F346473

General Info

Members Datasets Scaffolds Average Seq Length
233 196 466 230

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0101123|Ga0496118_0101123_616_1398
Length 260
Sequence VPHDGDKTPAALAGTAFDGQLSVSTRCIGLAMLKQFGHEVWTADGTDVVIVGFHYPTRMAVMRLSDRCLFIWSPIQLTETLRAEVDAFGQVRHIIAPHSPHHLFLPEWKSAYPGAKVYAPPGLRKKREDIVFDADLGNTPSPDWAEEIDQALMQSNLITTEVVFFHVKSGTVLFTDLIQQFPASLFSGWRALVAKLDLMAGPEPSVPRKFRVAFTNRRAARDSLERIFAWPAEKVLMAHGIPVEKDARAFLRRAFGWLTA

Samples

Sample ID Description Type Environment
1 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
138 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
139 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
140 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
141 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
143 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
147 2643221651 Afipia sp. Root123D2 Isolate Unclassified
148 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
149 2738543024 Aminobacter sp. AP02 Isolate Unclassified
150 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
151 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
152 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
153 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
154 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
155 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
156 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
157 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
158 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
159 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
160 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
161 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
162 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
163 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
164 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
165 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
166 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
167 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
168 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
169 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
170 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
171 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
172 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
173 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
174 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
175 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
176 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
177 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
178 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
179 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
180 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
181 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
182 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
183 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
184 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
185 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
186 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
187 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
188 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
189 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
190 3004167301 Mesorhizobium loti 582 Isolate Unclassified
191 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
192 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
193 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
194 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
195 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
196 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.11
Metatranscriptomes 0
Isolates 21.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.88
Nodule 19.31
Rhizoplane 0.86
Rhizosphere 55.36
Stem 0
Stem Tuber 0
Unclassified 14.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496118_0101123 3300048921 Bacteria 1948
