F346060

General Info

Members Datasets Scaffolds Average Seq Length
233 190 468 298

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10499253|Ga0105242_104992532
Length 311
Sequence MNILELHNLKKYFATQKAVDDLSFNVEQGGIFGLLGPNGAGKTTLLRMITGIFYPDEGEVIFDGKKFNPLTDIVKIGYMPEERGLYKKMKIGDQALYLARLKGLSHRDAMEKITFWFRRLEMETWWNKKVEDLSKGMSQKLQFVITVLHEPKLIILDEPFSGLDPVNANLIKDEIYGLAQRGSTIIFSTHRMEHVEEICDHIVLVNLGKKVLDGTVQQVKNDFKENKFNIQLDGMSSLIESPAFQIIGQKTNRFVVKINEGYKSNDVLKYFIDQQINIEAFNKILPSLNEIFIGLVENTKATSRPFQKAEA

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
27 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
47 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
48 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
49 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
50 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
51 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
52 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
53 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
58 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
59 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
60 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
61 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
62 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
63 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
64 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
65 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
66 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
67 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
68 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
69 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
70 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
71 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
72 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
73 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
74 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
75 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
76 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
77 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
80 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
81 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
82 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
83 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
84 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
85 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
86 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
87 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
88 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
97 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
98 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
99 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
100 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
101 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
102 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
103 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
104 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
105 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
106 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
107 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
108 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
109 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
110 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
111 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
112 2643221729 Bacillus sp. Root11 Isolate Unclassified
113 2643221730 Bacillus sp. Root131 Isolate Unclassified
114 2643221731 Bacillus sp. Root147 Isolate Unclassified
115 2643221732 Bacillus sp. Root239 Isolate Unclassified
116 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
117 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
118 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
119 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
120 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
121 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
122 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
