F346088

General Info

Members Datasets Scaffolds Average Seq Length
233 169 204 344

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10028936|Ga0157370_100289363
Length 322
Sequence MIATKGYAAQSAESDLAPWEFERREVGPHDVQFEILFCGVCHSDLHQIKNDWFPGIFPMVPGHEIVGRVIQVGDHVKKFKVGDLAGTGCMVDSCQVCENCKQDLEQYCLEGNTQTYNGLERDYSNNIVVREEFVLHVSEKLDLAAVAPLLCAGITTYSPLRHWKVGKGHKLAVLGLGGLGHMAVKFGVAFGAEVTVLSTSPKKEEQVAAAKGTFDFILDTVSAEHDFNMYLSLLRTNGTHICVGVPPKPAEIAAFSLLGGRKSLAGSGIGGIAETQEMLDFCAENNIVSDIEMIDMKDIHHAYERMEKGDVRYRFVIDMATL

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2818991437 Pedobacter terrae 518 Isolate Unclassified
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
13 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
14 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
15 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
16 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
17 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
18 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
19 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
20 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
21 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
22 2914759650 Rhizosphaericola mali Isolate Rhizosphere
23 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
24 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
25 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
26 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
27 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
28 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
31 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
163 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.55
Metatranscriptomes 0
Isolates 12.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.3
Nodule 0
Rhizoplane 0.86
Rhizosphere 69.53
Stem 0
Stem Tuber 0
Unclassified 16.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001337 3300002737 Bacteria 13706
2 JGI25157J39369_1007573 3300002741 Bacteria 1560
3 JGI25152J39213_1000289 3300002773 Bacteria 33114
4 JGI25150J39212_1000001 3300002774 Bacteria 1318726
5 JGI25151J46595_10000005 3300003187 Bacteria 431598
6 JGI25153J46596_10000018 3300003215 Bacteria 269774
7 rootH2_10004553 3300003320 Bacteria 89512
8 rootL2_10013090 3300003322 Bacteria 4745
9 rootL2_10098414 3300003322 Bacteria 4900
10 rootH1_10120525 3300003323 Bacteria 10790
11 Ga0055536_1000001 3300003781 Bacteria 630663
12 Ga0055530_10004660 3300003791 Bacteria 6960
13 Ga0065714_10065634 3300005288 Bacteria 9088
14 Ga0065714_10078418 3300005288 Bacteria 2600
15 Ga0070676_10000144 3300005328 Bacteria 27905
16 Ga0070670_100031395 3300005331 Bacteria 4574
17 Ga0068868_100016976 3300005338 Bacteria 5417
18 Ga0070669_100085566 3300005353 Bacteria 2354
19 Ga0070673_100013402 3300005364 Bacteria 5671
20 Ga0070662_100000083 3300005457 Bacteria 51358
21 Ga0070707_100052807 3300005468 Bacteria 3897
22 Ga0068855_100000093 3300005563 Bacteria 106968
23 Ga0068855_100123410 3300005563 Bacteria 2963
24 Ga0070664_100170128 3300005564 Bacteria 1933
25 Ga0068856_100603150 3300005614 Bacteria 1119
26 Ga0068852_100004913 3300005616 Bacteria 9492
27 Ga0068851_10100072 3300005834 Bacteria 1537
28 Ga0097621_100000344 3300006237 Bacteria 31894
29 Ga0075370_10065929 3300006353 Bacteria 2065
30 Ga0068871_100000824 3300006358 Bacteria 20776
31 Ga0068871_100009042 3300006358 Bacteria 7195
