F346183

General Info

Members Datasets Scaffolds Average Seq Length
233 184 466 283

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10266771|Ga0207708_102667711
Length 313
Sequence MPEQQRPPQQQTRQPGIESEMTPRPKVENREHHGTGKLNGKVALITGGDSGIGRGVAVAFAREGADLAIAYLDEHKDAEETQRMVEQEGRRCILIPGDVGSHAHCLHAVRTVLNELGQLDVLVNNAAQQEPQDSLENITPAQLERTFRTNIFSYFFMAQAALPHLGEGANIINTTSVTAYKGSPQLLDYSSTKGAIVSFTRPLALSLSEKKIRVNAVAPGPVWTPLIPSTFPPEKVATFGSDVPMKRAGQPEEIAPCYVFLATQDSSYMTGQVLHPNGGTVSPRGSSPAPWRRRRPRSHRSRWGSTTSGTPRW

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
55 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
56 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
57 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
64 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
65 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
66 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
67 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
68 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
69 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
70 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
71 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
72 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
73 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
74 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
75 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
76 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
100 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
101 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
102 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
103 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
104 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
105 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
106 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
107 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
108 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
109 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
110 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
111 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
112 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
113 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
114 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
115 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
116 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
117 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
118 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
119 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
120 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
121 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
122 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
123 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
124 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
125 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
126 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
132 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
133 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
134 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
135 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
136 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
137 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
138 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
139 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
140 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
141 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
142 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