2 rootH2_10249385 3300003320 Bacteria 1220
3 rootH1_10323109 3300003323 Unclassified 1983
4 Ga0055530_10000026 3300003791 Bacteria 129960
5 Ga0070676_10021121 3300005328 Bacteria 3643
6 Ga0070666_10002115 3300005335 Bacteria 12072
7 Ga0070680_100209953 3300005336 Unclassified 1643
8 Ga0068868_100008395 3300005338 Bacteria 7393
9 Ga0070667_100223923 3300005367 Unclassified 1675
10 Ga0070713_100084400 3300005436 Bacteria 2717
11 Ga0070713_100157218 3300005436 Bacteria 2027
12 Ga0070684_101036459 3300005535 Unclassified 770
13 Ga0068853_100055682 3300005539 Bacteria 3409
14 Ga0070693_100065985 3300005547 Bacteria 2117
15 Ga0070665_100223322 3300005548 Bacteria 1884
16 Ga0068855_100083118 3300005563 Bacteria 3709
17 Ga0068855_100489236 3300005563 Unclassified 1338
18 Ga0068860_100251671 3300005843 Bacteria 1721
19 Ga0081455_10005789 3300005937 Bacteria 13470
20 Ga0081455_10016682 3300005937 Bacteria 7075
21 Ga0081538_10082186 3300005981 Bacteria 1710
22 Ga0081540_1009225 3300005983 Bacteria 6804
23 Ga0081540_1033960 3300005983 Bacteria 2760
24 Ga0075365_10119530 3300006038 Bacteria 1817
25 Ga0075368_10014450 3300006042 Bacteria 2916
26 Ga0075363_100049553 3300006048 Bacteria 2237
27 Ga0075369_10089200 3300006186 Bacteria 1374
28 Ga0075370_10167615 3300006353 Bacteria 1290
29 Ga0068871_100085756 3300006358 Bacteria 2616
30 Ga0068871_100253465 3300006358 Unclassified 1533
31 Ga0075434_100573915 3300006871 Unclassified 1147
32 Ga0111539_10864334 3300009094 Bacteria 1052
33 Ga0105245_10025542 3300009098 Bacteria 5196
34 Ga0105247_10204190 3300009101 Bacteria 1329
35 Ga0105241_10128559 3300009174 Bacteria 2048
36 Ga0105242_10042043 3300009176 Bacteria 3688
37 Ga0105248_10193376 3300009177 Bacteria 2292
38 Ga0105248_10198891 3300009177 Bacteria 2258
39 Ga0105248_10280649 3300009177 Unclassified 1875
40 Ga0105237_10034715 3300009545 Bacteria 5105
41 Ga0105238_10055787 3300009551 Bacteria 3965
42 Ga0105238_10157076 3300009551 Bacteria 2249
43 Ga0105239_10402118 3300010375 Bacteria 1550
44 Ga0105246_10249274 3300011119 Bacteria 1408
45 Ga0157378_10027073 3300013297 Bacteria 5058
46 Ga0157378_10406718 3300013297 Unclassified 1342
47 Ga0163162_10593313 3300013306 Bacteria 1234
48 Ga0157375_10292185 3300013308 Unclassified 1793
49 Ga0163163_10056488 3300014325 Bacteria 3880
50 Ga0163163_10576156 3300014325 Bacteria 1188
51 Ga0157379_10040976 3300014968 Bacteria 4134
52 Ga0157376_10008982 3300014969 Bacteria 7238
53 Ga0157376_10379695 3300014969 Bacteria 1361
54 Ga0213876_10130121 3300021384 Bacteria 1338
55 Ga0209148_1004284 3300025254 Bacteria 3555
56 Ga0209233_1005321 3300025261 Bacteria 4283
57 Ga0209455_1004058 3300025272 Bacteria 4942
58 Ga0209455_1007288 3300025272 Bacteria 3143
59 Ga0209758_1012856 3300025297 Bacteria 4636
60 Ga0209050_1000029 3300025298 Bacteria 465801
61 Ga0209257_1000152 3300025304 Bacteria 189432
62 Ga0207680_10003693 3300025903 Bacteria 7188
63 Ga0207654_10102684 3300025911 Bacteria 1764
64 Ga0207671_10035753 3300025914 Bacteria 3684
65 Ga0207694_10104839 3300025924 Bacteria 2244
66 Ga0207694_10149861 3300025924 Bacteria 1879
67 Ga0207694_10185738 3300025924 Bacteria 1687
68 Ga0207700_10124182 3300025928 Bacteria 2097
69 Ga0207706_10105455 3300025933 Bacteria 2480
70 Ga0207686_10006539 3300025934 Bacteria 6275
71 Ga0207711_10023559 3300025941 Bacteria 5153
72 Ga0207711_10082434 3300025941 Bacteria 2811
73 Ga0207711_10625072 3300025941 Bacteria 1005
74 Ga0207689_10195315 3300025942 Bacteria 1670
75 Ga0207667_10127401 3300025949 Bacteria 2623
76 Ga0207668_10328020 3300025972 Bacteria 1272
77 Ga0207677_10052013 3300026023 Bacteria 2781
78 Ga0207703_10162815 3300026035 Bacteria 1955
79 Ga0207676_10359918 3300026095 Bacteria 1348
80 Ga0207675_100032839 3300026118 Bacteria 4836
81 Ga0207683_10051096 3300026121 Bacteria 3622
82 Ga0207698_10059355 3300026142 Bacteria 2970
83 Ga0209813_10070631 3300027866 Bacteria 1134
84 Ga0268265_10112157 3300028380 Bacteria 2229
