F346220

General Info

Members Datasets Scaffolds Average Seq Length
233 176 466 121

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100214456|Ga0307408_1002144565
Length 145
Sequence MTVMVEGQPQARLKIAYEEYVCEVDPMDDKVNLAEKLALLDAPFQPGIVGFLNDYKLAVVKAEGEFVWHKHDDTDDFFLVLSGRLTIQLRDRDVSLGQGEVFVVPRGVEHRPRADREAHVLLIEPRGTVNTGDAGGELTQPERVI

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
105 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
106 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
107 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
108 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
160 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
161 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
173 2919395869 Microbacterium resistens 2980 Isolate Unclassified
174 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
175 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
176 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.14
Metatranscriptomes 1.72
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 7.3
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 8.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100214456 3300031548 Bacteria 1567
2 JGI25407J50210_10000953 3300003373 Bacteria 6244
3 Ga0070683_100082572 3300005329 Bacteria 3009
4 Ga0070683_100267940 3300005329 Bacteria 1624
5 Ga0070670_101472491 3300005331 Bacteria 625
6 Ga0070691_10313105 3300005341 Unclassified 861
7 Ga0070661_100178284 3300005344 Bacteria 1616
8 Ga0070675_100093025 3300005354 Bacteria 2528
9 Ga0070674_100915315 3300005356 Unclassified 765
10 Ga0070703_10155460 3300005406 Bacteria 863
11 Ga0070705_100012077 3300005440 Bacteria 4378
12 Ga0070708_100095709 3300005445 Bacteria 2711
13 Ga0070706_101156981 3300005467 Bacteria 711
14 Ga0070707_100913694 3300005468 Bacteria 842
15 Ga0070698_100534945 3300005471 Bacteria 1111
16 Ga0070679_100026715 3300005530 Bacteria 5676
17 Ga0070679_100053592 3300005530 Bacteria 4015
18 Ga0070679_100137775 3300005530 Bacteria 2422
19 Ga0070684_100152424 3300005535 Bacteria 2094
20 Ga0070697_100468096 3300005536 Bacteria 1099
21 Ga0070672_100689617 3300005543 Bacteria 894
22 Ga0070695_101100685 3300005545 Bacteria 650
23 Ga0070696_100022744 3300005546 Bacteria 4260
24 Ga0070704_100042217 3300005549 Bacteria 3153
25 Ga0070664_100538830 3300005564 Bacteria 1079
26 Ga0070664_100937050 3300005564 Bacteria 813
27 Ga0068857_100284907 3300005577 Unclassified 1520
28 Ga0070702_100233317 3300005615 Bacteria 1238
29 Ga0068870_10793574 3300005840 Bacteria 661
30 Ga0081455_11015598 3300005937 Bacteria 513
31 Ga0081538_10000689 3300005981 Bacteria 37088
32 Ga0081538_10045494 3300005981 Bacteria 2720
33 Ga0075365_10265992 3300006038 Bacteria 1206
34 Ga0075365_11210532 3300006038 Bacteria 531
35 Ga0075368_10139978 3300006042 Bacteria 1008
36 Ga0075428_100001400 3300006844 Bacteria 25647
37 Ga0075428_100646020 3300006844 Archaea 1128
38 Ga0075431_100166665 3300006847 Bacteria 2264
39 Ga0075431_101170576 3300006847 Bacteria 732
40 Ga0099794_10002025 3300007265 Bacteria 7325
41 Ga0105240_10046676 3300009093 Bacteria 5487