32 Ga0068865_100000492 3300006881 Bacteria 22165
33 Ga0105240_10060562 3300009093 Bacteria 4720
34 Ga0105240_10074687 3300009093 Bacteria 4183
35 Ga0105240_10176001 3300009093 Bacteria 2529
36 Ga0105241_10007925 3300009174 Bacteria 7810
37 Ga0105241_10015697 3300009174 Bacteria 5548
38 Ga0105241_10090975 3300009174 Bacteria 2407
39 Ga0105242_10035421 3300009176 Bacteria 4003
40 Ga0105237_10000168 3300009545 Bacteria 92212
41 Ga0105237_10000327 3300009545 Bacteria 66993
42 Ga0105237_10013640 3300009545 Bacteria 8510
43 Ga0105237_10326445 3300009545 Bacteria 1538
44 Ga0105237_10693994 3300009545 Bacteria 1024
45 Ga0105238_10003025 3300009551 Bacteria 16777
46 Ga0105249_10050093 3300009553 Bacteria 3808
47 Ga0105239_10033286 3300010375 Bacteria 5661
48 Ga0105239_10189007 3300010375 Bacteria 2305
49 Ga0157373_10010981 3300013100 Bacteria 6668
50 Ga0157373_10087022 3300013100 Bacteria 2202
51 Ga0157371_10000119 3300013102 Bacteria 120350
52 Ga0157371_10207793 3300013102 Bacteria 1404
53 Ga0157370_10001045 3300013104 Bacteria 34835
54 Ga0157370_10002088 3300013104 Bacteria 24445
55 Ga0157370_10028936 3300013104 Bacteria 5444
56 Ga0157370_10089767 3300013104 Bacteria 2886
57 Ga0157370_10090292 3300013104 Bacteria 2877
58 Ga0157370_10236969 3300013104 Bacteria 1689
59 Ga0157369_10000015 3300013105 Bacteria 262917
60 Ga0157374_10000009 3300013296 Bacteria 564330
61 Ga0157374_10001231 3300013296 Bacteria 21878
62 Ga0157374_10001437 3300013296 Bacteria 20134
63 Ga0157378_10036066 3300013297 Bacteria 4376
64 Ga0163162_10000882 3300013306 Bacteria 27892
65 Ga0163162_10013675 3300013306 Bacteria 7931
66 Ga0163162_10013980 3300013306 Bacteria 7846
67 Ga0163162_10073125 3300013306 Bacteria 3484
68 Ga0163162_10286674 3300013306 Bacteria 1778
69 Ga0157375_10100985 3300013308 Bacteria 2967
70 Ga0163163_10130286 3300014325 Bacteria 2555
71 Ga0157380_10002891 3300014326 Bacteria 11674
72 Ga0182008_10000267 3300014497 Bacteria 41024
73 Ga0157376_10003523 3300014969 Bacteria 10797
74 Ga0157376_10352055 3300014969 Bacteria 1410
75 Ga0182006_1000091 3300015261 Bacteria 109227
76 Ga0182006_1000352 3300015261 Bacteria 38650
77 Ga0182006_1007645 3300015261 Bacteria 4939
78 Ga0182007_10000010 3300015262 Bacteria 286070
79 Ga0183373_1005 3300015682 Bacteria 351562
80 Ga0163161_10000046 3300017792 Bacteria 127211
81 Ga0163161_10001274 3300017792 Bacteria 18814
82 Ga0163161_10003880 3300017792 Bacteria 10485
83 Ga0163161_10140459 3300017792 Bacteria 1829
84 Ga0163161_10183255 3300017792 Bacteria 1607
85 Ga0207427_100219 3300025231 Bacteria 49678
86 Ga0209437_100363 3300025233 Bacteria 49686
87 Ga0207425_1000002 3300025245 Bacteria 1362590
88 Ga0209646_1000003 3300025246 Bacteria 1160860
89 Ga0209026_1000202 3300025250 Bacteria 82517
90 Ga0209026_1004711 3300025250 Bacteria 3934
91 Ga0209129_1000002 3300025258 Bacteria 1359086
92 Ga0209233_1000017 3300025261 Bacteria 898076
93 Ga0209676_1000008 3300025292 Bacteria 991778
94 Ga0209025_1000004 3300025294 Bacteria 1361782
95 Ga0209758_1000006 3300025297 Bacteria 1359562
96 Ga0209758_1013871 3300025297 Bacteria 4345
97 Ga0209050_1000045 3300025298 Bacteria 388022
98 Ga0207426_1001549 3300025302 Bacteria 18689
99 Ga0207647_10000098 3300025904 Bacteria 67170
100 Ga0207645_10000185 3300025907 Bacteria 49988
101 Ga0207654_10003819 3300025911 Bacteria 7594
102 Ga0207654_10007860 3300025911 Bacteria 5377