143 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
144 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
145 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
146 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
147 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
148 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
153 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
180 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
181 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
182 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
183 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
184 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.98
Metatranscriptomes 9.44
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.86
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10266771 3300026075 Bacteria 1383
2 Ga0058862_10190687 3300004803 Bacteria 2166
3 Ga0070676_10000309 3300005328 Bacteria 21999
4 Ga0070661_100264628 3300005344 Bacteria 1330
5 Ga0070714_100000025 3300005435 Bacteria 147717
6 Ga0070714_100047160 3300005435 Bacteria 3659
7 Ga0070705_100027200 3300005440 Bacteria 3121
8 Ga0068867_100001736 3300005459 Bacteria 15181
9 Ga0070698_100051945 3300005471 Bacteria 4173
10 Ga0070699_100454545 3300005518 Bacteria 1161
11 Ga0070695_100011034 3300005545 Bacteria 5401
12 Ga0070696_100000606 3300005546 Bacteria 23003
13 Ga0068857_100095697 3300005577 Unclassified 2661
14 Ga0068857_100112475 3300005577 Bacteria 2448
15 Ga0081455_10002597 3300005937 Bacteria 21425
16 Ga0081455_10388774 3300005937 Bacteria 972
17 Ga0081538_10017204 3300005981 Bacteria 5500
18 Ga0081538_10072185 3300005981 Bacteria 1894
19 Ga0070716_100094003 3300006173 Bacteria 1821
20 Ga0075430_100123209 3300006846 Bacteria 2161
21 Ga0075436_100091377 3300006914 Bacteria 2116
22 Ga0105247_10124990 3300009101 Bacteria 1671
23 Ga0114129_10503159 3300009147 Bacteria 1582
24 Ga0105242_10261781 3300009176 Bacteria 1563
25 Ga0105248_10093591 3300009177 Bacteria 3385
26 Ga0105249_10191865 3300009553 Bacteria 1994
27 Ga0105246_10383826 3300011119 Unclassified 1162
28 Ga0157370_10065140 3300013104 Bacteria 3448
29 Ga0157372_10180682 3300013307 Bacteria 2442
30 Ga0157375_10092100 3300013308 Bacteria 3094
31 Ga0206356_10034891 3300020070 Bacteria 2294
32 Ga0206351_10766389 3300020077 Bacteria 979
33 Ga0206350_10692148 3300020080 Bacteria 1196
34 Ga0213874_10039293 3300021377 Bacteria 1409
35 Ga0213876_10151465 3300021384 Bacteria 1233
36 Ga0224712_10028522 3300022467 Bacteria 1996
37 Ga0224712_10194547 3300022467 Bacteria 919
38 Ga0207652_10327362 3300025921 Bacteria 1383
39 Ga0207659_10064751 3300025926 Bacteria 2647
40 Ga0207664_10000071 3300025929 Bacteria 105708
41 Ga0207664_10060304 3300025929 Bacteria 3023
42 Ga0207669_10056874 3300025937 Bacteria 2378
43 Ga0207665_10124184 3300025939 Bacteria 1826
44 Ga0207712_10200125 3300025961 Bacteria 1583
45 Ga0207648_10063184 3300026089 Bacteria 3228
46 Ga0207676_10416032 3300026095 Bacteria 1260
47 Ga0207674_10123801 3300026116 Bacteria 2551
48 Ga0207698_10441466 3300026142 Bacteria 1254
49 Ga0307513_10008767 3300031456 Bacteria 12882
50 Ga0307513_10313160 3300031456 Bacteria 1331
51 Ga0307408_100000363 3300031548 Bacteria 42043
52 Ga0307408_100003544 3300031548 Bacteria 10629
53 Ga0307408_100281002 3300031548 Bacteria 1386
54 Ga0307405_10034554 3300031731 Bacteria 3009
55 Ga0307410_10083962 3300031852 Bacteria 2244
56 Ga0307406_10530506 3300031901 Bacteria 960
57 Ga0307412_10026847 3300031911 Bacteria 3584
58 Ga0307409_100115256 3300031995 Bacteria 2262
59 Ga0307416_100197010 3300032002 Bacteria 1906
60 Ga0307415_100059271 3300032126 Bacteria 2639
61 Ga0436364_1467371 3300037853 Bacteria 1568
