F346373

General Info

Members Datasets Scaffolds Average Seq Length
233 137 466 191

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0078632|Ga0451576_0078632_1305_1976
Length 223
Sequence MGPWAAARSFGESERGCRAGGGLLTSESKEVSTMATAASGAKVSDLLRRLDLAVATDDVNLLCRNVKRVLAEIVGSEREFLDAPFLRPAPDRYARRLLHRDPAGRYSVVVMVWDRGQGTPLHDHSGMWCVECVYRGRIRVTSFDMVGDSQAEVMRFAPETVIVAGKGEAGHLIPPFEYHMIENPDDTAAVTIHVYGGEMTSCTAFFPVEGGYRRETRTLSYTD

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
84 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 6.44
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 19.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0078632 3300045051 Bacteria 3432
2 MBSR1b_contig_12765972 2162886012 Bacteria 943
3 MBSR1b_contig_1692626 2162886012 Bacteria 1291
4 MBSR1b_contig_317582 2162886012 Bacteria 1792
5 Ga0065715_10090989 3300005293 Bacteria 6241
6 Ga0070690_100170547 3300005330 Bacteria 1497
7 Ga0070670_100037438 3300005331 Bacteria 4175
8 Ga0068869_100085373 3300005334 Bacteria 2364
9 Ga0070689_100004866 3300005340 Bacteria 9118
10 Ga0070689_100014510 3300005340 Bacteria 5725
11 Ga0070689_100073707 3300005340 Bacteria 2670
12 Ga0070689_100980258 3300005340 Unclassified 751
13 Ga0070675_100233046 3300005354 Bacteria 1607
14 Ga0070673_100185869 3300005364 Unclassified 1781
15 Ga0070673_100691914 3300005364 Bacteria 936
16 Ga0070688_100015897 3300005365 Bacteria 4291
17 Ga0070688_100094066 3300005365 Bacteria 1964
18 Ga0070688_100119372 3300005365 Bacteria 1764
19 Ga0070701_10016024 3300005438 Bacteria 3475
20 Ga0070705_100172522 3300005440 Unclassified 1457
21 Ga0070705_100513261 3300005440 Bacteria 912
22 Ga0070700_100032553 3300005441 Bacteria 3134
23 Ga0070700_100132118 3300005441 Unclassified 1686
24 Ga0070694_100053861 3300005444 Bacteria 2724
25 Ga0068867_100050633 3300005459 Bacteria 3062
26 Ga0070706_100029097 3300005467 Bacteria 5090
27 Ga0070698_100038416 3300005471 Bacteria 4932
28 Ga0070698_100194752 3300005471 Bacteria 1964
29 Ga0070697_100337976 3300005536 Bacteria 1299
30 Ga0070697_100352542 3300005536 Bacteria 1271
31 Ga0070686_100109198 3300005544 Bacteria 1882
32 Ga0070686_100507172 3300005544 Bacteria 937
33 Ga0070695_100020652 3300005545 Bacteria 4022
34 Ga0070695_100091673 3300005545 Bacteria 2030
35 Ga0070696_100022133 3300005546 Bacteria 4317
36 Ga0070696_100564028 3300005546 Unclassified 914
37 Ga0070704_100004573 3300005549 Bacteria 7996
38 Ga0070704_100352394 3300005549 Unclassified 1243
39 Ga0070704_100669762 3300005549 Unclassified 918
40 Ga0068859_100054598 3300005617 Bacteria 4018
41 Ga0068859_100106259 3300005617 Bacteria 2866
42 Ga0068859_100776568 3300005617 Bacteria 1046
43 Ga0068859_101981228 3300005617 Unclassified 643
44 Ga0068863_100033687 3300005841 Bacteria 4880
45 Ga0068863_100042249 3300005841 Bacteria 4332
46 Ga0068858_100837033 3300005842 Unclassified 898
47 Ga0068860_100006182 3300005843 Bacteria 12045
48 Ga0075365_10928883 3300006038 Unclassified 613
49 Ga0070716_100293255 3300006173 Bacteria 1128
50 Ga0070716_100726509 3300006173 Unclassified 761
51 Ga0075428_100054118 3300006844 Bacteria 4398
52 Ga0075428_100134508 3300006844 Bacteria 2688
53 Ga0075428_100516516 3300006844 Bacteria 1278
54 Ga0075430_100437371 3300006846 Bacteria 1080
55 Ga0075430_100666086 3300006846 Unclassified 858
56 Ga0075431_100020355 3300006847 Bacteria 6778
57 Ga0075431_100043681 3300006847 Bacteria 4623
58 Ga0075431_100076511 3300006847 Unclassified 3454
59 Ga0075431_100111710 3300006847 Bacteria 2820