103 Ga0207695_10024834 3300025913 Bacteria 6726
104 Ga0207695_10054633 3300025913 Bacteria 4168
105 Ga0207695_10137071 3300025913 Bacteria 2400
106 Ga0207671_10001657 3300025914 Bacteria 25327
107 Ga0207671_10005309 3300025914 Bacteria 11938
108 Ga0207671_10010536 3300025914 Bacteria 7615
109 Ga0207681_10088000 3300025923 Bacteria 2211
110 Ga0207694_10059330 3300025924 Bacteria 2975
111 Ga0207650_10046120 3300025925 Bacteria 3209
112 Ga0207706_10000176 3300025933 Bacteria 70917
113 Ga0207704_10000055 3300025938 Bacteria 78858
114 Ga0207679_10070741 3300025945 Bacteria 2629
115 Ga0207667_10006429 3300025949 Bacteria 14235
116 Ga0207667_10083625 3300025949 Bacteria 3305
117 Ga0207651_10058964 3300025960 Bacteria 2655
118 Ga0207677_10014863 3300026023 Bacteria 4561
119 Ga0207677_10181279 3300026023 Bacteria 1657
120 Ga0207639_10015474 3300026041 Bacteria 5384
121 Ga0207648_10000775 3300026089 Bacteria 36025
122 Ga0207648_10207776 3300026089 Bacteria 1737
123 Ga0307515_10000493 3300028794 Bacteria 94441
124 Ga0307515_10125231 3300028794 Bacteria 2877
125 Ga0265338_10086891 3300028800 Bacteria 2600
126 Ga0307511_10000382 3300030521 Bacteria 47277
127 Ga0265327_10000389 3300031251 Bacteria 82772
128 Ga0265327_10036482 3300031251 Bacteria 2702
129 Ga0307513_10359578 3300031456 Bacteria 1201
130 Ga0307509_10060456 3300031507 Bacteria 4005
131 Ga0307509_10080321 3300031507 Bacteria 3373
132 Ga0307509_10149860 3300031507 Bacteria 2251
133 Ga0307508_10000926 3300031616 Bacteria 34077
134 Ga0307516_10000111 3300031730 Bacteria 94707
135 Ga0307516_10035825 3300031730 Bacteria 4974
136 Ga0307516_10084216 3300031730 Bacteria 3019
137 Ga0307405_10000005 3300031731 Bacteria 376536
138 Ga0307405_10000124 3300031731 Bacteria 30625
139 Ga0307406_10144022 3300031901 Bacteria 1691
140 Ga0307407_10000120 3300031903 Bacteria 25292
141 Ga0307409_100163318 3300031995 Bacteria 1951
142 Ga0307416_100000037 3300032002 Bacteria 137513
143 Ga0307414_10001117 3300032004 Bacteria 13707
144 Ga0307414_10125494 3300032004 Bacteria 1982
145 Ga0373937_0067961 3300036401 Bacteria 3285
146 Ga0395899_0000017 3300037312 Bacteria 440179
147 Ga0395899_0001160 3300037312 Bacteria 23301
148 Ga0395900_0004024 3300037418 Bacteria 15689
149 Ga0395905_0001097 3300037471 Bacteria 34059
150 Ga0395901_0003411 3300038443 Bacteria 16009
151 Ga0439455_0023079 3300042012 Bacteria 1496
152 Ga0451577_0084891 3300042876 Unclassified 2825
153 Ga0453683_0025312 3300044673 Bacteria 3772
154 Ga0466961_0007492 3300044693 Bacteria 6942
155 Ga0466971_0012225 3300044719 Bacteria 3760
156 Ga0466959_0000178 3300045049 Bacteria 42120
157 Ga0451576_0006308 3300045051 Bacteria 14585
158 Ga0495627_018875 3300046453 Bacteria 2318
159 Ga0495638_0009125 3300046460 Bacteria 6981
160 Ga0495638_0092066 3300046460 Bacteria 1825
161 Ga0495650_0000014 3300046471 Bacteria 581606
162 Ga0495585_0000031 3300046492 Bacteria 143899
163 Ga0495607_0139486 3300046501 Bacteria 1252
164 Ga0495606_0000020 3300046507 Bacteria 274490
165 Ga0495606_0006021 3300046507 Bacteria 11364
166 Ga0495606_0009419 3300046507 Bacteria 8268
167 Ga0495610_0000045 3300046512 Bacteria 155304
168 Ga0495610_0000329 3300046512 Bacteria 50268
169 Ga0495610_0002311 3300046512 Bacteria 16108
170 Ga0495616_0005620 3300046513 Bacteria 7673
171 Ga0495633_0000123 3300046558 Bacteria 104682
172 Ga0495633_0065366 3300046558 Bacteria 1700