42 Ga0111539_10713063 3300009094 Bacteria 1168
43 Ga0105245_10261515 3300009098 Bacteria 1684
44 Ga0114129_10004745 3300009147 Bacteria 19205
45 Ga0105243_12762071 3300009148 Bacteria 531
46 Ga0105248_12588903 3300009177 Bacteria 578
47 Ga0105238_12713844 3300009551 Bacteria 532
48 Ga0105249_11908854 3300009553 Bacteria 667
49 Ga0157371_10250039 3300013102 Unclassified 1276
50 Ga0157370_10018741 3300013104 Bacteria 6959
51 Ga0157369_10001670 3300013105 Bacteria 27062
52 Ga0157369_10730054 3300013105 Bacteria 1019
53 Ga0157369_12639760 3300013105 Bacteria 507
54 Ga0157372_10726373 3300013307 Bacteria 1155
55 Ga0157372_11735717 3300013307 Bacteria 718
56 Ga0157372_12125618 3300013307 Bacteria 645
57 Ga0157375_13395399 3300013308 Bacteria 530
58 Ga0157376_11042337 3300014969 Bacteria 842
59 Ga0197907_10421696 3300020069 Unclassified 691
60 Ga0206351_10909105 3300020077 Bacteria 967
61 Ga0206350_10257018 3300020080 Unclassified 541
62 Ga0213874_10232886 3300021377 Unclassified 673
63 Ga0224712_10038999 3300022467 Bacteria 1778
64 Ga0207655_1051634 3300025728 Bacteria 1660
65 Ga0207705_10403211 3300025909 Bacteria 1058
66 Ga0207684_10340664 3300025910 Bacteria 1291
67 Ga0207707_10508480 3300025912 Bacteria 1027
68 Ga0207660_10241032 3300025917 Bacteria 1424
69 Ga0207649_10666623 3300025920 Bacteria 805
70 Ga0207652_10037183 3300025921 Bacteria 4120
71 Ga0207646_10154847 3300025922 Bacteria 2067
72 Ga0207650_10487597 3300025925 Bacteria 1029
73 Ga0207659_10293014 3300025926 Bacteria 1334
74 Ga0207687_11284599 3300025927 Bacteria 629
75 Ga0207644_10439444 3300025931 Bacteria 1071
76 Ga0207669_10044796 3300025937 Bacteria 2603
77 Ga0207689_10352925 3300025942 Bacteria 1223
78 Ga0207661_10032197 3300025944 Bacteria 4059
79 Ga0207661_10226917 3300025944 Bacteria 1652
80 Ga0207661_10232126 3300025944 Bacteria 1634
81 Ga0207679_10396203 3300025945 Bacteria 1213
82 Ga0207679_10461794 3300025945 Bacteria 1128
83 Ga0207667_10213766 3300025949 Bacteria 1976
84 Ga0207640_10921284 3300025981 Bacteria 764
85 Ga0207708_10839837 3300026075 Unclassified 792
86 Ga0207648_11450988 3300026089 Unclassified 645
87 Ga0207674_10086563 3300026116 Bacteria 3128
88 Ga0209588_1066080 3300027671 Bacteria 1169
89 Ga0207428_10466599 3300027907 Bacteria 919
90 Ga0265319_1035142 3300028563 Bacteria 1720
91 Ga0265334_10092512 3300028573 Bacteria 1101
92 Ga0265338_10129547 3300028800 Bacteria 1995
93 Ga0265338_10778060 3300028800 Bacteria 657
94 Ga0265328_10248283 3300031239 Bacteria 681
95 Ga0265320_10048558 3300031240 Bacteria 2070
96 Ga0265325_10051846 3300031241 Bacteria 2108
97 Ga0265340_10065045 3300031247 Bacteria 1737
98 Ga0265339_10053159 3300031249 Bacteria 2204
99 Ga0265331_10174158 3300031250 Bacteria 973
100 Ga0265327_10000061 3300031251 Bacteria 234364
101 Ga0265316_10113690 3300031344 Bacteria 2048
102 Ga0307408_100938361 3300031548 Bacteria 794
103 Ga0307405_10310378 3300031731 Bacteria 1200
104 Ga0307413_10057246 3300031824 Bacteria 2383
105 Ga0307413_11013252 3300031824 Bacteria 712
106 Ga0307410_10126595 3300031852 Bacteria 1871