60 Ga0075431_100870142 3300006847 Unclassified 872
61 Ga0075433_10013374 3300006852 Bacteria 6669
62 Ga0075433_10081519 3300006852 Unclassified 2853
63 Ga0075433_10105869 3300006852 Bacteria 2492
64 Ga0075434_100002336 3300006871 Bacteria 16610
65 Ga0075434_100239954 3300006871 Bacteria 1832
66 Ga0075434_100835105 3300006871 Bacteria 937
67 Ga0075429_100004593 3300006880 Bacteria 11870
68 Ga0075429_100017645 3300006880 Bacteria 6172
69 Ga0075429_100090422 3300006880 Bacteria 2670
70 Ga0075429_100714685 3300006880 Bacteria 878
71 Ga0068865_100101108 3300006881 Bacteria 2111
72 Ga0068865_100195224 3300006881 Bacteria 1568
73 Ga0068865_100289826 3300006881 Bacteria 1306
74 Ga0075436_100020525 3300006914 Bacteria 4534
75 Ga0097620_100054599 3300006931 Bacteria 4018
76 Ga0097620_100106263 3300006931 Bacteria 2866
77 Ga0097620_100776675 3300006931 Bacteria 1046
78 Ga0075435_100202292 3300007076 Bacteria 1683
79 Ga0075435_100275038 3300007076 Bacteria 1437
80 Ga0075435_100459907 3300007076 Bacteria 1098
81 Ga0105240_10000035 3300009093 Bacteria 277936
82 Ga0111539_10086736 3300009094 Bacteria 3678
83 Ga0111539_10214039 3300009094 Bacteria 2245
84 Ga0111539_10269114 3300009094 Bacteria 1984
85 Ga0111539_10312500 3300009094 Bacteria 1829
86 Ga0111539_10776114 3300009094 Unclassified 1115
87 Ga0111539_11670315 3300009094 Bacteria 739
88 Ga0111539_11978330 3300009094 Bacteria 676
89 Ga0114129_10000112 3300009147 Bacteria 80956
90 Ga0114129_10005973 3300009147 Bacteria 17242
91 Ga0114129_10214307 3300009147 Unclassified 2601
92 Ga0114129_10949964 3300009147 Unclassified 1086
93 Ga0105248_10076159 3300009177 Bacteria 3771
94 Ga0105237_10000044 3300009545 Bacteria 177828
95 Ga0105237_10135120 3300009545 Bacteria 2461
96 Ga0105238_10067257 3300009551 Unclassified 3585
97 Ga0105238_10197588 3300009551 Unclassified 1987
98 Ga0105239_10024821 3300010375 Bacteria 6604
99 Ga0157378_10027629 3300013297 Bacteria 5005
100 Ga0157375_10081683 3300013308 Bacteria 3272
101 Ga0182008_10373512 3300014497 Bacteria 761
102 Ga0157377_10360205 3300014745 Bacteria 979
103 Ga0157376_11041214 3300014969 Bacteria 842
104 Ga0213875_10117600 3300021388 Unclassified 1242
105 Ga0207695_10001002 3300025913 Bacteria 50032
106 Ga0207671_10000004 3300025914 Bacteria 1022356
107 Ga0207671_10247001 3300025914 Bacteria 1402
108 Ga0207694_10191591 3300025924 Unclassified 1661
109 Ga0207694_10590002 3300025924 Unclassified 934
110 Ga0207650_10025731 3300025925 Bacteria 4193
111 Ga0207706_10295632 3300025933 Unclassified 1411
112 Ga0207670_10179493 3300025936 Bacteria 1594
113 Ga0207704_10435753 3300025938 Bacteria 1043
114 Ga0207665_10765838 3300025939 Unclassified 761
115 Ga0207711_10073112 3300025941 Bacteria 2979
116 Ga0207689_10102938 3300025942 Bacteria 2346
117 Ga0207689_10206686 3300025942 Bacteria 1622
118 Ga0207651_10246679 3300025960 Bacteria 1459
119 Ga0207651_10999342 3300025960 Unclassified 747
120 Ga0207677_10139134 3300026023 Bacteria 1856
121 Ga0207703_10874711 3300026035 Unclassified 860
122 Ga0207708_10024949 3300026075 Bacteria 4523
123 Ga0207708_10171816 3300026075 Unclassified 1717
124 Ga0207641_10031936 3300026088 Bacteria 4370
125 Ga0207641_10036751 3300026088 Bacteria 4088
126 Ga0207641_10093333 3300026088 Bacteria 2638
127 Ga0207648_10050476 3300026089 Bacteria 3638
128 Ga0209974_10159768 3300027876 Bacteria 817
129 Ga0209974_10218558 3300027876 Unclassified 709
130 Ga0207428_10007155 3300027907 Bacteria 10211
131 Ga0207428_10068508 3300027907 Bacteria 2791
132 Ga0207428_10177878 3300027907 Bacteria 1608