123 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
124 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
125 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
126 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
127 2818991441 Niallia circulans 3243 Isolate Rhizosphere
128 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
129 2818991459 Paenibacillus sp. 597 Isolate Unclassified
130 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
131 2842882022 Bacillus sp. R-71893 Isolate Unclassified
132 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
133 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
134 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
135 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
136 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
137 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
138 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
139 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
140 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
141 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
142 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
143 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
144 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
145 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
146 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
147 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
148 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
149 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
150 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
151 2919720352 Priestia megaterium 4340 Isolate Unclassified
152 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
153 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
154 2929004312 Priestia megaterium 1104 Isolate Unclassified
155 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
156 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
157 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
158 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
159 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
160 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
161 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
162 2965761152 Bacillus sp. COPE52 Isolate Unclassified
163 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
164 2969141011 Bacillus velezensis MH25 Isolate Unclassified
165 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
166 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
167 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
168 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
169 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
170 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
171 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
172 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
173 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
174 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
175 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
176 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
177 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
178 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
179 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
180 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
181 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
182 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
183 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
184 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
185 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
186 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
187 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
188 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
189 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
190 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 58.8
Metatranscriptomes 0
Isolates 41.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.86
Bulb 0
Endosphere 8.15
Nodule 0
Rhizoplane 6.87
Rhizosphere 47.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10499253 3300009176 Bacteria 1157
