F346167

General Info

Members Datasets Scaffolds Average Seq Length
233 146 466 281

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10125328|Ga0207700_101253282
Length 313
Sequence VQIADSARHSTSYKQTGIIPLMAANAQMDIPEAEIAKSAAEKLVVLEARLRQMGRLMVAYSGGVDSAFLAATAHRVLGDQMLAVLADSASLARRDLEQAYDFALTHGIPLQVVATEELDNPEYAKNDANRCFHCKDELFTTMKLLGEKLEFSAIAYGMNADDTRDYRPGQRAAQQHEVLAPIAEAGLTKAEVRVLCKTAGYSLWDRPAAPCLSSRVEYGRKVTREVLEQVENAEESMRQLGFREFRVRHHGELARVEIARNELPRALTMEMLDAITAALKHAGYQYVTLDTAGFRSGSLNAILPVDVLARRGA

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0
Rhizosphere 95.71
Stem 0
Stem Tuber 0
Unclassified 18.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10125328 3300025928 Bacteria 2089
2 LJNas_1006952 3300000546 Bacteria 1225
3 rootH1_10243680 3300003323 Bacteria 2131
4 Ga0070658_10000004 3300005327 Bacteria 402230
5 Ga0070658_10003753 3300005327 Bacteria 12431
6 Ga0070658_10151558 3300005327 Bacteria 1941
7 Ga0070658_10173320 3300005327 Unclassified 1813
8 Ga0070666_10037710 3300005335 Bacteria 3215
9 Ga0070666_10136527 3300005335 Bacteria 1706
10 Ga0070680_100031588 3300005336 Bacteria 4259
11 Ga0068868_100003995 3300005338 Bacteria 10292
12 Ga0068868_100143165 3300005338 Bacteria 1964
13 Ga0070660_100005235 3300005339 Bacteria 8972
14 Ga0070671_100001552 3300005355 Bacteria 17296
15 Ga0070671_100255084 3300005355 Unclassified 1490
16 Ga0070659_100009323 3300005366 Bacteria 7209
17 Ga0070659_100126152 3300005366 Unclassified 2076
18 Ga0070667_100043809 3300005367 Bacteria 3757
19 Ga0070714_100086408 3300005435 Bacteria 2741
20 Ga0070714_100088280 3300005435 Unclassified 2713
21 Ga0070714_100148933 3300005435 Bacteria 2107
22 Ga0070714_100228864 3300005435 Unclassified 1712
23 Ga0070713_100057169 3300005436 Bacteria 3247
24 Ga0070713_100154055 3300005436 Unclassified 2047
25 Ga0070713_100507683 3300005436 Bacteria 1138
26 Ga0070663_100190151 3300005455 Unclassified 1597
27 Ga0070678_100153594 3300005456 Bacteria 1857
28 Ga0070681_10006476 3300005458 Bacteria 11399
29 Ga0070681_10061641 3300005458 Unclassified 3724
30 Ga0070681_10338064 3300005458 Bacteria 1415
31 Ga0070707_100339453 3300005468 Bacteria 1459
32 Ga0070698_100152273 3300005471 Unclassified 2260
33 Ga0070699_100070999 3300005518 Bacteria 3027
34 Ga0070699_100564259 3300005518 Unclassified 1037
35 Ga0070679_100013019 3300005530 Bacteria 7966
36 Ga0070679_100067996 3300005530 Unclassified 3554
37 Ga0070684_100510817 3300005535 Bacteria 1113
38 Ga0068853_100021558 3300005539 Bacteria 5374
39 Ga0070693_100057569 3300005547 Bacteria 2247
40 Ga0070665_100005245 3300005548 Bacteria 13400
41 Ga0070665_100137083 3300005548 Bacteria 2450
42 Ga0068855_100101457 3300005563 Unclassified 3313
43 Ga0068855_100120106 3300005563 Bacteria 3008
44 Ga0068855_100209334 3300005563 Bacteria 2192
45 Ga0068857_100036255 3300005577 Bacteria 4370
46 Ga0068857_100219305 3300005577 Bacteria 1737
47 Ga0068854_100002687 3300005578 Bacteria 11024
48 Ga0068854_100067260 3300005578 Bacteria 2610
49 Ga0068854_100178966 3300005578 Bacteria 1655
50 Ga0068854_100256143 3300005578 Bacteria 1399
51 Ga0068856_100005708 3300005614 Bacteria 12259