107 Ga0307410_11139398 3300031852 Unclassified 677
108 Ga0307410_11716341 3300031852 Bacteria 556
109 Ga0326468_10058565 3300031889 Bacteria 606
110 Ga0307406_10410169 3300031901 Bacteria 1076
111 Ga0307406_10665447 3300031901 Bacteria 866
112 Ga0307407_10422109 3300031903 Bacteria 961
113 Ga0307412_10081853 3300031911 Bacteria 2234
114 Ga0307412_10090180 3300031911 Bacteria 2142
115 Ga0307409_100067450 3300031995 Bacteria 2825
116 Ga0307409_100311411 3300031995 Bacteria 1469
117 Ga0307416_100192765 3300032002 Bacteria 1924
118 Ga0307414_10164192 3300032004 Bacteria 1768
119 Ga0307415_100450561 3300032126 Unclassified 1112
120 Ga0307415_100582670 3300032126 Bacteria 993
121 Ga0307415_101364587 3300032126 Bacteria 674
122 Ga0307415_101486197 3300032126 Bacteria 648
123 Ga0316583_10072573 3300032133 Bacteria 1204
124 Ga0395899_0422590 3300037312 Bacteria 878
125 Ga0395900_1373782 3300037418 Bacteria 619
126 Ga0395898_0578484 3300037466 Bacteria 1065
127 Ga0395898_0706621 3300037466 Bacteria 950
128 Ga0395901_0063617 3300038443 Bacteria 3840
129 Ga0395901_0105680 3300038443 Bacteria 2955
130 Ga0395901_0231668 3300038443 Bacteria 1928
131 Ga0436365_1857373 3300039437 Unclassified 537
132 Ga0436363_0004894 3300039450 Bacteria 5877
133 Ga0451791_0242072 3300041451 Bacteria 979
134 Ga0451793_0486454 3300041452 Bacteria 1113
135 Ga0451797_1052607 3300041453 Bacteria 539
136 Ga0451795_0144335 3300041456 Bacteria 719
137 Ga0451802_0459569 3300041460 Bacteria 683
138 Ga0451807_2023859 3300041486 Bacteria 1117
139 Ga0451837_1511324 3300041494 Bacteria 1117
140 Ga0451855_0507714 3300041511 Bacteria 1131
141 Ga0451853_1032007 3300041512 Bacteria 2844
142 Ga0451853_1583377 3300041512 Bacteria 1578
143 Ga0439440_0287527 3300042993 Unclassified 509
144 Ga0466969_0538168 3300044656 Bacteria 534
145 Ga0466961_0432341 3300044693 Bacteria 797
146 Ga0466961_0890558 3300044693 Unclassified 530
147 Ga0466963_0325590 3300044694 Bacteria 1082
148 Ga0466963_0406116 3300044694 Bacteria 961
149 Ga0466963_0589808 3300044694 Bacteria 785
150 Ga0466963_0679974 3300044694 Bacteria 726
151 Ga0466964_0018389 3300044706 Bacteria 2682
152 Ga0466964_0456720 3300044706 Bacteria 678
153 Ga0466971_0383346 3300044719 Bacteria 683
154 Ga0466968_0389607 3300044735 Bacteria 682
155 Ga0466957_0489178 3300044842 Bacteria 852
156 Ga0466960_0562333 3300044901 Bacteria 674
157 Ga0466959_0150710 3300045049 Bacteria 1639
158 Ga0466959_0835207 3300045049 Bacteria 615
159 Ga0466958_0086984 3300045836 Bacteria 1929
160 Ga0466958_0357737 3300045836 Bacteria 940
161 Ga0466958_0385201 3300045836 Bacteria 904
162 Ga0466967_0135954 3300045976 Bacteria 2286
163 Ga0466967_0321815 3300045976 Bacteria 1492
164 Ga0466967_0713354 3300045976 Bacteria 994
165 Ga0466967_1136361 3300045976 Bacteria 778
166 Ga0466967_1689829 3300045976 Bacteria 630
167 Ga0466967_1690830 3300045976 Bacteria 630
168 Ga0495627_000366 3300046453 Bacteria 42078
169 Ga0495592_0866240 3300046454 Bacteria 533
170 Ga0495638_0575116 3300046460 Bacteria 557
171 Ga0495596_0066384 3300046500 Bacteria 1403
172 Ga0495628_1242069 3300046516 Bacteria 504