62 Ga0436365_0180776 3300039437 Bacteria 1234
63 Ga0436363_0362686 3300039450 Bacteria 1679
64 Ga0439452_025478 3300042010 Bacteria 1501
65 Ga0439434_0018428 3300042435 Bacteria 2090
66 Ga0439460_0020922 3300042461 Bacteria 1783
67 Ga0439460_0033283 3300042461 Bacteria 1480
68 Ga0453683_0024748 3300044673 Bacteria 3817
69 Ga0466963_0098580 3300044694 Bacteria 1998
70 Ga0453684_0231045 3300044712 Bacteria 2135
71 Ga0451576_0000146 3300045051 Bacteria 179707
72 Ga0451576_0007741 3300045051 Bacteria 12758
73 Ga0451576_0062682 3300045051 Bacteria 3875
74 Ga0466967_0068391 3300045976 Bacteria 3171
75 Ga0495633_0119307 3300046558 Unclassified 1222
76 Ga0501290_002284 3300049513 Bacteria 2485
77 Ga0501291_000169 3300049514 Bacteria 8086
78 Ga0501292_000166 3300049515 Bacteria 10765
79 Ga0501293_002063 3300049516 Bacteria 1520
80 Ga0501294_000110 3300049517 Bacteria 9279
81 Ga0501296_000031 3300049519 Bacteria 16205
82 Ga0501297_000032 3300049520 Bacteria 13827
83 Ga0501298_000169 3300049521 Bacteria 8069
84 Ga0501299_003026 3300049522 Bacteria 2394
85 Ga0501300_000040 3300049523 Bacteria 18858
86 Ga0501301_000518 3300049524 Bacteria 2361
87 Ga0501302_000535 3300049525 Bacteria 2019
88 Ga0501303_000328 3300049526 Bacteria 3870
89 Ga0501031_0004582 3300049568 Bacteria 8965
90 Ga0501031_0006076 3300049568 Bacteria 7884
91 Ga0501032_0059136 3300049569 Bacteria 2573
92 Ga0501033_0040135 3300049570 Bacteria 3495
93 Ga0501034_0001158 3300049571 Bacteria 36552
94 Ga0501034_0234560 3300049571 Bacteria 1783
95 Ga0501036_0085323 3300049572 Unclassified 2669
96 Ga0501036_0163283 3300049572 Bacteria 1878
97 Ga0501037_0001365 3300049573 Bacteria 17925
98 Ga0501037_0090552 3300049573 Bacteria 2212
99 Ga0501038_0000702 3300049574 Bacteria 29863
100 Ga0501038_0078966 3300049574 Bacteria 2776
101 Ga0501038_0182812 3300049574 Bacteria 1691
102 Ga0501039_0006864 3300049575 Bacteria 8660
103 Ga0501039_0012808 3300049575 Bacteria 6410
104 Ga0501039_0221670 3300049575 Bacteria 1487
105 Ga0501040_0035037 3300049576 Unclassified 3402
106 Ga0501040_0094402 3300049576 Bacteria 2081
107 Ga0501040_0346205 3300049576 Bacteria 1064
108 Ga0501040_0445029 3300049576 Bacteria 932
109 Ga0501041_0040625 3300049577 Bacteria 2824
110 Ga0501041_0194542 3300049577 Bacteria 1270
111 Ga0501042_0018238 3300049578 Bacteria 4857
112 Ga0501042_0054663 3300049578 Unclassified 2848
113 Ga0501042_0106379 3300049578 Bacteria 2019
114 Ga0501043_0104912 3300049579 Bacteria 2221
115 Ga0501046_0000081 3300049580 Bacteria 101779
116 Ga0501046_0001242 3300049580 Bacteria 24678
117 Ga0501046_0031559 3300049580 Bacteria 4293
118 Ga0501046_0041133 3300049580 Bacteria 3690
119 Ga0501047_0009149 3300049581 Bacteria 9351
120 Ga0501048_0005627 3300049582 Bacteria 9530
121 Ga0501048_0229455 3300049582 Bacteria 1317
122 Ga0501048_0313947 3300049582 Bacteria 1116
123 Ga0501068_0013382 3300049584 Bacteria 4668
124 Ga0501068_0273280 3300049584 Bacteria 1079
125 Ga0501069_0087533 3300049585 Bacteria 1760
126 Ga0501070_0387790 3300049586 Bacteria 1131
127 Ga0501072_0010119 3300049588 Bacteria 7178
128 Ga0501072_0089963 3300049588 Unclassified 2437
129 Ga0501075_0046240 3300049591 Bacteria 3269
130 Ga0501076_0008875 3300049592 Bacteria 7394
131 Ga0501077_0050785 3300049593 Unclassified 2636
132 Ga0501199_000446 3300049650 Bacteria 3667
133 Ga0501201_000054 3300049651 Bacteria 8006
134 Ga0501202_001906 3300049652 Bacteria 3427
135 Ga0501206_003544 3300049653 Bacteria 1985
136 Ga0501207_001943 3300049654 Bacteria 2637
137 Ga0501210_001689 3300049657 Bacteria 1294
138 Ga0501211_001275 3300049658 Bacteria 2695
139 Ga0501216_000116 3300049660 Bacteria 7803
140 Ga0501217_006662 3300049661 Bacteria 2461
