325865
225 2644092981 2643221615 Bacteria 5487866
226 2644322594 2643221657 Bacteria 5490246
227 2812352431 2811994878 Bacteria 5992952
228 2862580728 2862574272 Bacteria 10567477
229 2895434370 2895427314 Bacteria 13147766
230 2899365744 2899359706 Bacteria 10940472
231 2997452078 2997451912 Bacteria 8492419
232 8056210073 8056207758 Bacteria 8639239
233 8056830836 8056829672 Bacteria 9045328
234 JGI24739J22299_10160611
235 JGI24737J22298_10047642
236 JGI24735J21928_10085240
237 JGI24738J21930_10050289
238 Ga0070682_100183549
239 Ga0070660_100079567
240 Ga0070689_100865871
241 Ga0070714_100031927
242 Ga0070713_100053173
243 Ga0070713_100112899
244 Ga0070713_100387713
245 Ga0070710_10008183
246 Ga0070701_10463144
247 Ga0070681_10009327
248 Ga0070681_10316642
249 Ga0070706_100329490
250 Ga0070706_101229703
251 Ga0070679_100012658
252 Ga0070679_100073272
253 Ga0068853_100001738
254 Ga0068855_101000993
255 Ga0068854_100532174
256 Ga0068856_100247063
257 Ga0068861_101760325
258 Ga0068860_101028344
259 Ga0081455_10074997
260 Ga0070717_10248771
261 Ga0070717_10784917
262 Ga0075365_10060889
263 Ga0075365_10147479
264 Ga0075368_10033028
265 Ga0075363_100051526
266 Ga0075363_100690004
267 Ga0070712_100638656
268 Ga0075367_10002334
269 Ga0075428_100323253
270 Ga0075428_100612377
271 Ga0075430_100286749
272 Ga0075431_100327905
273 Ga0075429_100293045
274 Ga0068865_101024274
275 Ga0105240_10469353
276 Ga0111539_11123829
277 Ga0111539_11692093
278 Ga0105245_10014363
279 Ga0105245_10233761
280 Ga0114129_11327900
281 Ga0105241_10166390
282 Ga0105242_10028346
283 Ga0105238_10134812
284 Ga0105239_10473832
285 Ga0105239_10960054
286 Ga0105239_11656162
287 Ga0105246_10057141
288 Ga0157369_12048932
289 Ga0157374_10786133
290 Ga0157378_10519198
291 Ga0157372_11412514
292 Ga0182006_1183155
293 Ga0206353_10230177
294 Ga0207692_10861336
295 Ga0207647_10456245
296 Ga0207684_10353493
297 Ga0207684_11018951
298 Ga0207654_10142515
299 Ga0207707_10039723
300 Ga0207707_10055153
301 Ga0207707_10617918
302 Ga0207693_10006490
303 Ga0207693_10727538
304 Ga0207660_10175001
305 Ga0207657_10018141
306 Ga0207652_10202915
307 Ga0207694_10186602
308 Ga0207687_10181827
309 Ga0207700_10312729
310 Ga0207664_10020191
311 Ga0207690_11006086
312 Ga0207686_10015117
313 Ga0207670_10572742
314 Ga0207667_10892776
315 Ga0207639_10229780
316 Ga0207702_10495548
317 Ga0207698_10495037
318 Ga0209813_10171087
319 Ga0307512_10015854
320 Ga0307408_101665381
321 Ga0307508_10006280
322 Ga0307405_10022156
323 Ga0307518_10032940
324 Ga0307410_10508118
325 Ga0307406_10366788
326 Ga0307407_10095605
327 Ga0307407_11011750
328 Ga0307409_100093108
329 Ga0307409_100101337
330 Ga0307416_101016154
331 Ga0307411_10030180
332 Ga0307415_100267875
333 Ga0316580_10054781
334 Ga0373954_0116915
335 Ga0373935_0867585
336 Ga0373937_0213734
337 Ga0373925_1399939
338 Ga0395899_0541212
339 Ga0395900_0652266
340 Ga0395898_0001427
341 Ga0395898_0147009
342 Ga0395901_1441335
343 Ga0451843_0508223
344 Ga0451853_2555685
345 Ga0466969_0039971
346 Ga0466972_0013358
347 Ga0466965_0232702
348 Ga0466966_0003179
349 Ga0466966_0627702
350 Ga0466961_0002160
351 Ga0466961_0020509
352 Ga0466961_0167400
353 Ga0466971_0040464
354 Ga0466970_0020552
355 Ga0466970_0172397
356 Ga0466970_0410039
357 Ga0466957_0030872
358 Ga0466960_0002098
359 Ga0466960_0213940
360 Ga0466960_0265201
361 Ga0466959_0002237
362 Ga0466958_0412126
363 Ga0466967_0040466
364 Ga0466967_0137516
365 Ga0495603_0003132
366 Ga0495603_0017549
367 Ga0495603_0043926
368 Ga0495629_0042435
369 Ga0495629_0592434