52 Ga0068856_100231441 3300005614 Unclassified 1863
53 Ga0068852_100000526 3300005616 Bacteria 25203
54 Ga0068852_100094902 3300005616 Unclassified 2677
55 Ga0068852_100397099 3300005616 Archaea 1356
56 Ga0068851_10026541 3300005834 Unclassified 2848
57 Ga0068863_100004704 3300005841 Bacteria 13449
58 Ga0081540_1007314 3300005983 Bacteria 7896
59 Ga0070717_10001531 3300006028 Bacteria 16022
60 Ga0070717_10321689 3300006028 Unclassified 1378
61 Ga0070716_100122434 3300006173 Unclassified 1631
62 Ga0097621_100002464 3300006237 Bacteria 12671
63 Ga0068871_100001432 3300006358 Bacteria 15981
64 Ga0068871_100740115 3300006358 Unclassified 903
65 Ga0075436_100003852 3300006914 Bacteria 10287
66 Ga0075436_100073770 3300006914 Unclassified 2362
67 Ga0105240_10000531 3300009093 Bacteria 70393
68 Ga0105240_10042580 3300009093 Bacteria 5786
69 Ga0105240_10046458 3300009093 Bacteria 5501
70 Ga0105245_10000286 3300009098 Bacteria 48236
71 Ga0105245_10559419 3300009098 Bacteria 1166
72 Ga0105247_10074817 3300009101 Bacteria 2125
73 Ga0105247_10277140 3300009101 Unclassified 1156
74 Ga0105243_10301804 3300009148 Bacteria 1452
75 Ga0105241_10132849 3300009174 Bacteria 2017
76 Ga0105242_10077227 3300009176 Bacteria 2778
77 Ga0105248_10034495 3300009177 Bacteria 5658
78 Ga0105248_10059894 3300009177 Bacteria 4276
79 Ga0105237_10039168 3300009545 Bacteria 4785
80 Ga0105237_10122615 3300009545 Bacteria 2593
81 Ga0105238_10017675 3300009551 Bacteria 7249
82 Ga0157371_10059161 3300013102 Unclassified 2717
83 Ga0157371_10088486 3300013102 Archaea 2193
84 Ga0157371_10336959 3300013102 Unclassified 1097
85 Ga0157370_10001565 3300013104 Bacteria 28303
86 Ga0157370_10182664 3300013104 Bacteria 1949
87 Ga0157369_10142941 3300013105 Unclassified 2531
88 Ga0157369_10198492 3300013105 Unclassified 2106
89 Ga0157374_10000480 3300013296 Bacteria 36285
90 Ga0157374_10037427 3300013296 Bacteria 4453
91 Ga0157374_10047427 3300013296 Bacteria 3984
92 Ga0157374_10063083 3300013296 Unclassified 3475
93 Ga0157374_10133402 3300013296 Bacteria 2405
94 Ga0157378_10000023 3300013297 Bacteria 129977
95 Ga0163162_10034708 3300013306 Bacteria 5021
96 Ga0157372_10007134 3300013307 Bacteria 11893
97 Ga0157372_10014240 3300013307 Bacteria 8502
98 Ga0157372_10018449 3300013307 Bacteria 7500
99 Ga0157375_10268691 3300013308 Bacteria 1867
100 Ga0157379_10234754 3300014968 Bacteria 1663
101 Ga0213874_10070459 3300021377 Bacteria 1114
102 Ga0207656_10082186 3300025321 Bacteria 1449
103 Ga0207680_10049221 3300025903 Bacteria 2508
104 Ga0207680_10113339 3300025903 Bacteria 1762
105 Ga0207647_10004265 3300025904 Bacteria 10603
106 Ga0207699_10018620 3300025906 Bacteria 3684
107 Ga0207705_10000013 3300025909 Bacteria 451680
108 Ga0207705_10002679 3300025909 Bacteria 13632
109 Ga0207705_10074323 3300025909 Unclassified 2467
110 Ga0207705_10154056 3300025909 Bacteria 1723
111 Ga0207705_10293313 3300025909 Bacteria 1246
112 Ga0207654_10000209 3300025911 Bacteria 35841
113 Ga0207707_10117146 3300025912 Unclassified 2328
114 Ga0207695_10002371 3300025913 Bacteria 27983
115 Ga0207695_10003908 3300025913 Bacteria 20616