2 JGI25151J46595_10003698 3300003187 Bacteria 8316
3 JGI25151J46595_10011286 3300003187 Bacteria 4113
4 JGI25151J46595_10011740 3300003187 Bacteria 4013
5 rootH1_10004972 3300003316 Bacteria 34087
6 rootH1_10004972 3300003323 Bacteria 2958
7 rootL2_10028608 3300003322 Bacteria 31444
8 rootH1_10073365 3300003316 Bacteria 2624
9 rootH1_10073365 3300003323 Bacteria 3138
10 Ga0055538_1000239 3300003751 Bacteria 30028
11 Ga0055532_1002981 3300003758 Bacteria 3152
12 Ga0055541_1000332 3300003841 Bacteria 14996
13 Ga0070658_10177858 3300005327 Bacteria 1790
14 Ga0070671_100037997 3300005355 Bacteria 3995
15 Ga0070679_100162122 3300005530 Bacteria 2210
16 Ga0070664_100477615 3300005564 Bacteria 1147
17 Ga0105251_10011073 3300009011 Bacteria 5174
18 Ga0105244_10003624 3300009036 Bacteria 10948
19 Ga0105244_10034451 3300009036 Bacteria 2665
20 Ga0105250_10001606 3300009092 Bacteria 12104
21 Ga0105245_10023683 3300009098 Bacteria 5390
22 Ga0105247_10005336 3300009101 Bacteria 8101
23 Ga0105243_10041593 3300009148 Bacteria 3594
24 Ga0105242_10044593 3300009176 Bacteria 3592
25 Ga0105246_10022742 3300011119 Bacteria 4049
26 Ga0157371_10140331 3300013102 Bacteria 1721
27 Ga0157369_10134724 3300013105 Bacteria 2616
28 Ga0157378_10011515 3300013297 Bacteria 7743
29 Ga0157378_10034767 3300013297 Bacteria 4456
30 Ga0157375_10016815 3300013308 Bacteria 6584
31 Ga0157377_10012768 3300014745 Bacteria 4234
32 Ga0157376_10073001 3300014969 Bacteria 2921
33 Ga0163161_10426585 3300017792 Bacteria 1068
34 Ga0209784_100283 3300025224 Bacteria 28568
35 Ga0209566_100033 3300025225 Bacteria 332650
36 Ga0209147_100306 3300025229 Bacteria 39217
37 Ga0209147_103176 3300025229 Bacteria 3371
38 Ga0209147_103381 3300025229 Bacteria 3148
39 Ga0209258_102890 3300025242 Bacteria 4063
40 Ga0209673_1002162 3300025273 Bacteria 14543
41 Ga0209675_1004029 3300025291 Bacteria 6692
42 Ga0209025_1002195 3300025294 Bacteria 21609
43 Ga0209025_1007653 3300025294 Bacteria 7986
44 Ga0209025_1011232 3300025294 Bacteria 5933
45 Ga0209025_1013306 3300025294 Bacteria 5184
46 Ga0209025_1018672 3300025294 Bacteria 3910
47 Ga0207696_1000562 3300025711 Bacteria 29341
48 Ga0207696_1003613 3300025711 Bacteria 6974
49 Ga0207655_1001538 3300025728 Bacteria 20855
50 Ga0207655_1029965 3300025728 Bacteria 2538
51 Ga0207655_1038965 3300025728 Bacteria 2070
52 Ga0207713_1001236 3300025735 Bacteria 21198
53 Ga0207713_1025844 3300025735 Bacteria 2702
54 Ga0207644_10172677 3300025931 Bacteria 1689
55 Ga0207686_10056026 3300025934 Bacteria 2476
56 Ga0207709_10022181 3300025935 Bacteria 3600
57 Ga0207679_10444400 3300025945 Bacteria 1149
58 Ga0207698_10177602 3300026142 Bacteria 1882
59 Ga0307408_100035818 3300031548 Bacteria 3485
60 Ga0395900_0026786 3300037418 Bacteria 5900
61 Ga0395898_0067867 3300037466 Bacteria 3452
62 Ga0395901_0047137 3300038443 Bacteria 4475
63 Ga0237819_00056 3300038705 Bacteria 39926
64 Ga0237819_00156 3300038705 Bacteria 25293
65 Ga0439436_0010037 3300041404 Bacteria 2895
66 Ga0439439_0001342 3300041406 Bacteria 4845
67 Ga0439433_0003964 3300041999 Bacteria 3186
68 Ga0439449_0005555 3300042007 Bacteria 4825
69 Ga0439449_0006025 3300042007 Bacteria 4631
70 Ga0439449_0032496 3300042007 Bacteria 1945
71 Ga0439457_018741 3300042014 Bacteria 1537
72 Ga0439462_0001740 3300042015 Bacteria 4920
73 Ga0439462_0002608 3300042015 Bacteria 4213
74 Ga0466969_0005615 3300044656 Bacteria 6669
75 Ga0466961_0050361 3300044693 Bacteria 2660
76 Ga0466968_0019296 3300044735 Bacteria 2745
77 Ga0466959_0014621 3300045049 Bacteria 5710
78 Ga0495603_0076764 3300046455 Bacteria 1960
79 Ga0495591_026909 3300046458 Bacteria 1779
80 Ga0495585_0116859 3300046492 Bacteria 1414
81 Ga0495597_0120509 3300046542 Bacteria 1094
82 Ga0495622_0103094 3300046557 Bacteria 1307
83 Ga0495661_0135182 3300046665 Bacteria 1347
84 Ga0495589_0024699 3300046794 Bacteria 3053
85 Ga0495660_0093933 3300046810 Bacteria 1554
86 Ga0495683_0152628 3300047323 Bacteria 1074
87 Ga0496100_0002001 3300048903 Bacteria 10199
88 Ga0496101_0004257 3300048904 Bacteria 8977
89 Ga0496102_0055119 3300048905 Bacteria 3625
90 Ga0496103_0002451 3300048906 Bacteria 11663