85 Ga0268264_10000958 3300028381 Bacteria 29729
86 Ga0265338_10004454 3300028800 Bacteria 18905
87 Ga0265330_10035144 3300031235 Bacteria 2238
88 Ga0307513_10127812 3300031456 Bacteria 2493
89 Ga0307509_10186399 3300031507 Unclassified 1932
90 Ga0307508_10019717 3300031616 Bacteria 6127
91 Ga0265342_10079546 3300031712 Bacteria 1895
92 Ga0307516_10126716 3300031730 Bacteria 2337
93 Ga0307516_10199561 3300031730 Bacteria 1721
94 Ga0373955_0028158 3300035172 Bacteria 2911
95 Ga0373924_0129651 3300035410 Unclassified 1097
96 Ga0373937_0059329 3300036401 Unclassified 3516
97 Ga0373937_0110397 3300036401 Bacteria 2558
98 Ga0436365_0686390 3300039437 Bacteria 1299
99 Ga0439465_0093085 3300041413 Bacteria 1033
100 Ga0495592_0215609 3300046454 Unclassified 1286
101 Ga0495651_0002173 3300046462 Bacteria 15168
102 Ga0495653_0073713 3300046463 Bacteria 2546
103 Ga0495664_0047731 3300046477 Bacteria 2541
104 Ga0495583_0031812 3300046506 Bacteria 2553
105 Ga0495608_0018298 3300046511 Unclassified 4834
106 Ga0495618_0014338 3300046514 Bacteria 4828
107 Ga0495628_0131754 3300046516 Unclassified 1911
108 Ga0495630_0355966 3300046517 Unclassified 1120
109 Ga0495652_0106612 3300046529 Unclassified 2262
110 Ga0495645_0274774 3300046543 Unclassified 1110
111 Ga0495668_0021086 3300046616 Bacteria 3741
112 Ga0495634_0265738 3300046642 Unclassified 1045
113 Ga0495635_0427520 3300046663 Unclassified 877
114 Ga0495657_0009103 3300046675 Bacteria 7544
115 Ga0495646_0011869 3300046680 Bacteria 5542
116 Ga0495604_0005199 3300047317 Bacteria 10311
117 Ga0495674_0009612 3300047319 Bacteria 9185
118 Ga0495672_0010563 3300047320 Bacteria 6567
119 Ga0495676_0209890 3300047321 Unclassified 1348
120 Ga0495680_0003160 3300047322 Bacteria 16401
121 Ga0495675_0008185 3300047444 Bacteria 6471
122 Ga0495684_0018953 3300047471 Bacteria 5298
123 Ga0495593_0299285 3300047673 Unclassified 804
124 Ga0495602_0023899 3300048088 Bacteria 5942
125 Ga0496106_0338015 3300048909 Unclassified 1209
126 Ga0496108_0025439 3300048911 Bacteria 4879
127 Ga0496117_0007732 3300048920 Bacteria 10391
128 Ga0496117_0082975 3300048920 Bacteria 2097
129 Ga0496118_0033349 3300048921 Bacteria 4226
130 Ga0496118_0083000 3300048921 Bacteria 2242
131 Ga0496119_0112837 3300048922 Bacteria 1506
132 Ga0496121_0003149 3300048924 Bacteria 23797
133 Ga0496121_0195703 3300048924 Bacteria 1445
134 Ga0496124_0002423 3300048927 Bacteria 24474
135 Ga0496126_0068542 3300048929 Unclassified 3167
136 Ga0496126_0219418 3300048929 Bacteria 1598
137 Ga0496126_0286246 3300048929 Unclassified 1364
138 Ga0496126_0446434 3300048929 Bacteria 1042
139 Ga0501034_0120980 3300049571 Bacteria 2604
140 Ga0501034_0122330 3300049571 Bacteria 2588
141 Ga0501037_0317608 3300049573 Unclassified 1079
142 Ga0501038_0128564 3300049574 Bacteria 2082
143 Ga0501043_0377167 3300049579 Bacteria 1074
144 Ga0501047_0010002 3300049581 Bacteria 8967
145 Ga0501047_0057377 3300049581 Bacteria 3765
146 Ga0501047_0112766 3300049581 Bacteria 2601
147 Ga0501069_0155716 3300049585 Bacteria 1314
148 Ga0501073_0017246 3300049589 Bacteria 5231
149 Ga0501073_0047326 3300049589 Bacteria 3023
150 Ga0501073_0096865 3300049589 Bacteria 2049
151 Ga0501074_0097500 3300049590 Unclassified 2104
152 Ga0501080_0025189 3300049742 Bacteria 5521
153 Ga0501080_0078996 3300049742 Bacteria 3059
154 Ga0501080_0757892 3300049742 Bacteria 853
155 Ga0501080_0805606 3300049742 Unclassified 823
156 Ga0501083_0027830 3300049744 Bacteria 3898
157 Ga0501083_0096440 3300049744 Bacteria 1951
158 Ga0501083_0351387 3300049744 Bacteria 958
159 Ga0501044_0215382 3300049823 Bacteria 1873
160 nmdc:mga03n38_159916_c1 3300050490 Bacteria 1140
161 nmdc:mga00v17_396625_c1 3300050491 Bacteria 897
162 nmdc:mga0yw44_105279_c1 3300050492 Bacteria 1802
163 nmdc:mga0k408_301461_c1 3300050493 Unclassified 956
164 nmdc:mga06z11_65454_c1 3300050494 Bacteria 1908
165 nmdc:mga04h51_84233_c1 3300050495 Bacteria 1134
166 nmdc:mga0n895_928934_c1 3300050512 Unclassified 854