116 Ga0207695_10062634 3300025913 Bacteria 3839
117 Ga0207695_10077869 3300025913 Bacteria 3366
118 Ga0207695_10115850 3300025913 Bacteria 2654
119 Ga0207671_10000600 3300025914 Bacteria 47921
120 Ga0207671_10389813 3300025914 Bacteria 1107
121 Ga0207663_10174532 3300025916 Unclassified 1530
122 Ga0207660_10036821 3300025917 Unclassified 3403
123 Ga0207657_10002757 3300025919 Bacteria 18918
124 Ga0207657_10023468 3300025919 Bacteria 5743
125 Ga0207657_10093674 3300025919 Bacteria 2502
126 Ga0207649_10319040 3300025920 Bacteria 1141
127 Ga0207652_10157530 3300025921 Unclassified 2034
128 Ga0207694_10000898 3300025924 Bacteria 26304
129 Ga0207694_10022695 3300025924 Bacteria 4760
130 Ga0207687_10001012 3300025927 Bacteria 19086
131 Ga0207700_10368648 3300025928 Bacteria 1253
132 Ga0207700_10667147 3300025928 Unclassified 927
133 Ga0207664_10032623 3300025929 Bacteria 3994
134 Ga0207664_10036843 3300025929 Bacteria 3782
135 Ga0207664_10147119 3300025929 Bacteria 1999
136 Ga0207664_10527998 3300025929 Bacteria 1058
137 Ga0207644_10042360 3300025931 Bacteria 3226
138 Ga0207690_10035333 3300025932 Unclassified 3227
139 Ga0207665_10050151 3300025939 Bacteria 2806
140 Ga0207711_10182231 3300025941 Bacteria 1910
141 Ga0207711_10203475 3300025941 Unclassified 1807
142 Ga0207661_10010154 3300025944 Bacteria 6769
143 Ga0207667_10001644 3300025949 Bacteria 28165
144 Ga0207667_10005917 3300025949 Bacteria 14896
145 Ga0207667_10029114 3300025949 Bacteria 5992
146 Ga0207667_10046346 3300025949 Bacteria 4602
147 Ga0207658_10065245 3300025986 Bacteria 2734
148 Ga0207677_10013993 3300026023 Bacteria 4669
149 Ga0207677_10119665 3300026023 Bacteria 1978
150 Ga0207639_10437614 3300026041 Bacteria 1185
151 Ga0207678_10000626 3300026067 Bacteria 32290
152 Ga0207678_10005725 3300026067 Bacteria 11093
153 Ga0207702_10004315 3300026078 Bacteria 12679
154 Ga0207702_10051308 3300026078 Unclassified 3485
155 Ga0207641_10120941 3300026088 Bacteria 2336
156 Ga0207676_10118042 3300026095 Bacteria 2232
157 Ga0207674_10003832 3300026116 Bacteria 18334
158 Ga0207674_10159774 3300026116 Unclassified 2208
159 Ga0207698_10001476 3300026142 Bacteria 13679
160 Ga0207698_10250422 3300026142 Bacteria 1620
161 Ga0207698_10349502 3300026142 Unclassified 1396
162 Ga0268266_10009326 3300028379 Bacteria 8653
163 Ga0268266_10012461 3300028379 Bacteria 7348
164 Ga0268266_10019954 3300028379 Bacteria 5711
165 Ga0268266_10097950 3300028379 Bacteria 2580
166 Ga0265318_10040076 3300028577 Bacteria 1785
167 Ga0265330_10006691 3300031235 Bacteria 5685
168 Ga0265325_10006767 3300031241 Bacteria 6931
169 Ga0265329_10033839 3300031242 Unclassified 1652
170 Ga0265339_10026712 3300031249 Unclassified 3304
171 Ga0265316_10044880 3300031344 Bacteria 3512
172 Ga0265316_10148075 3300031344 Unclassified 1760
173 Ga0265313_10013102 3300031595 Bacteria 5004
174 Ga0265314_10000027 3300031711 Bacteria 278331
175 Ga0265342_10001088 3300031712 Bacteria 26276
176 Ga0307510_10096436 3300033180 Bacteria 2773
177 Ga0307510_10218986 3300033180 Bacteria 1417
178 Ga0373943_0243503 3300035170 Bacteria 1008
179 Ga0373927_0019328 3300035695 Unclassified 4468