173 Ga0495668_0004984 3300046616 Bacteria 9187
174 Ga0495625_0000009 3300046660 Bacteria 404954
175 Ga0495661_0001938 3300046665 Bacteria 16455
176 Ga0495661_0020830 3300046665 Bacteria 4275
177 Ga0495613_0172293 3300046689 Bacteria 1535
178 Ga0495670_0077774 3300046691 Bacteria 1687
179 Ga0495671_0062244 3300046692 Bacteria 1839
180 Ga0495649_0000008 3300046694 Bacteria 483706
181 Ga0495600_0110512 3300046809 Bacteria 1790
182 Ga0495674_0110766 3300047319 Bacteria 2328
183 Ga0495687_000345 3300047443 Bacteria 59578
184 Ga0495684_0034502 3300047471 Bacteria 3882
185 Ga0495686_0001123 3300047472 Bacteria 31643
186 Ga0495686_0001299 3300047472 Bacteria 28153
187 Ga0496115_0019556 3300048918 Bacteria 5213
188 Ga0496122_0004201 3300048925 Bacteria 18112
189 Ga0496123_0001966 3300048926 Bacteria 26685
190 Ga0496125_0000972 3300048928 Bacteria 44870
191 Ga0496126_0015471 3300048929 Bacteria 7673
192 nmdc:mga07m45_22398_c1 3300050496 Bacteria 3448
193 nmdc:mga08y16_11927_c1 3300050511 Bacteria 9129
194 Ga0500644_0036552 3300053088 Bacteria 1599
195 Ga0500592_006117 3300053116 Bacteria 1917
196 Ga0500608_062855 3300053122 Bacteria 1772
197 Ga0500618_002133 3300053125 Bacteria 7805
198 Ga0500618_015463 3300053125 Bacteria 1928
199 Ga0500642_0024768 3300053130 Bacteria 2429
200 Ga0500616_0002432 3300053153 Bacteria 15502
201 Ga0500622_0000012 3300053156 Bacteria 383183
202 Ga0500622_0000030 3300053156 Bacteria 208734
203 Ga0500622_0000925 3300053156 Bacteria 24930
204 Ga0500622_0001363 3300053156 Bacteria 19730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10693994 Ga0105237_106939942 288
2 3300013306 Ga0163162_10286674 Ga0163162_102866742 288
3 3300037312 Ga0395899_0001160 Ga0395899_0001160_13565_14437 288
4 3300038443 Ga0395901_0003411 Ga0395901_0003411_13628_14500 288
5 3300046501 Ga0495607_0139486 Ga0495607_0139486_108_977 288
6 3300013104 Ga0157370_10028936 Ga0157370_100289363 322
7 3300006353 Ga0075370_10065929 Ga0075370_100659291 326
8 3300009545 Ga0105237_10000327 Ga0105237_1000032729 326
9 3300013104 Ga0157370_10002088 Ga0157370_100020886 326
10 3300017792 Ga0163161_10001274 Ga0163161_100012749 326
11 3300017792 Ga0163161_10183255 Ga0163161_101832551 326
12 3300025914 Ga0207671_10001657 Ga0207671_100016579 326
13 3300048925 Ga0496122_0004201 Ga0496122_0004201_5137_6177 326
14 3300048926 Ga0496123_0001966 Ga0496123_0001966_3773_4813 326
15 3300050496 nmdc:mga07m45_22398_c1 nmdc:mga07m45_22398_c1_1720_2763 326
16 3300046689 Ga0495613_0172293 Ga0495613_0172293_69_1109 330
17 3300014497 Ga0182008_10000267 Ga0182008_1000026733 331
18 3300015261 Ga0182006_1007645 Ga0182006_10076454 331
19 3300046691 Ga0495670_0077774 Ga0495670_0077774_50_1090 331
20 3300009545 Ga0105237_10326445 Ga0105237_103264451 332
21 3300013306 Ga0163162_10073125 Ga0163162_100731251 332
22 3300048918 Ga0496115_0019556 Ga0496115_0019556_2802_3845 332
23 3300005563 Ga0068855_100000093 Ga0068855_10000009385 333
24 3300025949 Ga0207667_10006429 Ga0207667_100064295 333
25 3300028794 Ga0307515_10000493 Ga0307515_1000049358 333
26 3300031251 Ga0265327_10036482 Ga0265327_100364822 333
27 3300053116 Ga0500592_006117 Ga0500592_006117_75_1118 333
28 3300031730 Ga0307516_10084216 Ga0307516_100842162 334
29 3300003323 rootH1_10120525 rootH1_101205253 335
30 3300046460 Ga0495638_0009125 Ga0495638_0009125_988_2028 336
31 3300046692 Ga0495671_0062244 Ga0495671_0062244_216_1262 336