173 Ga0495680_0114825 3300047322 Bacteria 1993
174 Ga0496100_0170514 3300048903 Bacteria 1567
175 Ga0496104_0200552 3300048907 Bacteria 1907
176 Ga0496104_1823529 3300048907 Bacteria 510
177 Ga0496105_0449675 3300048908 Bacteria 1017
178 Ga0496108_0167750 3300048911 Bacteria 1899
179 Ga0496109_0145432 3300048912 Bacteria 2218
180 Ga0496110_0090129 3300048913 Bacteria 2742
181 Ga0496112_0316088 3300048915 Bacteria 1506
182 Ga0496113_0257919 3300048916 Bacteria 1393
183 Ga0496115_0765411 3300048918 Bacteria 754
184 Ga0496115_1183468 3300048918 Bacteria 575
185 Ga0496126_0183820 3300048929 Bacteria 1774
186 Ga0501031_0469543 3300049568 Bacteria 812
187 Ga0501032_0031701 3300049569 Bacteria 3623
188 Ga0501033_1010580 3300049570 Bacteria 555
189 Ga0501034_0525043 3300049571 Bacteria 1095
190 Ga0501034_0562461 3300049571 Bacteria 1049
191 Ga0501034_0589942 3300049571 Bacteria 1017
192 Ga0501036_0010615 3300049572 Bacteria 7608
193 Ga0501038_0310999 3300049574 Bacteria 1234
194 Ga0501039_0046170 3300049575 Bacteria 3365
195 Ga0501041_0154790 3300049577 Bacteria 1432
196 Ga0501042_0381003 3300049578 Bacteria 1021
197 Ga0501043_0025851 3300049579 Bacteria 4605
198 Ga0501047_0410143 3300049581 Unclassified 1187
199 Ga0501047_0494819 3300049581 Bacteria 1049
200 Ga0501048_0016009 3300049582 Bacteria 5530
201 Ga0501048_0360617 3300049582 Bacteria 1037
202 Ga0501048_0931011 3300049582 Unclassified 625
203 Ga0501067_0383719 3300049583 Bacteria 783
204 Ga0501070_0437600 3300049586 Bacteria 1055
205 Ga0501072_0903661 3300049588 Bacteria 690
206 Ga0501072_1055625 3300049588 Bacteria 633
207 Ga0501072_1197539 3300049588 Unclassified 590
208 Ga0501074_0999601 3300049590 Bacteria 588
209 Ga0501075_0278497 3300049591 Unclassified 1275
210 Ga0501076_0976520 3300049592 Bacteria 698
211 Ga0501206_102273 3300049653 Bacteria 521
212 Ga0501247_049833 3300049677 Bacteria 619
213 Ga0501259_126639 3300049688 Bacteria 613
214 Ga0501079_0532106 3300049741 Bacteria 924
215 Ga0501080_0162078 3300049742 Bacteria 2065
216 Ga0501080_1176403 3300049742 Unclassified 660
217 Ga0501080_1724553 3300049742 Bacteria 528
218 Ga0501035_0057473 3300049822 Bacteria 3468
219 Ga0501044_0941124 3300049823 Bacteria 737
220 Ga0501044_1080079 3300049823 Bacteria 672
221 Ga0501045_0750479 3300049824 Bacteria 719
222 nmdc:mga0yw44_1121573_c1 3300050492 Bacteria 531
223 nmdc:mga05p37_5072_c1 3300050507 Bacteria 15436
224 nmdc:mga06r32_1162333_c1 3300050510 Bacteria 719
225 nmdc:mga06r32_277126_c1 3300050510 Bacteria 1664
226 nmdc:mga06r32_402941_c1 3300050510 Bacteria 1350
227 nmdc:mga08y16_569353_c1 3300050511 Bacteria 1145
228 Ga0530510_0001203 3300061734 Bacteria 17253
229 2812372337 2811994882 Bacteria 4688362
230 2919396380 2919395869 Bacteria 3704152
231 2945969695 2945968032 Bacteria 4111363
232 2974295117 2974294766 Bacteria 3767688
233 2974325080 2974324384 Bacteria 3750535
234 Ga0307408_100214456
235 JGI25407J50210_10000953
236 Ga0070683_100082572
237 Ga0070683_100267940
238 Ga0070670_101472491
239 Ga0070691_10313105
240 Ga0070661_100178284
241 Ga0070675_100093025
242 Ga0070674_100915315