180 Ga0436364_0278774 3300037853 Bacteria 400541
181 Ga0436364_1244154 3300037853 Bacteria 3887
182 Ga0395901_0052873 3300038443 Bacteria 4222
183 Ga0436365_0318821 3300039437 Bacteria 1688
184 Ga0436363_0687635 3300039450 Bacteria 1510
185 Ga0436363_1352741 3300039450 Bacteria 6491
186 Ga0451576_0084799 3300045051 Bacteria 3296
187 Ga0495603_0182685 3300046455 Bacteria 1213
188 Ga0495629_0001291 3300046459 Bacteria 19702
189 Ga0495651_0005224 3300046462 Bacteria 9896
190 Ga0495653_0027192 3300046463 Bacteria 4579
191 Ga0495650_0000009 3300046471 Bacteria 653845
192 Ga0495650_0001506 3300046471 Bacteria 22209
193 Ga0495580_0014814 3300046472 Bacteria 5909
194 Ga0495580_0022997 3300046472 Bacteria 4583
195 Ga0495580_0033658 3300046472 Bacteria 3691
196 Ga0495580_0069566 3300046472 Unclassified 2459
197 Ga0495582_0002811 3300046473 Bacteria 9732
198 Ga0495639_0001430 3300046475 Bacteria 10669
199 Ga0495662_0000730 3300046476 Bacteria 15702
200 Ga0495664_0001463 3300046477 Bacteria 12508
201 Ga0495594_0000765 3300046499 Bacteria 16490
202 Ga0495583_0063126 3300046506 Bacteria 1647
203 Ga0495608_0120219 3300046511 Bacteria 1685
204 Ga0495628_0021684 3300046516 Bacteria 5280
205 Ga0495632_0068968 3300046519 Bacteria 1703
206 Ga0495666_0002409 3300046526 Bacteria 9309
207 Ga0495665_0002266 3300046531 Bacteria 10422
208 Ga0495665_0027565 3300046531 Unclassified 3049
209 Ga0495640_0018142 3300046533 Bacteria 5228
210 Ga0495586_0006899 3300046535 Bacteria 6052
211 Ga0495587_0111502 3300046536 Bacteria 1571
212 Ga0495609_0008232 3300046538 Bacteria 5118
213 Ga0495645_0000476 3300046543 Bacteria 27726
214 Ga0495633_0118769 3300046558 Bacteria 1225
215 Ga0495667_0005012 3300046559 Bacteria 8949
216 Ga0495634_0004303 3300046642 Bacteria 11223
217 Ga0495625_0000598 3300046660 Bacteria 52509
218 Ga0495625_0006287 3300046660 Bacteria 10622
219 Ga0495625_0064826 3300046660 Bacteria 2576
220 Ga0495646_0014514 3300046680 Bacteria 5007
221 Ga0495600_0003012 3300046809 Bacteria 9834
222 Ga0495581_0000532 3300047315 Bacteria 19579
223 Ga0495604_0005961 3300047317 Bacteria 9671
224 Ga0495672_0000951 3300047320 Bacteria 30208
225 Ga0495676_0006770 3300047321 Bacteria 10538
226 Ga0495675_0002159 3300047444 Bacteria 11723
227 Ga0495602_0006901 3300048088 Bacteria 11933
228 Ga0495614_0000272 3300048089 Bacteria 20187
229 Ga0501077_0069398 3300049593 Bacteria 2234
230 Ga0501083_0074749 3300049744 Bacteria 2251
231 Ga0501044_0194418 3300049823 Bacteria 1989
232 Ga0500595_010920 3300053119 Bacteria 3580
233 Ga0501084_0033992 3300054114 Bacteria 4264
234 Ga0207700_10125328
235 LJNas_1006952
236 rootH1_10243680
237 Ga0070658_10000004
238 Ga0070658_10003753
239 Ga0070658_10151558
240 Ga0070658_10173320
241 Ga0070666_10037710
242 Ga0070666_10136527
243 Ga0070680_100031588
244 Ga0068868_100003995
245 Ga0068868_100143165
246 Ga0070660_100005235
247 Ga0070671_100001552
248 Ga0070671_100255084
249 Ga0070659_100009323
250 Ga0070659_100126152
251 Ga0070667_100043809
252 Ga0070714_100086408
253 Ga0070714_100088280
254 Ga0070714_100148933
255 Ga0070714_100228864
256 Ga0070713_100057169