32 3300053088 Ga0500644_0036552 Ga0500644_0036552_229_1269 336
33 3300053153 Ga0500616_0002432 Ga0500616_0002432_6073_7116 336
34 3300005331 Ga0070670_100031395 Ga0070670_1000313951 337
35 3300025925 Ga0207650_10046120 Ga0207650_100461201 337
36 3300032004 Ga0307414_10001117 Ga0307414_100011174 337
37 3300015682 Ga0183373_1005 Ga0183373_1005271 338
38 iso_pu_bacteria 2902048731 2902049274 341
39 iso_pu_bacteria 2599185184 2599476861 342
40 iso_pu_bacteria 2738541273 2738700498 342
41 iso_pu_bacteria 2738541302 2738855772 342
42 iso_pu_bacteria 2738543014 2739254247 342
43 iso_pu_bacteria 2738543023 2739304642 342
44 iso_pu_bacteria 2739367651 2739590175 342
45 iso_pu_bacteria 2739367656 2739617793 342
46 iso_pu_bacteria 2739367663 2739645332 342
47 iso_pu_bacteria 2818991437 2819548438 342
48 iso_pu_bacteria 2842722452 2842722999 342
49 iso_pu_bacteria 2842909656 2842913953 342
50 iso_pu_bacteria 2849281842 2849283696 342
51 iso_pu_bacteria 2852623160 2852623306 342
52 iso_pu_bacteria 2852627209 2852631405 342
53 iso_pu_bacteria 2857627736 2857630692 342
54 iso_pu_bacteria 2881955468 2881957749 342
55 iso_pu_bacteria 2884933994 2884937816 342
56 iso_pu_bacteria 2896109856 2896111470 342
57 iso_pu_bacteria 2904445276 2904449550 342
58 iso_pu_bacteria 2914759650 2914762270 342
59 iso_pu_bacteria 2928078545 2928078771 342
60 iso_pu_bacteria 2928147474 2928151551 342
61 iso_pu_bacteria 2929239360 2929245628 342
62 iso_pu_bacteria 2932082852 2932085434 342
63 iso_pu_bacteria 2945997725 2945999963 342
64 iso_pu_bacteria 2954016120 2954016571 342
65 iso_pu_bacteria 8003151029 8003156563 342
66 iso_pu_bacteria 2522125168 2522553056 343
67 3300005468 Ga0070707_100052807 Ga0070707_1000528073 345
68 3300002737 JGI25162J39368_1001337 JGI25162J39368_10013375 346
69 3300002741 JGI25157J39369_1007573 JGI25157J39369_10075731 346
70 3300002773 JGI25152J39213_1000289 JGI25152J39213_100028922 346
71 3300002774 JGI25150J39212_1000001 JGI25150J39212_10000011145 346
72 3300003187 JGI25151J46595_10000005 JGI25151J46595_1000000554 346
73 3300003215 JGI25153J46596_10000018 JGI25153J46596_10000018181 346
74 3300003320 rootH2_10004553 rootH2_1000455337 346
75 3300003322 rootL2_10013090 rootL2_100130903 346
76 3300003322 rootL2_10098414 rootL2_100984142 346
77 3300003781 Ga0055536_1000001 Ga0055536_1000001201 346
78 3300003791 Ga0055530_10004660 Ga0055530_100046608 346
79 3300005288 Ga0065714_10065634 Ga0065714_100656344 346
80 3300005288 Ga0065714_10078418 Ga0065714_100784183 346
81 3300005328 Ga0070676_10000144 Ga0070676_1000014414 346
82 3300005338 Ga0068868_100016976 Ga0068868_1000169763 346
83 3300005353 Ga0070669_100085566 Ga0070669_1000855662 346
84 3300005364 Ga0070673_100013402 Ga0070673_1000134026 346
85 3300005457 Ga0070662_100000083 Ga0070662_10000008337 346
86 3300005563 Ga0068855_100123410 Ga0068855_1001234102 346
87 3300005564 Ga0070664_100170128 Ga0070664_1001701282 346
88 3300005614 Ga0068856_100603150 Ga0068856_1006031501 346
89 3300005616 Ga0068852_100004913 Ga0068852_1000049136 346
90 3300005834 Ga0068851_10100072 Ga0068851_101000722 346
91 3300006237 Ga0097621_100000344 Ga0097621_10000034428 346
92 3300006358 Ga0068871_100000824 Ga0068871_1000008248 346
93 3300006358 Ga0068871_100009042 Ga0068871_1000090428 346
94 3300006881 Ga0068865_100000492 Ga0068865_1000004927 346
95 3300009093 Ga0105240_10060562 Ga0105240_100605623 346