243 Ga0070703_10155460
244 Ga0070705_100012077
245 Ga0070708_100095709
246 Ga0070706_101156981
247 Ga0070707_100913694
248 Ga0070698_100534945
249 Ga0070679_100026715
250 Ga0070679_100053592
251 Ga0070679_100137775
252 Ga0070684_100152424
253 Ga0070697_100468096
254 Ga0070672_100689617
255 Ga0070695_101100685
256 Ga0070696_100022744
257 Ga0070704_100042217
258 Ga0070664_100538830
259 Ga0070664_100937050
260 Ga0068857_100284907
261 Ga0070702_100233317
262 Ga0068870_10793574
263 Ga0081455_11015598
264 Ga0081538_10000689
265 Ga0081538_10045494
266 Ga0075365_10265992
267 Ga0075365_11210532
268 Ga0075368_10139978
269 Ga0075428_100001400
270 Ga0075428_100646020
271 Ga0075431_100166665
272 Ga0075431_101170576
273 Ga0099794_10002025
274 Ga0105240_10046676
275 Ga0111539_10713063
276 Ga0105245_10261515
277 Ga0114129_10004745
278 Ga0105243_12762071
279 Ga0105248_12588903
280 Ga0105238_12713844
281 Ga0105249_11908854
282 Ga0157371_10250039
283 Ga0157370_10018741
284 Ga0157369_10001670
285 Ga0157369_10730054
286 Ga0157369_12639760
287 Ga0157372_10726373
288 Ga0157372_11735717
289 Ga0157372_12125618
290 Ga0157375_13395399
291 Ga0157376_11042337
292 Ga0197907_10421696
293 Ga0206351_10909105
294 Ga0206350_10257018
295 Ga0213874_10232886
296 Ga0224712_10038999
297 Ga0207655_1051634
298 Ga0207705_10403211
299 Ga0207684_10340664
300 Ga0207707_10508480
301 Ga0207660_10241032
302 Ga0207649_10666623
303 Ga0207652_10037183
304 Ga0207646_10154847
305 Ga0207650_10487597
306 Ga0207659_10293014
307 Ga0207687_11284599
308 Ga0207644_10439444
309 Ga0207669_10044796
310 Ga0207689_10352925
311 Ga0207661_10032197
312 Ga0207661_10226917
313 Ga0207661_10232126
314 Ga0207679_10396203
315 Ga0207679_10461794
316 Ga0207667_10213766
317 Ga0207640_10921284
318 Ga0207708_10839837
319 Ga0207648_11450988
320 Ga0207674_10086563
321 Ga0209588_1066080
322 Ga0207428_10466599
323 Ga0265319_1035142
324 Ga0265334_10092512
325 Ga0265338_10129547
326 Ga0265338_10778060
327 Ga0265328_10248283
328 Ga0265320_10048558
329 Ga0265325_10051846
330 Ga0265340_10065045
331 Ga0265339_10053159
332 Ga0265331_10174158
333 Ga0265327_10000061
334 Ga0265316_10113690
335 Ga0307408_100938361
336 Ga0307405_10310378
337 Ga0307413_10057246
338 Ga0307413_11013252
339 Ga0307410_10126595
340 Ga0307410_11139398
341 Ga0307410_11716341
342 Ga0326468_10058565
343 Ga0307406_10410169
344 Ga0307406_10665447
345 Ga0307407_10422109
346 Ga0307412_10081853
347 Ga0307412_10090180
348 Ga0307409_100067450
349 Ga0307409_100311411
350 Ga0307416_100192765
351 Ga0307414_10164192
352 Ga0307415_100450561
353 Ga0307415_100582670
354 Ga0307415_101364587
355 Ga0307415_101486197
356 Ga0316583_10072573
357 Ga0395899_0422590
358 Ga0395900_1373782
359 Ga0395898_0578484
360 Ga0395898_0706621
361 Ga0395901_0063617
362 Ga0395901_0105680
363 Ga0395901_0231668
364 Ga0436365_1857373
365 Ga0436363_0004894
366 Ga0451791_0242072
367 Ga0451793_0486454
368 Ga0451797_1052607
369 Ga0451795_0144335
370 Ga0451802_0459569
371 Ga0451807_2023859
372 Ga0451837_1511324
373 Ga0451855_0507714
374 Ga0451853_1032007
375 Ga0451853_1583377
376 Ga0439440_0287527