141 Ga0501227_004595 3300049665 Bacteria 2965
142 Ga0501233_000500 3300049668 Bacteria 6282
143 Ga0501235_000149 3300049669 Bacteria 11925
144 Ga0501236_001370 3300049670 Bacteria 2767
145 Ga0501239_000416 3300049672 Bacteria 3234
146 Ga0501243_001702 3300049675 Bacteria 3175
147 Ga0501248_000390 3300049678 Bacteria 2316
148 Ga0501251_001902 3300049681 Bacteria 1979
149 Ga0501253_000041 3300049683 Bacteria 8443
150 Ga0501255_000461 3300049684 Bacteria 2778
151 Ga0501257_001184 3300049686 Bacteria 5344
152 Ga0501257_010124 3300049686 Bacteria 2135
153 Ga0501258_000121 3300049687 Bacteria 4302
154 Ga0501260_000169 3300049689 Bacteria 4985
155 Ga0501261_001842 3300049690 Bacteria 2610
156 Ga0501221_002400 3300049704 Bacteria 3095
157 Ga0501225_0001267 3300049705 Bacteria 7842
158 Ga0501229_000885 3300049706 Bacteria 3389
159 Ga0501234_002294 3300049707 Bacteria 3019
160 Ga0501245_000709 3300049708 Bacteria 4113
161 Ga0501079_0065868 3300049741 Unclassified 2795
162 Ga0501079_0332882 3300049741 Bacteria 1189
163 Ga0501080_0157797 3300049742 Bacteria 2096
164 Ga0501081_0006789 3300049743 Bacteria 7444
165 Ga0501081_0218202 3300049743 Bacteria 1387
166 Ga0501083_0000037 3300049744 Bacteria 95622
167 Ga0501083_0063442 3300049744 Bacteria 2464
168 Ga0501241_003614 3300049758 Bacteria 2916
169 Ga0501262_008598 3300049759 Bacteria 1252
170 Ga0501264_001766 3300049761 Bacteria 2178
171 Ga0501265_004300 3300049762 Bacteria 1621
172 Ga0501266_001799 3300049763 Bacteria 2715
173 Ga0501269_002157 3300049766 Bacteria 2459
174 Ga0501270_000034 3300049767 Bacteria 10462
175 Ga0501271_000041 3300049768 Bacteria 9033
176 Ga0501273_002849 3300049770 Bacteria 1794
177 Ga0501274_000243 3300049771 Bacteria 3609
178 Ga0501275_001226 3300049772 Bacteria 2582
179 Ga0501276_001594 3300049773 Bacteria 1547
180 Ga0501278_000199 3300049774 Bacteria 4738
181 Ga0501279_001087 3300049775 Bacteria 3591
182 Ga0501280_002725 3300049776 Bacteria 2868
183 Ga0501281_00252 3300049777 Bacteria 5728
184 Ga0501282_006175 3300049778 Bacteria 1281
185 Ga0501283_000040 3300049779 Bacteria 15569
186 Ga0501035_0010524 3300049822 Bacteria 8572
187 Ga0501035_0164474 3300049822 Bacteria 1919
188 Ga0501044_0046077 3300049823 Bacteria 4516
189 Ga0501044_0263788 3300049823 Bacteria 1660
190 Ga0501044_0433726 3300049823 Bacteria 1223
191 Ga0501045_0044683 3300049824 Unclassified 3227
192 Ga0501045_0222244 3300049824 Bacteria 1406
193 Ga0501045_0482860 3300049824 Bacteria 921
194 Ga0501204_000661 3300049850 Bacteria 3104
195 Ga0501212_002939 3300049851 Bacteria 2095
196 nmdc:mga0qj67_19241_c1 3300050509 Bacteria 5215
197 nmdc:mga0qj67_347100_c1 3300050509 Bacteria 1200
198 nmdc:mga06r32_612314_c1 3300050510 Bacteria 1059
199 nmdc:mga08y16_64108_c1 3300050511 Bacteria 3838
200 nmdc:mga0n895_16463_c1 3300050512 Bacteria 6786
201 nmdc:mga0rr50_189158_c1 3300050513 Bacteria 1686
202 nmdc:mga0rr50_19425_c1 3300050513 Bacteria 4587
203 nmdc:mga08x19_122997_c1 3300050514 Bacteria 1741
204 nmdc:mga0a205_11953_c1 3300050515 Bacteria 8017
205 Ga0501084_0036219 3300054114 Unclassified 4122
206 Ga0590071_009303 3300059421 Bacteria 2306
207 Ga0587066_000835 3300059490 Bacteria 2809
208 Ga0587073_0001455 3300059492 Bacteria 2763
209 Ga0587080_001001 3300059503 Bacteria 2842
210 Ga0587082_000971 3300059504 Bacteria 2754
211 Ga0587082_002758 3300059504 Bacteria 2030
212 Ga0587083_0004988 3300059505 Bacteria 1888
213 Ga0587083_0011052 3300059505 Bacteria 1480
214 Ga0587085_002581 3300059506 Bacteria 1863
215 Ga0587090_014143 3300059510 Bacteria 1163
216 Ga0587091_000991 3300059511 Bacteria 2859
217 Ga0587092_003343 3300059512 Bacteria 1816
218 Ga0587128_000607 3300059630 Bacteria 2817
219 Ga0587069_002915 3300059642 Bacteria 1791