96 3300009093 Ga0105240_10074687 Ga0105240_100746873 346
97 3300009093 Ga0105240_10176001 Ga0105240_101760012 346
98 3300009174 Ga0105241_10007925 Ga0105241_100079251 346
99 3300009174 Ga0105241_10015697 Ga0105241_100156975 346
100 3300009174 Ga0105241_10090975 Ga0105241_100909752 346
101 3300009176 Ga0105242_10035421 Ga0105242_100354214 346
102 3300009545 Ga0105237_10000168 Ga0105237_1000016812 346
103 3300009545 Ga0105237_10013640 Ga0105237_100136403 346
104 3300009551 Ga0105238_10003025 Ga0105238_1000302511 346
105 3300009553 Ga0105249_10050093 Ga0105249_100500931 346
106 3300010375 Ga0105239_10033286 Ga0105239_100332868 346
107 3300010375 Ga0105239_10189007 Ga0105239_101890072 346
108 3300013100 Ga0157373_10010981 Ga0157373_100109818 346
109 3300013100 Ga0157373_10087022 Ga0157373_100870222 346
110 3300013102 Ga0157371_10000119 Ga0157371_1000011934 346
111 3300013102 Ga0157371_10207793 Ga0157371_102077932 346
112 3300013104 Ga0157370_10001045 Ga0157370_1000104510 346
113 3300013104 Ga0157370_10089767 Ga0157370_100897672 346
114 3300013104 Ga0157370_10090292 Ga0157370_100902922 346
115 3300013104 Ga0157370_10236969 Ga0157370_102369691 346
116 3300013105 Ga0157369_10000015 Ga0157369_1000001571 346
117 3300013296 Ga0157374_10000009 Ga0157374_1000000995 346
118 3300013296 Ga0157374_10001231 Ga0157374_100012316 346
119 3300013296 Ga0157374_10001437 Ga0157374_100014376 346
120 3300013297 Ga0157378_10036066 Ga0157378_100360662 346
121 3300013306 Ga0163162_10000882 Ga0163162_1000088223 346
122 3300013306 Ga0163162_10013675 Ga0163162_100136758 346
123 3300013306 Ga0163162_10013980 Ga0163162_100139805 346
124 3300013308 Ga0157375_10100985 Ga0157375_101009851 346
125 3300014325 Ga0163163_10130286 Ga0163163_101302863 346
126 3300014326 Ga0157380_10002891 Ga0157380_100028911 346
127 3300014969 Ga0157376_10003523 Ga0157376_100035232 346
128 3300014969 Ga0157376_10352055 Ga0157376_103520552 346
129 3300015261 Ga0182006_1000091 Ga0182006_100009150 346
130 3300015261 Ga0182006_1000352 Ga0182006_100035210 346
131 3300015262 Ga0182007_10000010 Ga0182007_10000010144 346
132 3300017792 Ga0163161_10000046 Ga0163161_10000046102 346
133 3300017792 Ga0163161_10003880 Ga0163161_100038807 346
134 3300017792 Ga0163161_10140459 Ga0163161_101404592 346
135 3300025231 Ga0207427_100219 Ga0207427_1002196 346
136 3300025233 Ga0209437_100363 Ga0209437_1003636 346
137 3300025245 Ga0207425_1000002 Ga0207425_100000256 346
138 3300025246 Ga0209646_1000003 Ga0209646_100000379 346
139 3300025250 Ga0209026_1000202 Ga0209026_100020218 346
140 3300025250 Ga0209026_1004711 Ga0209026_10047113 346
141 3300025258 Ga0209129_1000002 Ga0209129_100000256 346
142 3300025261 Ga0209233_1000017 Ga0209233_1000017832 346
143 3300025292 Ga0209676_1000008 Ga0209676_1000008657 346
144 3300025294 Ga0209025_1000004 Ga0209025_10000041133 346
145 3300025297 Ga0209758_1000006 Ga0209758_10000061133 346
146 3300025297 Ga0209758_1013871 Ga0209758_10138711 346
147 3300025298 Ga0209050_1000045 Ga0209050_1000045128 346
148 3300025302 Ga0207426_1001549 Ga0207426_100154910 346
149 3300025904 Ga0207647_10000098 Ga0207647_1000009832 346
150 3300025907 Ga0207645_10000185 Ga0207645_1000018529 346
151 3300025911 Ga0207654_10003819 Ga0207654_100038193 346
152 3300025911 Ga0207654_10007860 Ga0207654_100078603 346
153 3300025913 Ga0207695_10024834 Ga0207695_100248343 346
154 3300025913 Ga0207695_10054633 Ga0207695_100546333 346