133 Ga0207428_10179797 3300027907 Unclassified 1599
134 Ga0207428_10417246 3300027907 Bacteria 981
135 Ga0268265_10482129 3300028380 Bacteria 1165
136 Ga0268264_10018886 3300028381 Bacteria 5636
137 Ga0373934_0000212 3300035086 Bacteria 21190
138 Ga0373923_0410758 3300035111 Unclassified 652
139 Ga0373953_0167137 3300035117 Bacteria 946
140 Ga0373956_0074640 3300035119 Bacteria 1550
141 Ga0373957_0008566 3300035120 Bacteria 3319
142 Ga0373955_0000318 3300035172 Bacteria 19892
143 Ga0373933_0008261 3300035724 Bacteria 5681
144 Ga0373947_0358468 3300035725 Unclassified 979
145 Ga0373937_0303719 3300036401 Unclassified 1508
146 Ga0436364_1069680 3300037853 Unclassified 1240
147 Ga0436365_1570262 3300039437 Bacteria 778
148 Ga0451845_0664304 3300041501 Unclassified 627
149 Ga0439455_0036367 3300042012 Bacteria 1246
150 Ga0453683_0078514 3300044673 Bacteria 2067
151 Ga0453683_0428458 3300044673 Unclassified 854
152 Ga0453684_0065325 3300044712 Bacteria 4641
153 Ga0451576_0031501 3300045051 Bacteria 5652
154 Ga0451576_0090326 3300045051 Bacteria 3186
155 Ga0451576_0100708 3300045051 Bacteria 3004
156 Ga0495592_0149363 3300046454 Bacteria 1617
157 Ga0495592_0477002 3300046454 Unclassified 777
158 Ga0495603_0147781 3300046455 Bacteria 1366
159 Ga0495651_0002960 3300046462 Bacteria 13123
160 Ga0495653_0469411 3300046463 Unclassified 789
161 Ga0495608_0059272 3300046511 Bacteria 2522
162 Ga0495618_0034010 3300046514 Bacteria 3195
163 Ga0495628_0015442 3300046516 Bacteria 6376
164 Ga0495628_0037590 3300046516 Bacteria 3881
165 Ga0495587_0026636 3300046536 Bacteria 3524
166 Ga0495598_0245286 3300046537 Bacteria 662
167 Ga0495667_0051667 3300046559 Bacteria 2710
168 Ga0495635_0184387 3300046663 Bacteria 1418
169 Ga0495588_0241513 3300046674 Bacteria 953
170 Ga0495657_0189058 3300046675 Bacteria 1259
171 Ga0495599_0092379 3300046678 Bacteria 1888
172 Ga0495676_0043517 3300047321 Bacteria 3673
173 Ga0495680_0074431 3300047322 Bacteria 2579
174 Ga0495680_0304811 3300047322 Bacteria 1117
175 Ga0495675_0067249 3300047444 Bacteria 2264
176 Ga0496100_0019149 3300048903 Bacteria 4078
177 Ga0496101_0388618 3300048904 Bacteria 1098
178 Ga0496102_0007849 3300048905 Bacteria 9118
179 Ga0496102_0340356 3300048905 Bacteria 1413
180 Ga0496103_0020270 3300048906 Bacteria 3994
181 Ga0496104_0011908 3300048907 Bacteria 7803
182 Ga0496105_0036763 3300048908 Bacteria 4035
183 Ga0496106_0005482 3300048909 Bacteria 9388
184 Ga0496107_0097491 3300048910 Bacteria 2152
185 Ga0496108_0006558 3300048911 Bacteria 9442
186 Ga0496109_0002800 3300048912 Bacteria 14601
187 Ga0496110_0012160 3300048913 Bacteria 7071
188 Ga0496111_0041514 3300048914 Bacteria 3301
189 Ga0496112_0022700 3300048915 Bacteria 5985
190 Ga0496113_0010699 3300048916 Bacteria 6077
191 Ga0501042_0790955 3300049578 Bacteria 690
192 Ga0501072_0030883 3300049588 Bacteria 4191
193 Ga0501074_0509144 3300049590 Bacteria 853
194 Ga0501076_0017148 3300049592 Bacteria 5501
195 Ga0501081_0025859 3300049743 Bacteria 3954
196 Ga0501083_0386762 3300049744 Bacteria 910
197 nmdc:mga05p37_152113_c1 3300050507 Unclassified 2829
198 nmdc:mga05p37_19471_c1 3300050507 Bacteria 8210
199 nmdc:mga05p37_5420_c1 3300050507 Bacteria 14992
200 nmdc:mga09592_136_c1 3300050508 Bacteria 48356
201 nmdc:mga09592_233477_c1 3300050508 Unclassified 1594
202 nmdc:mga09592_279349_c1 3300050508 Bacteria 1448
203 nmdc:mga09592_39405_c1 3300050508 Bacteria 3969
204 nmdc:mga09592_72132_c1 3300050508 Bacteria 2932
205 nmdc:mga0qj67_124137_c1 3300050509 Bacteria 2089