377 Ga0466969_0538168
378 Ga0466961_0432341
379 Ga0466961_0890558
380 Ga0466963_0325590
381 Ga0466963_0406116
382 Ga0466963_0589808
383 Ga0466963_0679974
384 Ga0466964_0018389
385 Ga0466964_0456720
386 Ga0466971_0383346
387 Ga0466968_0389607
388 Ga0466957_0489178
389 Ga0466960_0562333
390 Ga0466959_0150710
391 Ga0466959_0835207
392 Ga0466958_0086984
393 Ga0466958_0357737
394 Ga0466958_0385201
395 Ga0466967_0135954
396 Ga0466967_0321815
397 Ga0466967_0713354
398 Ga0466967_1136361
399 Ga0466967_1689829
400 Ga0466967_1690830
401 Ga0495627_000366
402 Ga0495592_0866240
403 Ga0495638_0575116
404 Ga0495596_0066384
405 Ga0495628_1242069
406 Ga0495680_0114825
407 Ga0496100_0170514
408 Ga0496104_0200552
409 Ga0496104_1823529
410 Ga0496105_0449675
411 Ga0496108_0167750
412 Ga0496109_0145432
413 Ga0496110_0090129
414 Ga0496112_0316088
415 Ga0496113_0257919
416 Ga0496115_0765411
417 Ga0496115_1183468
418 Ga0496126_0183820
419 Ga0501031_0469543
420 Ga0501032_0031701
421 Ga0501033_1010580
422 Ga0501034_0525043
423 Ga0501034_0562461
424 Ga0501034_0589942
425 Ga0501036_0010615
426 Ga0501038_0310999
427 Ga0501039_0046170
428 Ga0501041_0154790
429 Ga0501042_0381003
430 Ga0501043_0025851
431 Ga0501047_0410143
432 Ga0501047_0494819
433 Ga0501048_0016009
434 Ga0501048_0360617
435 Ga0501048_0931011
436 Ga0501067_0383719
437 Ga0501070_0437600
438 Ga0501072_0903661
439 Ga0501072_1055625
440 Ga0501072_1197539
441 Ga0501074_0999601
442 Ga0501075_0278497
443 Ga0501076_0976520
444 Ga0501206_102273
445 Ga0501247_049833
446 Ga0501259_126639
447 Ga0501079_0532106
448 Ga0501080_0162078
449 Ga0501080_1176403
450 Ga0501080_1724553
451 Ga0501035_0057473
452 Ga0501044_0941124
453 Ga0501044_1080079
454 Ga0501045_0750479
455 nmdc:mga0yw44_1121573_c1
456 nmdc:mga05p37_5072_c1
457 nmdc:mga06r32_1162333_c1
458 nmdc:mga06r32_277126_c1
459 nmdc:mga06r32_402941_c1
460 nmdc:mga08y16_569353_c1
461 Ga0530510_0001203
462 2812372337
463 2919396380
464 2945969695
465 2974295117
466 2974325080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

56

124

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9906 5 97
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.9048 3 96
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.902 28 93
8e8w-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.901 28 93
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.9 28 93
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9144 1 97 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9052 1 97 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8918 27 93 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8913 27 93 2.60.120.10
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8894 17 93 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2D5N4Q3-F1-model_v4 Mannose-6-phosphate isomerase 0.9932 3 96 GO:0016853
AF-A0A520N3S9-F1-model_v4 Cupin domain-containing protein 0.9894 3 92
AF-A0A0M2VRC7-F1-model_v4 deleted 0.9879 1 98
AF-A0A537BVB2-F1-model_v4 Cupin domain-containing protein 0.9871 6 91
AF-A0A1W9RU29-F1-model_v4 Cupin type-2 domain-containing protein 0.9854 3 96

Map