167 nmdc:mga0rr50_281602_c1 3300050513 Bacteria 1387
168 nmdc:mga0sz30_95556_c1 3300050516 Bacteria 1296
169 Ga0495601_0082620 3300053077 Unclassified 2062
170 Ga0500559_0103149 3300053136 Unclassified 1316
171 Ga0500568_0042975 3300053139 Bacteria 1808
172 Ga0500573_0068595 3300053140 Bacteria 2024
173 Ga0500590_072807 3300053148 Bacteria 1705
174 Ga0500604_0114118 3300053151 Unclassified 899
175 Ga0500634_0000015 3300053161 Bacteria 113039
176 Ga0500636_0129694 3300053177 Bacteria 1406
177 Ga0500645_005215 3300053730 Bacteria 4836
178 Ga0500596_004258 3300053735 Bacteria 2645
179 Ga0501084_0031422 3300054114 Bacteria 4439
180 Ga0501082_0032895 3300060353 Bacteria 4472
181 Ga0501082_0094048 3300060353 Bacteria 2590
182 Ga0501082_0699497 3300060353 Bacteria 887
183 2509371554 2509276018 Bacteria 6910194
184 2644291607 2643221651 Bacteria 4798932
185 2688597626 2687453392 Bacteria 6880454
186 2739307076 2738543024 Bacteria 5603683
187 2856333523 2856328259 Bacteria 6528202
188 2856337929 2856334872 Bacteria 7037011
189 2857368942 2857367948 Bacteria 6965560
190 2869253557 2869249662 Bacteria 6868783
191 2869265724 2869264136 Bacteria 6880765
192 2869277950 2869271264 Bacteria 6908218
193 2871461726 2871459585 Bacteria 6866887
194 2874133043 2874131515 Bacteria 6820270
195 2874165349 2874162495 Bacteria 6174670
196 2874609699 2874604998 Bacteria 7834745
197 2878776209 2878774303 Bacteria 6108671
198 2878786693 2878781027 Bacteria 6834456
199 2891091958 2891088606 Bacteria 4762464
200 2903771016 2903768456 Bacteria 9749579
201 2906367681 2906363423 Bacteria 6856682
202 2906371487 2906370794 Bacteria 6881062
203 2906400563 2906393657 Bacteria 6790866
204 2906412506 2906408224 Bacteria 6162342
205 2922175868 2922172374 Bacteria 6167644
206 2922180193 2922178524 Bacteria 6025201
207 2937876101 2937868953 Bacteria 6639878
208 2958124888 2958122699 Bacteria 7280457
209 2958138668 2958137437 Bacteria 6050276
210 2958163658 2958158011 Bacteria 6058449
211 2961141706 2961136820 Bacteria 6775228
212 2965025816 2965025482 Bacteria 6532201
213 2965038986 2965032056 Bacteria 6887443
214 2965042691 2965040258 Bacteria 6855979
215 2965050986 2965047637 Bacteria 6623551
216 2965096483 2965089291 Bacteria 6866420
217 2965116241 2965110997 Bacteria 6693150
218 2970551509 2970547951 Bacteria 6931819
219 2977874272 2977872689 Bacteria 7270173
220 2977919859 2977915119 Bacteria 6829656
221 2977939055 2977935797 Bacteria 6252826
222 2977953497 2977950692 Bacteria 6893264
223 2977959341 2977957713 Bacteria 6877875
224 2979793326 2979793036 Bacteria 6808957
225 2987646411 2987645492 Bacteria 6117018
226 2987674336 2987673487 Bacteria 6884027
227 3004168061 3004167301 Bacteria 8330599
228 3004198432 3004195979 Bacteria 6776956
229 3004243014 3004239961 Bacteria 6892290
230 8004306558 8004300914 Bacteria 6132239
231 8004366383 8004361976 Bacteria 6858373
232 8004695255 8004695233 Bacteria 6731676
233 8056682691 8056681323 Bacteria 8472857
234 Ga0496118_0101123
235 rootH2_10249385
236 rootH1_10323109
237 Ga0055530_10000026
238 Ga0070676_10021121
239 Ga0070666_10002115
240 Ga0070680_100209953
241 Ga0068868_100008395
242 Ga0070667_100223923
243 Ga0070713_100084400
244 Ga0070713_100157218
245 Ga0070684_101036459
246 Ga0068853_100055682
247 Ga0070693_100065985
248 Ga0070665_100223322
249 Ga0068855_100083118
250 Ga0068855_100489236
251 Ga0068860_100251671
252 Ga0081455_10005789
253 Ga0081455_10016682
254 Ga0081538_10082186
255 Ga0081540_1009225
256 Ga0081540_1033960
257 Ga0075365_10119530
258 Ga0075368_10014450
259 Ga0075363_100049553
260 Ga0075369_10089200
261 Ga0075370_10167615
262 Ga0068871_100085756
263 Ga0068871_100253465
264 Ga0075434_100573915
265 Ga0111539_10864334
266 Ga0105245_10025542
267 Ga0105247_10204190
268 Ga0105241_10128559
269 Ga0105242_10042043
270 Ga0105248_10193376
271 Ga0105248_10198891
272 Ga0105248_10280649
273 Ga0105237_10034715
274 Ga0105238_10055787
275 Ga0105238_10157076
276 Ga0105239_10402118