206 nmdc:mga0qj67_286919_c1 3300050509 Unclassified 1334
207 nmdc:mga0qj67_70648_c1 3300050509 Bacteria 2785
208 nmdc:mga06r32_311158_c1 3300050510 Bacteria 1561
209 nmdc:mga06r32_413616_c1 3300050510 Unclassified 1330
210 nmdc:mga06r32_661527_c1 3300050510 Bacteria 1012
211 nmdc:mga06r32_67441_c1 3300050510 Unclassified 3454
212 nmdc:mga06r32_88135_c1 3300050510 Bacteria 3029
213 nmdc:mga08y16_1711_c1 3300050511 Bacteria 22261
214 nmdc:mga08y16_219486_c1 3300050511 Bacteria 1968
215 nmdc:mga08y16_234715_c1 3300050511 Bacteria 1897
216 nmdc:mga08y16_386683_c1 3300050511 Unclassified 1434
217 nmdc:mga0n895_1090589_c1 3300050512 Bacteria 776
218 nmdc:mga0n895_189_c1 3300050512 Bacteria 38186
219 nmdc:mga0n895_276450_c1 3300050512 Bacteria 1703
220 nmdc:mga0n895_588552_c1 3300050512 Bacteria 1116
221 nmdc:mga0rr50_215115_c1 3300050513 Bacteria 1585
222 nmdc:mga0rr50_226014_c1 3300050513 Bacteria 1547
223 nmdc:mga0rr50_382908_c1 3300050513 Bacteria 1186
224 nmdc:mga0rr50_496418_c1 3300050513 Bacteria 1037
225 nmdc:mga08x19_36841_c1 3300050514 Bacteria 3100
226 nmdc:mga0a205_2053_c1 3300050515 Bacteria 17602
227 nmdc:mga0a205_540878_c1 3300050515 Bacteria 1020
228 Ga0495601_0100618 3300053077 Bacteria 1867
229 Ga0495595_0055340 3300053084 Bacteria 1846
230 Ga0495619_0394224 3300053085 Bacteria 956
231 Ga0501084_0469032 3300054114 Bacteria 1064
232 Ga0501084_0897497 3300054114 Bacteria 745
233 Ga0501082_0542838 3300060353 Unclassified 1017
234 Ga0451576_0078632
235 MBSR1b_contig_12765972
236 MBSR1b_contig_1692626
237 MBSR1b_contig_317582
238 Ga0065715_10090989
239 Ga0070690_100170547
240 Ga0070670_100037438
241 Ga0068869_100085373
242 Ga0070689_100004866
243 Ga0070689_100014510
244 Ga0070689_100073707
245 Ga0070689_100980258
246 Ga0070675_100233046
247 Ga0070673_100185869
248 Ga0070673_100691914
249 Ga0070688_100015897
250 Ga0070688_100094066
251 Ga0070688_100119372
252 Ga0070701_10016024
253 Ga0070705_100172522
254 Ga0070705_100513261
255 Ga0070700_100032553
256 Ga0070700_100132118
257 Ga0070694_100053861
258 Ga0068867_100050633
259 Ga0070706_100029097
260 Ga0070698_100038416
261 Ga0070698_100194752
262 Ga0070697_100337976
263 Ga0070697_100352542
264 Ga0070686_100109198
265 Ga0070686_100507172
266 Ga0070695_100020652
267 Ga0070695_100091673
268 Ga0070696_100022133
269 Ga0070696_100564028
270 Ga0070704_100004573
271 Ga0070704_100352394
272 Ga0070704_100669762
273 Ga0068859_100054598
274 Ga0068859_100106259
275 Ga0068859_100776568
276 Ga0068859_101981228
277 Ga0068863_100033687
278 Ga0068863_100042249
279 Ga0068858_100837033
280 Ga0068860_100006182
281 Ga0075365_10928883
282 Ga0070716_100293255
283 Ga0070716_100726509
284 Ga0075428_100054118
285 Ga0075428_100134508
286 Ga0075428_100516516
287 Ga0075430_100437371
288 Ga0075430_100666086
289 Ga0075431_100020355
290 Ga0075431_100043681
291 Ga0075431_100076511
292 Ga0075431_100111710
293 Ga0075431_100870142
294 Ga0075433_10013374
295 Ga0075433_10081519
296 Ga0075433_10105869
297 Ga0075434_100002336
298 Ga0075434_100239954
299 Ga0075434_100835105
300 Ga0075429_100004593
301 Ga0075429_100017645
302 Ga0075429_100090422
303 Ga0075429_100714685
304 Ga0068865_100101108
305 Ga0068865_100195224
306 Ga0068865_100289826
307 Ga0075436_100020525
308 Ga0097620_100054599
309 Ga0097620_100106263
310 Ga0097620_100776675
311 Ga0075435_100202292
312 Ga0075435_100275038
313 Ga0075435_100459907
314 Ga0105240_10000035
315 Ga0111539_10086736
316 Ga0111539_10214039
317 Ga0111539_10269114
318 Ga0111539_10312500
319 Ga0111539_10776114