91 Ga0496104_0008270 3300048907 Bacteria 9239
92 Ga0496105_0000183 3300048908 Bacteria 41823
93 Ga0496106_0000328 3300048909 Bacteria 33629
94 Ga0496107_0000194 3300048910 Bacteria 31739
95 Ga0496108_0002635 3300048911 Bacteria 14375
96 Ga0496109_0007185 3300048912 Bacteria 9411
97 Ga0496110_0010009 3300048913 Bacteria 7693
98 Ga0496111_0127284 3300048914 Bacteria 1883
99 Ga0496112_0005588 3300048915 Bacteria 10900
100 Ga0496113_0035643 3300048916 Bacteria 3639
101 Ga0496116_0001233 3300048919 Bacteria 29792
102 Ga0496116_0004916 3300048919 Bacteria 12594
103 Ga0496116_0040817 3300048919 Bacteria 3190
104 Ga0496116_0059768 3300048919 Bacteria 2476
105 Ga0496116_0066847 3300048919 Bacteria 2298
106 Ga0496117_0005132 3300048920 Bacteria 13982
107 Ga0496117_0011445 3300048920 Bacteria 7948
108 Ga0496118_0010217 3300048921 Bacteria 9319
109 Ga0496119_0004555 3300048922 Bacteria 13729
110 Ga0496119_0023588 3300048922 Bacteria 4356
111 Ga0496119_0041565 3300048922 Bacteria 2925
112 Ga0496120_0001089 3300048923 Bacteria 35512
113 Ga0496120_0007250 3300048923 Bacteria 8295
114 Ga0496120_0155579 3300048923 Bacteria 1144
115 Ga0496121_0042584 3300048924 Bacteria 3945
116 Ga0496122_0007436 3300048925 Bacteria 12174
117 Ga0496122_0031022 3300048925 Bacteria 4460
118 Ga0496122_0047271 3300048925 Bacteria 3323
119 Ga0496122_0099874 3300048925 Bacteria 1944
120 Ga0496122_0127185 3300048925 Bacteria 1628
121 Ga0496123_0007939 3300048926 Bacteria 9851
122 Ga0496123_0055994 3300048926 Bacteria 2582
123 Ga0496123_0088668 3300048926 Bacteria 1846
124 Ga0496123_0090648 3300048926 Bacteria 1817
125 Ga0496124_0000128 3300048927 Bacteria 157194
126 Ga0496124_0001207 3300048927 Bacteria 40038
127 Ga0496124_0032781 3300048927 Bacteria 4582
128 Ga0496124_0115578 3300048927 Bacteria 2153
129 Ga0496125_0001560 3300048928 Bacteria 32687
130 Ga0496125_0038251 3300048928 Bacteria 4157
131 Ga0496125_0113230 3300048928 Bacteria 1958
132 Ga0496126_0003252 3300048929 Bacteria 20767
133 Ga0496126_0013163 3300048929 Bacteria 8437
134 Ga0496126_0056923 3300048929 Bacteria 3532
135 Ga0501032_0228498 3300049569 Bacteria 1210
136 Ga0501037_0100893 3300049573 Bacteria 2084
137 Ga0501070_0314638 3300049586 Bacteria 1274
138 Ga0501217_004329 3300049661 Bacteria 2913
139 Ga0501080_0217835 3300049742 Bacteria 1748
140 2511698917 2511231119 Bacteria 4019861
141 2524190394 2524023129 Bacteria 6762600
142 2545558132 2545555800 Bacteria 4222588
143 2550903444 2548877040 Bacteria 7507281
144 2563929484 2563366752 Bacteria 4961801
145 2571527935 2571042143 Bacteria 6986194
146 2573039169 2571042588 Bacteria 5045676
147 2578334952 2576861424 Bacteria 5270569
148 2578932551 2576861599 Bacteria 4217202
149 2580930074 2579778775 Bacteria 5360914
150 2600401543 2600254943 Bacteria 2613887
151 2601641662 2600255286 Bacteria 5390125
152 2621272971 2619619294 Bacteria 5575484
153 2631984850 2630968484 Bacteria 3876276
154 2643737767 2643221543 Bacteria 6628015
155 2644424428 2643221676 Bacteria 8119172
156 2644707658 2643221729 Bacteria 6621700
157 2644712308 2643221730 Bacteria 6523787
158 2644721036 2643221731 Bacteria 5623886
159 2644722562 2643221732 Bacteria 5756404
160 2651530166 2648501850 Bacteria 3975476
161 2674420224 2671180844 Bacteria 4164150
162 2695626840 2695420354 Bacteria 3922431
163 2698323988 2695420987 Bacteria 6152737
164 2717917345 2716884898 Bacteria 3928789
165 2723601964 2721755693 Bacteria 6126117
166 2728533280 2728368933 Bacteria 7044283
167 2730138051 2728369359 Bacteria 5621728
168 2753811918 2751185905 Bacteria 6142767
169 2793185834 2791355222 Bacteria 5898266
170 2802439356 2802428803 Bacteria 5806948
171 2819570095 2818991441 Bacteria 5062707
172 2819583004 2818991443 Bacteria 6598732
173 2819671435 2818991459 Bacteria 8736032
174 2819711666 2818991465 Bacteria 5388835
175 2842887231 2842882022 Bacteria 6158489
176 2857455187 2857453340 Bacteria 8090534
177 2864738432 2864733723 Bacteria 6770668
178 2865005860 2865002811 Bacteria 6333767
179 2877769659 2877768649 Bacteria 3957164
180 2880170656 2880169592 Bacteria 3900066
181 2881638636 2881636855 Bacteria 5205297
182 2888580071 2888578766 Bacteria 6743310