220 Ga0587072_001683 3300059643 Bacteria 2816
221 Ga0587071_016243 3300060344 Bacteria 1316
222 Ga0587111_0002543 3300060346 Bacteria 2453
223 Ga0501082_0012955 3300060353 Bacteria 7168
224 Ga0501082_0249320 3300060353 Bacteria 1545
225 Ga0501082_0293468 3300060353 Bacteria 1416
226 Ga0530510_0013648 3300061734 Bacteria 5716
227 Ga0530510_0108695 3300061734 Bacteria 2030
228 2587742076 2585428059 Bacteria 8696589
229 2857453977 2857453340 Bacteria 8090534
230 2971416926 2971410472 Bacteria 8311090
231 2984528689 2984527788 Bacteria 5288478
232 2984534791 2984532647 Bacteria 5288506
233 8056533921 8056533031 Bacteria 8964429
234 Ga0207708_10266771
235 Ga0058862_10190687
236 Ga0070676_10000309
237 Ga0070661_100264628
238 Ga0070714_100000025
239 Ga0070714_100047160
240 Ga0070705_100027200
241 Ga0068867_100001736
242 Ga0070698_100051945
243 Ga0070699_100454545
244 Ga0070695_100011034
245 Ga0070696_100000606
246 Ga0068857_100095697
247 Ga0068857_100112475
248 Ga0081455_10002597
249 Ga0081455_10388774
250 Ga0081538_10017204
251 Ga0081538_10072185
252 Ga0070716_100094003
253 Ga0075430_100123209
254 Ga0075436_100091377
255 Ga0105247_10124990
256 Ga0114129_10503159
257 Ga0105242_10261781
258 Ga0105248_10093591
259 Ga0105249_10191865
260 Ga0105246_10383826
261 Ga0157370_10065140
262 Ga0157372_10180682
263 Ga0157375_10092100
264 Ga0206356_10034891
265 Ga0206351_10766389
266 Ga0206350_10692148
267 Ga0213874_10039293
268 Ga0213876_10151465
269 Ga0224712_10028522
270 Ga0224712_10194547
271 Ga0207652_10327362
272 Ga0207659_10064751
273 Ga0207664_10000071
274 Ga0207664_10060304
275 Ga0207669_10056874
276 Ga0207665_10124184
277 Ga0207712_10200125
278 Ga0207648_10063184
279 Ga0207676_10416032
280 Ga0207674_10123801
281 Ga0207698_10441466
282 Ga0307513_10008767
283 Ga0307513_10313160
284 Ga0307408_100000363
285 Ga0307408_100003544
286 Ga0307408_100281002
287 Ga0307405_10034554
288 Ga0307410_10083962
289 Ga0307406_10530506
290 Ga0307412_10026847
291 Ga0307409_100115256
292 Ga0307416_100197010
293 Ga0307415_100059271
294 Ga0436364_1467371
295 Ga0436365_0180776
296 Ga0436363_0362686
297 Ga0439452_025478
298 Ga0439434_0018428
299 Ga0439460_0020922
300 Ga0439460_0033283
301 Ga0453683_0024748
302 Ga0466963_0098580
303 Ga0453684_0231045
304 Ga0451576_0000146
305 Ga0451576_0007741
306 Ga0451576_0062682
307 Ga0466967_0068391
308 Ga0495633_0119307
309 Ga0501290_002284
310 Ga0501291_000169
311 Ga0501292_000166
312 Ga0501293_002063
313 Ga0501294_000110
314 Ga0501296_000031
315 Ga0501297_000032
316 Ga0501298_000169
317 Ga0501299_003026
318 Ga0501300_000040
319 Ga0501301_000518
320 Ga0501302_000535
321 Ga0501303_000328
322 Ga0501031_0004582
323 Ga0501031_0006076
324 Ga0501032_0059136
325 Ga0501033_0040135
326 Ga0501034_0001158
327 Ga0501034_0234560
328 Ga0501036_0085323
329 Ga0501036_0163283
330 Ga0501037_0001365
331 Ga0501037_0090552
332 Ga0501038_0000702
333 Ga0501038_0078966
334 Ga0501038_0182812
335 Ga0501039_0006864
336 Ga0501039_0012808
337 Ga0501039_0221670
338 Ga0501040_0035037
339 Ga0501040_0094402
340 Ga0501040_0346205
341 Ga0501040_0445029
342 Ga0501041_0040625
343 Ga0501041_0194542
344 Ga0501042_0018238
345 Ga0501042_0054663
346 Ga0501042_0106379
347 Ga0501043_0104912
348 Ga0501046_0000081
349 Ga0501046_0001242
350 Ga0501046_0031559
351 Ga0501046_0041133
352 Ga0501047_0009149
353 Ga0501048_0005627
354 Ga0501048_0229455
355 Ga0501048_0313947
356 Ga0501068_0013382
357 Ga0501068_0273280
358 Ga0501069_0087533
359 Ga0501070_0387790
360 Ga0501072_0010119
361 Ga0501072_0089963
362 Ga0501075_0046240
363 Ga0501076_0008875
364 Ga0501077_0050785
365 Ga0501199_000446
366 Ga0501201_000054
367 Ga0501202_001906
368 Ga0501206_003544
369 Ga0501207_001943