320 Ga0111539_11670315
321 Ga0111539_11978330
322 Ga0114129_10000112
323 Ga0114129_10005973
324 Ga0114129_10214307
325 Ga0114129_10949964
326 Ga0105248_10076159
327 Ga0105237_10000044
328 Ga0105237_10135120
329 Ga0105238_10067257
330 Ga0105238_10197588
331 Ga0105239_10024821
332 Ga0157378_10027629
333 Ga0157375_10081683
334 Ga0182008_10373512
335 Ga0157377_10360205
336 Ga0157376_11041214
337 Ga0213875_10117600
338 Ga0207695_10001002
339 Ga0207671_10000004
340 Ga0207671_10247001
341 Ga0207694_10191591
342 Ga0207694_10590002
343 Ga0207650_10025731
344 Ga0207706_10295632
345 Ga0207670_10179493
346 Ga0207704_10435753
347 Ga0207665_10765838
348 Ga0207711_10073112
349 Ga0207689_10102938
350 Ga0207689_10206686
351 Ga0207651_10246679
352 Ga0207651_10999342
353 Ga0207677_10139134
354 Ga0207703_10874711
355 Ga0207708_10024949
356 Ga0207708_10171816
357 Ga0207641_10031936
358 Ga0207641_10036751
359 Ga0207641_10093333
360 Ga0207648_10050476
361 Ga0209974_10159768
362 Ga0209974_10218558
363 Ga0207428_10007155
364 Ga0207428_10068508
365 Ga0207428_10177878
366 Ga0207428_10179797
367 Ga0207428_10417246
368 Ga0268265_10482129
369 Ga0268264_10018886
370 Ga0373934_0000212
371 Ga0373923_0410758
372 Ga0373953_0167137
373 Ga0373956_0074640
374 Ga0373957_0008566
375 Ga0373955_0000318
376 Ga0373933_0008261
377 Ga0373947_0358468
378 Ga0373937_0303719
379 Ga0436364_1069680
380 Ga0436365_1570262
381 Ga0451845_0664304
382 Ga0439455_0036367
383 Ga0453683_0078514
384 Ga0453683_0428458
385 Ga0453684_0065325
386 Ga0451576_0031501
387 Ga0451576_0090326
388 Ga0451576_0100708
389 Ga0495592_0149363
390 Ga0495592_0477002
391 Ga0495603_0147781
392 Ga0495651_0002960
393 Ga0495653_0469411
394 Ga0495608_0059272
395 Ga0495618_0034010
396 Ga0495628_0015442
397 Ga0495628_0037590
398 Ga0495587_0026636
399 Ga0495598_0245286
400 Ga0495667_0051667
401 Ga0495635_0184387
402 Ga0495588_0241513
403 Ga0495657_0189058
404 Ga0495599_0092379
405 Ga0495676_0043517
406 Ga0495680_0074431
407 Ga0495680_0304811
408 Ga0495675_0067249
409 Ga0496100_0019149
410 Ga0496101_0388618
411 Ga0496102_0007849
412 Ga0496102_0340356
413 Ga0496103_0020270
414 Ga0496104_0011908
415 Ga0496105_0036763
416 Ga0496106_0005482
417 Ga0496107_0097491
418 Ga0496108_0006558
419 Ga0496109_0002800
420 Ga0496110_0012160
421 Ga0496111_0041514
422 Ga0496112_0022700
423 Ga0496113_0010699
424 Ga0501042_0790955
425 Ga0501072_0030883
426 Ga0501074_0509144
427 Ga0501076_0017148
428 Ga0501081_0025859
429 Ga0501083_0386762
430 nmdc:mga05p37_152113_c1
431 nmdc:mga05p37_19471_c1
432 nmdc:mga05p37_5420_c1
433 nmdc:mga09592_136_c1
434 nmdc:mga09592_233477_c1
435 nmdc:mga09592_279349_c1
436 nmdc:mga09592_39405_c1
437 nmdc:mga09592_72132_c1
438 nmdc:mga0qj67_124137_c1
439 nmdc:mga0qj67_286919_c1
440 nmdc:mga0qj67_70648_c1
441 nmdc:mga06r32_311158_c1
442 nmdc:mga06r32_413616_c1
443 nmdc:mga06r32_661527_c1
444 nmdc:mga06r32_67441_c1
445 nmdc:mga06r32_88135_c1
446 nmdc:mga08y16_1711_c1
447 nmdc:mga08y16_219486_c1
448 nmdc:mga08y16_234715_c1
449 nmdc:mga08y16_386683_c1
450 nmdc:mga0n895_1090589_c1
451 nmdc:mga0n895_189_c1
452 nmdc:mga0n895_276450_c1
453 nmdc:mga0n895_588552_c1
454 nmdc:mga0rr50_215115_c1
455 nmdc:mga0rr50_226014_c1
456 nmdc:mga0rr50_382908_c1
457 nmdc:mga0rr50_496418_c1
458 nmdc:mga08x19_36841_c1
459 nmdc:mga0a205_2053_c1
460 nmdc:mga0a205_540878_c1
461 Ga0495601_0100618
462 Ga0495595_0055340
463 Ga0495619_0394224
464 Ga0501084_0469032
465 Ga0501084_0897497
466 Ga0501082_0542838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07847