183 2889051319 2889049205 Bacteria 7524325
184 2889278039 2889276214 Bacteria 5979355
185 2897110640 2897109615 Bacteria 4009619
186 2904118821 2904113452 Bacteria 7796941
187 2904529661 2904524088 Bacteria 5887454
188 2904562993 2904560550 Bacteria 4029838
189 2904597971 2904595352 Bacteria 6124848
190 2904756335 2904755435 Bacteria 7986759
191 2907206292 2907202186 Bacteria 6632024
192 2919148826 2919143609 Bacteria 6219228
193 2919430816 2919425241 Bacteria 8055701
194 2919522292 2919517244 Bacteria 5858162
195 2919725535 2919720352 Bacteria 5986006
196 2925327864 2925326138 Bacteria 9652120
197 2928099172 2928093941 Bacteria 5965005
198 2929009217 2929004312 Bacteria 5678476
199 2936364698 2936361878 Bacteria 5632809
200 2938651228 2938649242 Bacteria 7118381
201 2939684503 2939679117 Bacteria 6921672
202 2939707420 2939702853 Bacteria 5139229
203 2947427070 2947426588 Bacteria 5357194
204 2960324732 2960319331 Bacteria 5502575
205 2960378165 2960375949 Bacteria 5361395
206 2965762490 2965761152 Bacteria 5806513
207 2968563163 2968558590 Bacteria 6956864
208 2969142108 2969141011 Bacteria 4118468
209 2971404092 2971403814 Bacteria 7370929
210 2971405394 2971403814 Bacteria 7370929
211 2971412482 2971410472 Bacteria 8311090
212 2971516715 2971511577 Bacteria 5404012
213 2971894407 2971893375 Bacteria 3929648
214 2979084902 2979083700 Bacteria 5894929
215 2980178994 2980176882 Bacteria 5397533
216 2980188515 2980182181 Bacteria 9454109
217 2984532507 2984527788 Bacteria 5288478
218 2984533765 2984532647 Bacteria 5288506
219 2988225764 2988225383 Bacteria 7221625
220 2996637259 2996632988 Bacteria 6921523
221 2996707254 2996706504 Bacteria 5757485
222 648168513 648028048 Bacteria 5394884
223 8002322958 8002317523 Bacteria 8051857
224 8022633867 8022630665 Bacteria 3886130
225 8022894656 8022893055 Bacteria 5300455
226 8022915182 8022914991 Bacteria 5584517
227 8051953522 8051952484 Bacteria 3926774
228 8052177057 8052174270 Bacteria 3881265
229 8054465862 8054465665 Bacteria 7323556
230 8055636589 8055632911 Bacteria 5283357
231 8056538356 8056533031 Bacteria 8964429
232 8057474842 8057473075 Bacteria 5892720
233 8057633734 8057632132 Bacteria 4726859
234 8057736210 8057733483 Bacteria 6578323
235 8057978340 8057977335 Bacteria 5694872
236 Ga0105242_10499253
237 JGI25151J46595_10003698
238 JGI25151J46595_10011286
239 JGI25151J46595_10011740
240 rootH1_10004972
241 rootL2_10028608
242 rootH1_10073365
243 Ga0055538_1000239
244 Ga0055532_1002981
245 Ga0055541_1000332
246 Ga0070658_10177858
247 Ga0070671_100037997
248 Ga0070679_100162122
249 Ga0070664_100477615
250 Ga0105251_10011073
251 Ga0105244_10003624
252 Ga0105244_10034451
253 Ga0105250_10001606
254 Ga0105245_10023683
255 Ga0105247_10005336
256 Ga0105243_10041593
257 Ga0105242_10044593
258 Ga0105246_10022742
259 Ga0157371_10140331
260 Ga0157369_10134724
261 Ga0157378_10011515
262 Ga0157378_10034767
263 Ga0157375_10016815
264 Ga0157377_10012768
265 Ga0157376_10073001
266 Ga0163161_10426585
267 Ga0209784_100283
268 Ga0209566_100033
269 Ga0209147_100306
270 Ga0209147_103176
271 Ga0209147_103381
272 Ga0209258_102890
273 Ga0209673_1002162
274 Ga0209675_1004029
275 Ga0209025_1002195
276 Ga0209025_1007653
277 Ga0209025_1011232
278 Ga0209025_1013306
279 Ga0209025_1018672
280 Ga0207696_1000562
281 Ga0207696_1003613
282 Ga0207655_1001538
283 Ga0207655_1029965
284 Ga0207655_1038965
285 Ga0207713_1001236
286 Ga0207713_1025844
287 Ga0207644_10172677
288 Ga0207686_10056026
289 Ga0207709_10022181
290 Ga0207679_10444400
291 Ga0207698_10177602
292 Ga0307408_100035818
293 Ga0395900_0026786
294 Ga0395898_0067867
295 Ga0395901_0047137
296 Ga0237819_00056
297 Ga0237819_00156
298 Ga0439436_0010037
299 Ga0439439_0001342
300 Ga0439433_0003964
301 Ga0439449_0005555
302 Ga0439449_0006025
303 Ga0439449_0032496
304 Ga0439457_018741
305 Ga0439462_0001740
306 Ga0439462_0002608
307 Ga0466969_0005615
308 Ga0466961_0050361
309 Ga0466968_0019296
310 Ga0466959_0014621
311 Ga0495603_0076764
312 Ga0495591_026909
313 Ga0495585_0116859
314 Ga0495597_0120509
315 Ga0495622_0103094
316 Ga0495661_0135182
317 Ga0495589_0024699
318 Ga0495660_0093933
319 Ga0495683_0152628