277 Ga0105246_10249274
278 Ga0157378_10027073
279 Ga0157378_10406718
280 Ga0163162_10593313
281 Ga0157375_10292185
282 Ga0163163_10056488
283 Ga0163163_10576156
284 Ga0157379_10040976
285 Ga0157376_10008982
286 Ga0157376_10379695
287 Ga0213876_10130121
288 Ga0209148_1004284
289 Ga0209233_1005321
290 Ga0209455_1004058
291 Ga0209455_1007288
292 Ga0209758_1012856
293 Ga0209050_1000029
294 Ga0209257_1000152
295 Ga0207680_10003693
296 Ga0207654_10102684
297 Ga0207671_10035753
298 Ga0207694_10104839
299 Ga0207694_10149861
300 Ga0207694_10185738
301 Ga0207700_10124182
302 Ga0207706_10105455
303 Ga0207686_10006539
304 Ga0207711_10023559
305 Ga0207711_10082434
306 Ga0207711_10625072
307 Ga0207689_10195315
308 Ga0207667_10127401
309 Ga0207668_10328020
310 Ga0207677_10052013
311 Ga0207703_10162815
312 Ga0207676_10359918
313 Ga0207675_100032839
314 Ga0207683_10051096
315 Ga0207698_10059355
316 Ga0209813_10070631
317 Ga0268265_10112157
318 Ga0268264_10000958
319 Ga0265338_10004454
320 Ga0265330_10035144
321 Ga0307513_10127812
322 Ga0307509_10186399
323 Ga0307508_10019717
324 Ga0265342_10079546
325 Ga0307516_10126716
326 Ga0307516_10199561
327 Ga0373955_0028158
328 Ga0373924_0129651
329 Ga0373937_0059329
330 Ga0373937_0110397
331 Ga0436365_0686390
332 Ga0439465_0093085
333 Ga0495592_0215609
334 Ga0495651_0002173
335 Ga0495653_0073713
336 Ga0495664_0047731
337 Ga0495583_0031812
338 Ga0495608_0018298
339 Ga0495618_0014338
340 Ga0495628_0131754
341 Ga0495630_0355966
342 Ga0495652_0106612
343 Ga0495645_0274774
344 Ga0495668_0021086
345 Ga0495634_0265738
346 Ga0495635_0427520
347 Ga0495657_0009103
348 Ga0495646_0011869
349 Ga0495604_0005199
350 Ga0495674_0009612
351 Ga0495672_0010563
352 Ga0495676_0209890
353 Ga0495680_0003160
354 Ga0495675_0008185
355 Ga0495684_0018953
356 Ga0495593_0299285
357 Ga0495602_0023899
358 Ga0496106_0338015
359 Ga0496108_0025439
360 Ga0496117_0007732
361 Ga0496117_0082975
362 Ga0496118_0033349
363 Ga0496118_0083000
364 Ga0496119_0112837
365 Ga0496121_0003149
366 Ga0496121_0195703
367 Ga0496124_0002423
368 Ga0496126_0068542
369 Ga0496126_0219418
370 Ga0496126_0286246
371 Ga0496126_0446434
372 Ga0501034_0120980
373 Ga0501034_0122330
374 Ga0501037_0317608
375 Ga0501038_0128564
376 Ga0501043_0377167
377 Ga0501047_0010002
378 Ga0501047_0057377
379 Ga0501047_0112766
380 Ga0501069_0155716
381 Ga0501073_0017246
382 Ga0501073_0047326
383 Ga0501073_0096865
384 Ga0501074_0097500
385 Ga0501080_0025189
386 Ga0501080_0078996
387 Ga0501080_0757892
388 Ga0501080_0805606
389 Ga0501083_0027830
390 Ga0501083_0096440
391 Ga0501083_0351387
392 Ga0501044_0215382
393 nmdc:mga03n38_159916_c1
394 nmdc:mga00v17_396625_c1
395 nmdc:mga0yw44_105279_c1
396 nmdc:mga0k408_301461_c1
397 nmdc:mga06z11_65454_c1
398 nmdc:mga04h51_84233_c1
399 nmdc:mga0n895_928934_c1
400 nmdc:mga0rr50_281602_c1
401 nmdc:mga0sz30_95556_c1
402 Ga0495601_0082620
403 Ga0500559_0103149
404 Ga0500568_0042975
405 Ga0500573_0068595
406 Ga0500590_072807
407 Ga0500604_0114118
408 Ga0500634_0000015
409 Ga0500636_0129694
410 Ga0500645_005215
411 Ga0500596_004258
412 Ga0501084_0031422
413 Ga0501082_0032895
414 Ga0501082_0094048
415 Ga0501082_0699497
416 2509371554
417 2644291607
418 2688597626
419 2739307076
420 2856333523
421 2856337929
422 2857368942
423 2869253557
424 2869265724
425 2869277950
426 2871461726
427 2874133043
428 2874165349
429 2874609699
430 2878776209
431 2878786693
432 2891091958
433 2903771016
434 2906367681
435 2906371487
436 2906400563
437 2906412506
438 2922175868
439 2922180193
440 2937876101
441 2958124888
442 2958138668
443 2958163658
444 2961141706
445 2965025816
446 2965038986
447 2965042691
448 2965050986
449 2965096483
450 2965116241
451 2970551509
452 2977874272
453 2977919859
454 2977939055
455 2977953497
456 2977959341
457 2979793326
458 2987646411
459 2987674336
460 3004168061
461 3004198432
462 3004243014
463 8004306558
464 8004366383
465 8004695255
466 8056682691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14234