257 Ga0070713_100154055
258 Ga0070713_100507683
259 Ga0070663_100190151
260 Ga0070678_100153594
261 Ga0070681_10006476
262 Ga0070681_10061641
263 Ga0070681_10338064
264 Ga0070707_100339453
265 Ga0070698_100152273
266 Ga0070699_100070999
267 Ga0070699_100564259
268 Ga0070679_100013019
269 Ga0070679_100067996
270 Ga0070684_100510817
271 Ga0068853_100021558
272 Ga0070693_100057569
273 Ga0070665_100005245
274 Ga0070665_100137083
275 Ga0068855_100101457
276 Ga0068855_100120106
277 Ga0068855_100209334
278 Ga0068857_100036255
279 Ga0068857_100219305
280 Ga0068854_100002687
281 Ga0068854_100067260
282 Ga0068854_100178966
283 Ga0068854_100256143
284 Ga0068856_100005708
285 Ga0068856_100231441
286 Ga0068852_100000526
287 Ga0068852_100094902
288 Ga0068852_100397099
289 Ga0068851_10026541
290 Ga0068863_100004704
291 Ga0081540_1007314
292 Ga0070717_10001531
293 Ga0070717_10321689
294 Ga0070716_100122434
295 Ga0097621_100002464
296 Ga0068871_100001432
297 Ga0068871_100740115
298 Ga0075436_100003852
299 Ga0075436_100073770
300 Ga0105240_10000531
301 Ga0105240_10042580
302 Ga0105240_10046458
303 Ga0105245_10000286
304 Ga0105245_10559419
305 Ga0105247_10074817
306 Ga0105247_10277140
307 Ga0105243_10301804
308 Ga0105241_10132849
309 Ga0105242_10077227
310 Ga0105248_10034495
311 Ga0105248_10059894
312 Ga0105237_10039168
313 Ga0105237_10122615
314 Ga0105238_10017675
315 Ga0157371_10059161
316 Ga0157371_10088486
317 Ga0157371_10336959
318 Ga0157370_10001565
319 Ga0157370_10182664
320 Ga0157369_10142941
321 Ga0157369_10198492
322 Ga0157374_10000480
323 Ga0157374_10037427
324 Ga0157374_10047427
325 Ga0157374_10063083
326 Ga0157374_10133402
327 Ga0157378_10000023
328 Ga0163162_10034708
329 Ga0157372_10007134
330 Ga0157372_10014240
331 Ga0157372_10018449
332 Ga0157375_10268691
333 Ga0157379_10234754
334 Ga0213874_10070459
335 Ga0207656_10082186
336 Ga0207680_10049221
337 Ga0207680_10113339
338 Ga0207647_10004265
339 Ga0207699_10018620
340 Ga0207705_10000013
341 Ga0207705_10002679
342 Ga0207705_10074323
343 Ga0207705_10154056
344 Ga0207705_10293313
345 Ga0207654_10000209
346 Ga0207707_10117146
347 Ga0207695_10002371
348 Ga0207695_10003908
349 Ga0207695_10062634
350 Ga0207695_10077869
351 Ga0207695_10115850
352 Ga0207671_10000600
353 Ga0207671_10389813
354 Ga0207663_10174532
355 Ga0207660_10036821
356 Ga0207657_10002757
357 Ga0207657_10023468
358 Ga0207657_10093674
359 Ga0207649_10319040
360 Ga0207652_10157530
361 Ga0207694_10000898
362 Ga0207694_10022695
363 Ga0207687_10001012
364 Ga0207700_10368648
365 Ga0207700_10667147
366 Ga0207664_10032623
367 Ga0207664_10036843
368 Ga0207664_10147119
369 Ga0207664_10527998
370 Ga0207644_10042360
371 Ga0207690_10035333
372 Ga0207665_10050151
373 Ga0207711_10182231
374 Ga0207711_10203475
375 Ga0207661_10010154
376 Ga0207667_10001644
377 Ga0207667_10005917
378 Ga0207667_10029114
379 Ga0207667_10046346
380 Ga0207658_10065245
381 Ga0207677_10013993
382 Ga0207677_10119665
383 Ga0207639_10437614
384 Ga0207678_10000626
385 Ga0207678_10005725
386 Ga0207702_10004315
387 Ga0207702_10051308
388 Ga0207641_10120941
389 Ga0207676_10118042
390 Ga0207674_10003832