370 Ga0495641_0135339
371 Ga0495580_0070029
372 Ga0495585_0051590
373 Ga0495585_0497041
374 Ga0495594_0000385
375 Ga0495594_0234931
376 Ga0495607_0088816
377 Ga0495628_0030496
378 Ga0495630_0022924
379 Ga0495666_0188459
380 Ga0495640_0075598
381 Ga0495587_0233719
382 Ga0495597_0379934
383 Ga0495622_0015061
384 Ga0495668_0209682
385 Ga0495668_0700011
386 Ga0495634_0008120
387 Ga0495611_0100602
388 Ga0495611_0329974
389 Ga0495635_0431394
390 Ga0495588_0024212
391 Ga0495599_0335044
392 Ga0495623_0059888
393 Ga0495658_0369004
394 Ga0495613_0000128
395 Ga0495613_0099497
396 Ga0495670_0114779
397 Ga0495589_0002198
398 Ga0495589_0020348
399 Ga0495581_0106113
400 Ga0495636_0066497
401 Ga0495674_0251974
402 Ga0495676_0004028
403 Ga0495676_0094794
404 Ga0495676_0104669
405 Ga0495676_0897587
406 Ga0495680_0242333
407 Ga0495683_0060973
408 Ga0495683_0222505
409 Ga0495685_007277
410 Ga0495685_120506
411 Ga0495684_0271707
412 Ga0495593_0062388
413 Ga0495602_0116715
414 Ga0496103_0387576
415 Ga0496104_0333229
416 Ga0496104_1222793
417 Ga0496105_0137620
418 Ga0496109_0691073
419 Ga0496112_0252485
420 Ga0496115_0965477
421 Ga0501033_0069870
422 Ga0501033_0147934
423 Ga0501034_0183999
424 Ga0501036_1055182
425 Ga0501038_0004815
426 Ga0501038_0252715
427 Ga0501039_0281178
428 Ga0501040_0255580
429 Ga0501043_0239612
430 Ga0501047_0089347
431 Ga0501067_0484197
432 Ga0501070_0303982
433 Ga0501073_0272409
434 Ga0501076_0441545
435 Ga0501080_0219283
436 Ga0501080_0645607
437 Ga0501044_0008514
438 Ga0501044_0023165
439 Ga0501044_0047233
440 Ga0501044_1122729
441 nmdc:mga0yw44_25076_c1
442 nmdc:mga0yw44_391169_c1
443 nmdc:mga06z11_2430_c1
444 nmdc:mga04h51_121045_c1
445 nmdc:mga05p37_666401_c1
446 nmdc:mga09592_1464300_c1
447 nmdc:mga0qj67_363641_c1
448 nmdc:mga08y16_682504_c1
449 Ga0495601_0024730
450 Ga0495612_0385670
451 Ga0495619_0248072
452 Ga0500566_0000510
453 Ga0500566_0118786
454 Ga0466962_0007995
455 2740165903
456 2559431123
457 2583150025
458 2644092981
459 2644322594
460 2812352431
461 2862580728
462 2895434370
463 2899365744
464 2997452078
465 8056210073
466 8056830836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

2

71

0.86

PF01799

Fer2_2

[2Fe-2S] binding domain

71

154

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lxf-assembly1.cif.gz_A crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans 0.7213 5 75
2wp9-assembly3.cif.gz_J crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant 0.71 12 73
7kcm-assembly1.cif.gz_C full-length human mitochondrial hsp90 (trap1) in complex with sdhb in the presence of amp-pnp 0.7069 12 75
2wlb-assembly2.cif.gz_B adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria 0.7 4 74
6yj4-assembly1.cif.gz_G structure of yarrowia lipolytica complex i at 2.7 a 0.6832 2 74
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9265 2 77 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9103 2 75 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9034 2 77 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8932 1 77 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8826 2 77 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A257LNN9-F1-model_v4 (2Fe-2S)-binding protein 0.9387 1 75 GO:0051537
AF-A0A257JGG5-F1-model_v4 Isoquinoline 1-oxidoreductase 0.932 4 79 GO:0051537
AF-A0A257LNN9-F1-model_v4 (2Fe-2S)-binding protein 0.9268 1 75 GO:0051537
AF-A0A800BKA9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9252 1 79 GO:0051537
AF-A0A1Q7AH13-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9222 1 80 GO:0051537

Map