PCO_ADO

PCO_ADO

97

194

0.85

PF05995

CDO_I

Cysteine dioxygenase type I

31

207

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fk2-assembly2.cif.gz_B crystal structure of the rhogap domain of human glucocorticoid receptor dna-binding factor 1 0.9666 13 37
4qma-assembly1.cif.gz_A crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076 0.8824 8 191
4wvz-assembly2.cif.gz_B crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa 0.8692 9 183
4tlf-assembly2.cif.gz_B crystal structure of thiol dioxygenase from pseudomonas aeruginosa 0.8554 9 183
3es1-assembly1.cif.gz_A-2 crystal structure of protein with a cupin-like fold and unknown function (yp_001165807.1) from novosphingobium aromaticivorans dsm 12444 at 1.91 a resolution 0.8409 73 165
ID Description Score Start End Superfamily
4qmaA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8766 48 191 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8674 60 164 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8564 68 165 2.60.120.10
4qmaA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8476 48 191 2.60.120.10
af_Q54K68_16_214_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8459 8 189 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A068NWD9-F1-model_v4 Cysteine dioxygenase 0.9549 14 191 GO:0008198
GO:0016702
AF-A0A2H0DR22-F1-model_v4 Cysteine dioxygenase 0.9446 7 191 GO:0008198
GO:0016702
AF-A0A068NWD9-F1-model_v4 Cysteine dioxygenase 0.9445 14 191 GO:0008198
GO:0016702
AF-A0A2V8GH77-F1-model_v4 Cysteine dioxygenase 0.9412 7 191 GO:0008198
GO:0016702
AF-A0A2R7NTG5-F1-model_v4 deleted 0.9382 11 191

Map