391 Ga0207674_10159774
392 Ga0207698_10001476
393 Ga0207698_10250422
394 Ga0207698_10349502
395 Ga0268266_10009326
396 Ga0268266_10012461
397 Ga0268266_10019954
398 Ga0268266_10097950
399 Ga0265318_10040076
400 Ga0265330_10006691
401 Ga0265325_10006767
402 Ga0265329_10033839
403 Ga0265339_10026712
404 Ga0265316_10044880
405 Ga0265316_10148075
406 Ga0265313_10013102
407 Ga0265314_10000027
408 Ga0265342_10001088
409 Ga0307510_10096436
410 Ga0307510_10218986
411 Ga0373943_0243503
412 Ga0373927_0019328
413 Ga0436364_0278774
414 Ga0436364_1244154
415 Ga0395901_0052873
416 Ga0436365_0318821
417 Ga0436363_0687635
418 Ga0436363_1352741
419 Ga0451576_0084799
420 Ga0495603_0182685
421 Ga0495629_0001291
422 Ga0495651_0005224
423 Ga0495653_0027192
424 Ga0495650_0000009
425 Ga0495650_0001506
426 Ga0495580_0014814
427 Ga0495580_0022997
428 Ga0495580_0033658
429 Ga0495580_0069566
430 Ga0495582_0002811
431 Ga0495639_0001430
432 Ga0495662_0000730
433 Ga0495664_0001463
434 Ga0495594_0000765
435 Ga0495583_0063126
436 Ga0495608_0120219
437 Ga0495628_0021684
438 Ga0495632_0068968
439 Ga0495666_0002409
440 Ga0495665_0002266
441 Ga0495665_0027565
442 Ga0495640_0018142
443 Ga0495586_0006899
444 Ga0495587_0111502
445 Ga0495609_0008232
446 Ga0495645_0000476
447 Ga0495633_0118769
448 Ga0495667_0005012
449 Ga0495634_0004303
450 Ga0495625_0000598
451 Ga0495625_0006287
452 Ga0495625_0064826
453 Ga0495646_0014514
454 Ga0495600_0003012
455 Ga0495581_0000532
456 Ga0495604_0005961
457 Ga0495672_0000951
458 Ga0495676_0006770
459 Ga0495675_0002159
460 Ga0495602_0006901
461 Ga0495614_0000272
462 Ga0501077_0069398
463 Ga0501083_0074749
464 Ga0501044_0194418
465 Ga0500595_010920
466 Ga0501084_0033992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dg3-assembly2.cif.gz_D lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.933 2 258
6utq-assembly1.cif.gz_E lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.9306 1 259
6dg3-assembly2.cif.gz_D lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9294 2 258
6dg3-assembly1.cif.gz_K-2 lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9269 2 258
6utq-assembly1.cif.gz_E lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.9269 1 259
ID Description Score Start End Superfamily
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9382 3 166 3.40.50.620
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9157 3 166 3.40.50.620
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7774 3 164 3.40.50.620
af_A8DZ59_1_333_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7391 19 50 3.50.50.60
4nrdE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7334 30 79 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A383APJ5-F1-model_v4 NAD/GMP synthase domain-containing protein 0.9849 3 214 GO:0016783
AF-A0A7V1QA64-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9845 3 208 GO:0016783
AF-A0A349K7C3-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9842 1 186 GO:0016783
AF-A0A523E2R9-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9824 3 261 GO:0016783
AF-A0A7V9ZCS3-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9824 3 261 GO:0016783

Map