320 Ga0496100_0002001
321 Ga0496101_0004257
322 Ga0496102_0055119
323 Ga0496103_0002451
324 Ga0496104_0008270
325 Ga0496105_0000183
326 Ga0496106_0000328
327 Ga0496107_0000194
328 Ga0496108_0002635
329 Ga0496109_0007185
330 Ga0496110_0010009
331 Ga0496111_0127284
332 Ga0496112_0005588
333 Ga0496113_0035643
334 Ga0496116_0001233
335 Ga0496116_0004916
336 Ga0496116_0040817
337 Ga0496116_0059768
338 Ga0496116_0066847
339 Ga0496117_0005132
340 Ga0496117_0011445
341 Ga0496118_0010217
342 Ga0496119_0004555
343 Ga0496119_0023588
344 Ga0496119_0041565
345 Ga0496120_0001089
346 Ga0496120_0007250
347 Ga0496120_0155579
348 Ga0496121_0042584
349 Ga0496122_0007436
350 Ga0496122_0031022
351 Ga0496122_0047271
352 Ga0496122_0099874
353 Ga0496122_0127185
354 Ga0496123_0007939
355 Ga0496123_0055994
356 Ga0496123_0088668
357 Ga0496123_0090648
358 Ga0496124_0000128
359 Ga0496124_0001207
360 Ga0496124_0032781
361 Ga0496124_0115578
362 Ga0496125_0001560
363 Ga0496125_0038251
364 Ga0496125_0113230
365 Ga0496126_0003252
366 Ga0496126_0013163
367 Ga0496126_0056923
368 Ga0501032_0228498
369 Ga0501037_0100893
370 Ga0501070_0314638
371 Ga0501217_004329
372 Ga0501080_0217835
373 2511698917
374 2524190394
375 2545558132
376 2550903444
377 2563929484
378 2571527935
379 2573039169
380 2578334952
381 2578932551
382 2580930074
383 2600401543
384 2601641662
385 2621272971
386 2631984850
387 2643737767
388 2644424428
389 2644707658
390 2644712308
391 2644721036
392 2644722562
393 2651530166
394 2674420224
395 2695626840
396 2698323988
397 2717917345
398 2723601964
399 2728533280
400 2730138051
401 2753811918
402 2793185834
403 2802439356
404 2819570095
405 2819583004
406 2819671435
407 2819711666
408 2842887231
409 2857455187
410 2864738432
411 2865005860
412 2877769659
413 2880170656
414 2881638636
415 2888580071
416 2889051319
417 2889278039
418 2897110640
419 2904118821
420 2904529661
421 2904562993
422 2904597971
423 2904756335
424 2907206292
425 2919148826
426 2919430816
427 2919522292
428 2919725535
429 2925327864
430 2928099172
431 2929009217
432 2936364698
433 2938651228
434 2939684503
435 2939707420
436 2947427070
437 2960324732
438 2960378165
439 2965762490
440 2968563163
441 2969142108
442 2971404092
443 2971405394
444 2971412482
445 2971516715
446 2971894407
447 2979084902
448 2980178994
449 2980188515
450 2984532507
451 2984533765
452 2988225764
453 2996637259
454 2996707254
455 648168513
456 8002322958
457 8022633867
458 8022894656
459 8022915182
460 8051953522
461 8052177057
462 8054465862
463 8055636589
464 8056538356
465 8057474842
466 8057633734
467 8057736210
468 8057978340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13732

DUF4162

Domain of unknown function (DUF4162)

214

296

0.96

PF00005

ABC_tran

ABC transporter

19

161

0.95

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

107

195

0.9

PF13476

AAA_23

AAA domain

4

147

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9356 1 217
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9294 3 220
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.929 1 218
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.9269 1 218
8bmq-assembly1.cif.gz_B cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to amp-pnp 0.9266 3 221
ID Description Score Start End Superfamily
af_Q2FVS3_1_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9852 1 224 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9764 3 217 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9598 1 219 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9519 3 221 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9513 3 220 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0D1P4L1-F1-model_v4 deleted 0.9564 3 221
AF-A0A2U3CB58-F1-model_v4 ABC transporter domain-containing protein 0.9517 2 220 GO:0005524
GO:0016887
AF-A0A483IYM9-F1-model_v4 ABC transporter ATP-binding protein/permease 0.9477 3 221 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A2Z2I0C4-F1-model_v4 ABC transporter ATP-binding protein 0.9475 1 217 GO:0005524
GO:0016887
AF-A0A2D6BKC8-F1-model_v4 ABC transporter domain-containing protein 0.9465 3 208 GO:0005524
GO:0016887

Map