155 3300025913 Ga0207695_10137071 Ga0207695_101370712 346
156 3300025914 Ga0207671_10005309 Ga0207671_100053099 346
157 3300025914 Ga0207671_10010536 Ga0207671_100105365 346
158 3300025923 Ga0207681_10088000 Ga0207681_100880002 346
159 3300025924 Ga0207694_10059330 Ga0207694_100593303 346
160 3300025933 Ga0207706_10000176 Ga0207706_1000017635 346
161 3300025938 Ga0207704_10000055 Ga0207704_1000005514 346
162 3300025945 Ga0207679_10070741 Ga0207679_100707413 346
163 3300025949 Ga0207667_10083625 Ga0207667_100836254 346
164 3300025960 Ga0207651_10058964 Ga0207651_100589642 346
165 3300026023 Ga0207677_10014863 Ga0207677_100148633 346
166 3300026023 Ga0207677_10181279 Ga0207677_101812792 346
167 3300026041 Ga0207639_10015474 Ga0207639_100154743 346
168 3300026089 Ga0207648_10000775 Ga0207648_100007756 346
169 3300026089 Ga0207648_10207776 Ga0207648_102077762 346
170 3300028794 Ga0307515_10125231 Ga0307515_101252311 346
171 3300028800 Ga0265338_10086891 Ga0265338_100868911 346
172 3300030521 Ga0307511_10000382 Ga0307511_100003829 346
173 3300031251 Ga0265327_10000389 Ga0265327_100003897 346
174 3300031456 Ga0307513_10359578 Ga0307513_103595782 346
175 3300031507 Ga0307509_10060456 Ga0307509_100604562 346
176 3300031507 Ga0307509_10080321 Ga0307509_100803212 346
177 3300031507 Ga0307509_10149860 Ga0307509_101498601 346
178 3300031616 Ga0307508_10000926 Ga0307508_1000092630 346
179 3300031730 Ga0307516_10000111 Ga0307516_1000011161 346
180 3300031730 Ga0307516_10035825 Ga0307516_100358252 346
181 3300031731 Ga0307405_10000005 Ga0307405_10000005279 346
182 3300031731 Ga0307405_10000124 Ga0307405_100001247 346
183 3300031901 Ga0307406_10144022 Ga0307406_101440221 346
184 3300031903 Ga0307407_10000120 Ga0307407_1000012020 346
185 3300031995 Ga0307409_100163318 Ga0307409_1001633182 346
186 3300032002 Ga0307416_100000037 Ga0307416_10000003721 346
187 3300032004 Ga0307414_10125494 Ga0307414_101254942 346
188 3300036401 Ga0373937_0067961 Ga0373937_0067961_1400_2443 346
189 3300037312 Ga0395899_0000017 Ga0395899_0000017_365222_366268 346
190 3300037418 Ga0395900_0004024 Ga0395900_0004024_150_1196 346
191 3300037471 Ga0395905_0001097 Ga0395905_0001097_32855_33901 346
192 3300042012 Ga0439455_0023079 Ga0439455_0023079_348_1394 346
193 3300042876 Ga0451577_0084891 Ga0451577_0084891_962_2002 346
194 3300044673 Ga0453683_0025312 Ga0453683_0025312_1467_2507 346
195 3300044693 Ga0466961_0007492 Ga0466961_0007492_4908_5954 346
196 3300044719 Ga0466971_0012225 Ga0466971_0012225_376_1422 346
197 3300045049 Ga0466959_0000178 Ga0466959_0000178_17456_18502 346
198 3300045051 Ga0451576_0006308 Ga0451576_0006308_11893_12933 346
199 3300046453 Ga0495627_018875 Ga0495627_018875_658_1698 346
200 3300046460 Ga0495638_0092066 Ga0495638_0092066_260_1303 346
201 3300046471 Ga0495650_0000014 Ga0495650_0000014_545020_546063 346
202 3300046492 Ga0495585_0000031 Ga0495585_0000031_111335_112378 346
203 3300046507 Ga0495606_0000020 Ga0495606_0000020_18780_19823 346
204 3300046507 Ga0495606_0006021 Ga0495606_0006021_443_1486 346
205 3300046507 Ga0495606_0009419 Ga0495606_0009419_1400_2440 346
206 3300046512 Ga0495610_0000045 Ga0495610_0000045_37763_38806 346
207 3300046512 Ga0495610_0000329 Ga0495610_0000329_27584_28627 346
208 3300046512 Ga0495610_0002311 Ga0495610_0002311_130_1173 346
209 3300046513 Ga0495616_0005620 Ga0495616_0005620_5867_6910 346