DUF4336

Domain of unknown function (DUF4336)

37

195

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.8342 1 223
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.8007 1 223
4ubq-assembly1.cif.gz_A crystal structure of imp-2 metallo-beta-lactamase from acinetobacter spp. 0.7274 1 230
4f6z-assembly1.cif.gz_A mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site 0.7252 1 230
6r79-assembly1.cif.gz_A structure of imp-13 metallo-beta-lactamase in apo form (loop open) 0.7219 1 230
ID Description Score Start End Superfamily
2p97B00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8308 6 230 3.60.15.10
af_I1LWQ0_108_335_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8279 8 141 3.60.15.10
2p97B00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8049 6 230 3.60.15.10
af_Q8RWE1_144_338_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.798 11 228 3.60.15.10
af_A0A1D8PNS2_11_271_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7833 3 221 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A1G8RCF2-F1-model_v4 DUF4336 domain-containing protein 0.9811 2 232
AF-A0A4Y6S390-F1-model_v4 DUF4336 domain-containing protein 0.9806 3 229
AF-A0A522LHV5-F1-model_v4 DUF4336 domain-containing protein 0.9795 1 229
AF-G6EFQ3-F1-model_v4 DUF4336 domain-containing protein 0.9788 1 229
AF-A0A7C5N447-F1-model_v4 DUF4336 domain-containing protein 0.9768 1 125

Map