370 Ga0501210_001689
371 Ga0501211_001275
372 Ga0501216_000116
373 Ga0501217_006662
374 Ga0501227_004595
375 Ga0501233_000500
376 Ga0501235_000149
377 Ga0501236_001370
378 Ga0501239_000416
379 Ga0501243_001702
380 Ga0501248_000390
381 Ga0501251_001902
382 Ga0501253_000041
383 Ga0501255_000461
384 Ga0501257_001184
385 Ga0501257_010124
386 Ga0501258_000121
387 Ga0501260_000169
388 Ga0501261_001842
389 Ga0501221_002400
390 Ga0501225_0001267
391 Ga0501229_000885
392 Ga0501234_002294
393 Ga0501245_000709
394 Ga0501079_0065868
395 Ga0501079_0332882
396 Ga0501080_0157797
397 Ga0501081_0006789
398 Ga0501081_0218202
399 Ga0501083_0000037
400 Ga0501083_0063442
401 Ga0501241_003614
402 Ga0501262_008598
403 Ga0501264_001766
404 Ga0501265_004300
405 Ga0501266_001799
406 Ga0501269_002157
407 Ga0501270_000034
408 Ga0501271_000041
409 Ga0501273_002849
410 Ga0501274_000243
411 Ga0501275_001226
412 Ga0501276_001594
413 Ga0501278_000199
414 Ga0501279_001087
415 Ga0501280_002725
416 Ga0501281_00252
417 Ga0501282_006175
418 Ga0501283_000040
419 Ga0501035_0010524
420 Ga0501035_0164474
421 Ga0501044_0046077
422 Ga0501044_0263788
423 Ga0501044_0433726
424 Ga0501045_0044683
425 Ga0501045_0222244
426 Ga0501045_0482860
427 Ga0501204_000661
428 Ga0501212_002939
429 nmdc:mga0qj67_19241_c1
430 nmdc:mga0qj67_347100_c1
431 nmdc:mga06r32_612314_c1
432 nmdc:mga08y16_64108_c1
433 nmdc:mga0n895_16463_c1
434 nmdc:mga0rr50_189158_c1
435 nmdc:mga0rr50_19425_c1
436 nmdc:mga08x19_122997_c1
437 nmdc:mga0a205_11953_c1
438 Ga0501084_0036219
439 Ga0590071_009303
440 Ga0587066_000835
441 Ga0587073_0001455
442 Ga0587080_001001
443 Ga0587082_000971
444 Ga0587082_002758
445 Ga0587083_0004988
446 Ga0587083_0011052
447 Ga0587085_002581
448 Ga0587090_014143
449 Ga0587091_000991
450 Ga0587092_003343
451 Ga0587128_000607
452 Ga0587069_002915
453 Ga0587072_001683
454 Ga0587071_016243
455 Ga0587111_0002543
456 Ga0501082_0012955
457 Ga0501082_0249320
458 Ga0501082_0293468
459 Ga0530510_0013648
460 Ga0530510_0108695
461 2587742076
462 2857453977
463 2971416926
464 2984528689
465 2984534791
466 8056533921

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

281

0.96

PF00106

adh_short

short chain dehydrogenase

41

235

0.95

PF08659

KR

KR domain

41

221

0.86

PF23441

35

281

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i3o-assembly1.cif.gz_A 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone 0.9861 7 284
3i3o-assembly2.cif.gz_H 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone 0.9856 11 284
3i3o-assembly2.cif.gz_G 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone 0.9833 23 284
3i3o-assembly2.cif.gz_G 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone 0.9793 23 284
3i3o-assembly2.cif.gz_H 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone 0.9784 11 284
ID Description Score Start End Superfamily
3i3oG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9833 23 284 3.40.50.720
3i3oG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9793 23 284 3.40.50.720
af_K7KGR3_30_220_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9752 102 283 3.40.50.720
3r3sA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9697 5 279 3.40.50.720
af_Q75KH3_1_297_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9685 1 281 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V5KU70-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9964 7 169 GO:0016614
AF-A0A358RU90-F1-model_v4 deleted 0.9959 7 176
AF-A0A353T4W6-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9931 7 163 GO:0016614
AF-A0A4Q3VP98-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9918 21 229 GO:0016614
AF-A0A442HW49-F1-model_v4 SDR family oxidoreductase 0.9911 32 226 GO:0016614

Map