210 3300046558 Ga0495633_0000123 Ga0495633_0000123_22610_23650 346
211 3300046558 Ga0495633_0065366 Ga0495633_0065366_152_1195 346
212 3300046616 Ga0495668_0004984 Ga0495668_0004984_6589_7632 346
213 3300046660 Ga0495625_0000009 Ga0495625_0000009_81462_82505 346
214 3300046665 Ga0495661_0001938 Ga0495661_0001938_13523_14602 346
215 3300046665 Ga0495661_0020830 Ga0495661_0020830_2564_3607 346
216 3300046694 Ga0495649_0000008 Ga0495649_0000008_166053_167096 346
217 3300046809 Ga0495600_0110512 Ga0495600_0110512_65_1105 346
218 3300047319 Ga0495674_0110766 Ga0495674_0110766_387_1427 346
219 3300047443 Ga0495687_000345 Ga0495687_000345_1779_2825 346
220 3300047471 Ga0495684_0034502 Ga0495684_0034502_2328_3368 346
221 3300047472 Ga0495686_0001123 Ga0495686_0001123_27648_28691 346
222 3300047472 Ga0495686_0001299 Ga0495686_0001299_21120_22163 346
223 3300048928 Ga0496125_0000972 Ga0496125_0000972_4708_5748 346
224 3300048929 Ga0496126_0015471 Ga0496126_0015471_5743_6783 346
225 3300050511 nmdc:mga08y16_11927_c1 nmdc:mga08y16_11927_c1_360_1400 346
226 3300053122 Ga0500608_062855 Ga0500608_062855_76_1251 346
227 3300053125 Ga0500618_002133 Ga0500618_002133_3609_4649 346
228 3300053125 Ga0500618_015463 Ga0500618_015463_484_1527 346
229 3300053130 Ga0500642_0024768 Ga0500642_0024768_469_1512 346
230 3300053156 Ga0500622_0000012 Ga0500622_0000012_202050_203090 346
231 3300053156 Ga0500622_0000030 Ga0500622_0000030_192688_193728 346
232 3300053156 Ga0500622_0000925 Ga0500622_0000925_15669_16709 346
233 3300053156 Ga0500622_0001363 Ga0500622_0001363_341_1381 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

204

284

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

27

139

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k3g-assembly1.cif.gz_B crystal structure of 10-hydroxygeraniol dehydrogenase from cantharanthus roseus in complex with nadp+ 0.9808 1 343
8b26-assembly1.cif.gz_B dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga 0.9788 1 343
1yqx-assembly1.cif.gz_B sinapyl alcohol dehydrogenase at 2.5 angstrom resolution 0.9778 1 343
5vkt-assembly1.cif.gz_A cinnamyl alcohol dehydrogenases (sbcad4) from sorghum bicolor (l.) moench 0.9757 3 344
7cgu-assembly1.cif.gz_A crystal structure of abhar 0.9746 1 344
ID Description Score Start End Superfamily
af_P9WQC5_159_311_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9834 160 311 3.40.50.720
af_P9WQC5_8_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9834 8 250 3.40.50.720
af_C6TB56_4_167_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9833 1 162 3.90.180.10
af_A0A0R0FW40_1_100_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9814 63 162 3.90.180.10
af_P9WQC5_8_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9794 8 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q5YB18-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.99 3 212 GO:0008270
GO:0016616
AF-A0A6J4J240-F1-model_v4 Alcohol dehydrogenase (EC 1.1.1.1) 0.9863 1 239 GO:0004022
GO:0008270
AF-A0A2T0JMJ6-F1-model_v4 alcohol dehydrogenase (NADP(+)) (EC 1.1.1.2) 0.985 49 345 GO:0008270
GO:0016616
AF-A0A376BKX9-F1-model_v4 NADP-dependent alcohol dehydrogenase C 2 (EC 1.1.1.2) 0.9845 56 223 GO:0008106
GO:0008270
AF-A0A2N4T1H4-F1-model_v4 alcohol dehydrogenase (NADP(+)) (EC 1.1.1.2) 0.9827 1 344 GO:0008270
GO:0016616

Feature Viewer

pLDDT pTM Quality
93.99 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map