F346049

General Info

Members Datasets Scaffolds Average Seq Length
233 108 466 107

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10158727|Ga0114129_101587273
Length 130
Sequence LKDAPLVAEYPAVHDHIDQSYGRAMMKRVGFQFKVRQDRLAEYKEHHKHVWPEMLDALRQTGWHNYTLFMRADGLIFGYFETEESLAVAQAKMAAKDVNTRWQEFMSPFVDANARPDETFVELEEYFHLD

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
57 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
60 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
61 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
68 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
69 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
70 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
73 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
74 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
77 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
78 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
79 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
80 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
81 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
84 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
85 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.29
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 34.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10158727 3300009147 Unclassified 3092
2 SwRhRL2b_contig_1642998 2162886007 Bacteria 1104
3 JGI25406J46586_10010403 3300003203 Bacteria 4131
4 Ga0065704_10107359 3300005289 Bacteria 2058
5 Ga0065704_10275777 3300005289 Unclassified 933
6 Ga0065712_10381293 3300005290 Unclassified 752
7 Ga0065707_10086007 3300005295 Bacteria 5724
8 Ga0065707_10116170 3300005295 Bacteria 2200
9 Ga0065707_10192098 3300005295 Unclassified 1341
10 Ga0065707_10716798 3300005295 Unclassified 632
11 Ga0070682_100771008 3300005337 Bacteria 778
12 Ga0070689_100443094 3300005340 Unclassified 1104
13 Ga0070687_100519907 3300005343 Unclassified 804
14 Ga0070700_101405095 3300005441 Unclassified 590
15 Ga0070706_101594754 3300005467 Bacteria 595
16 Ga0070707_100287389 3300005468 Bacteria 1598
17 Ga0070698_100215046 3300005471 Unclassified 1856
18 Ga0070698_100298005 3300005471 Bacteria 1543
19 Ga0070698_100520246 3300005471 Bacteria 1128
20 Ga0070698_100746716 3300005471 Bacteria 921
21 Ga0070698_101299566 3300005471 Unclassified 677
22 Ga0070699_100008422 3300005518 Bacteria 8933
23 Ga0070699_100040942 3300005518 Bacteria 4010
24 Ga0070699_100442495 3300005518 Bacteria 1178
25 Ga0070695_100623091 3300005545 Unclassified 849
26 Ga0070695_101301686 3300005545 Unclassified 600
27 Ga0070695_101605598 3300005545 Bacteria 543
28 Ga0070696_100999000 3300005546 Bacteria 699
29 Ga0070704_100534669 3300005549 Bacteria 1022
30 Ga0070704_101016609 3300005549 Bacteria 750
31 Ga0070702_100596297 3300005615 Bacteria 827
32 Ga0068859_100605381 3300005617 Bacteria 1189
33 Ga0068859_101956331 3300005617 Bacteria 647
34 Ga0068864_100111787 3300005618 Bacteria 2434
35 Ga0068861_100940549 3300005719 Unclassified 821
36 Ga0068861_102194617 3300005719 Unclassified 553
37 Ga0068870_11456503 3300005840 Bacteria 503
38 Ga0068862_100013292 3300005844 Bacteria 6809
39 Ga0068862_100275572 3300005844 Bacteria 1540
40 Ga0068862_100935276 3300005844 Bacteria 854
41 Ga0068862_102099746 3300005844 Unclassified 576
42 Ga0081539_10001336 3300005985 Bacteria 42955
43 Ga0081539_10013994 3300005985 Bacteria 5981
44 Ga0081539_10360798 3300005985 Unclassified 609
45 Ga0070715_10078759 3300006163 Unclassified 1491
46 Ga0075427_10001297 3300006194 Bacteria 3199
47 Ga0075428_100506746 3300006844 Bacteria 1291
48 Ga0075428_100880114 3300006844 Bacteria 950
49 Ga0075428_101030493 3300006844 Bacteria 871
50 Ga0075428_101067600 3300006844 Unclassified 853
51 Ga0075428_102124431 3300006844 Unclassified 580
52 Ga0075430_100092159 3300006846 Unclassified 2534
53 Ga0075430_100281620 3300006846 Bacteria 1375
54 Ga0075430_100379911 3300006846 Bacteria 1166
55 Ga0075430_100436071 3300006846 Bacteria 1081
56 Ga0075431_100037274 3300006847 Bacteria 5011
57 Ga0075431_100144976 3300006847 Bacteria 2447
58 Ga0075431_100432542 3300006847 Unclassified 1314
59 Ga0075431_100447822 3300006847 Bacteria 1287
60 Ga0075431_100995680 3300006847 Unclassified 805
61 Ga0075431_101384481 3300006847 Bacteria 663
62 Ga0075433_10460879 3300006852 Unclassified 1120
63 Ga0075433_10475547 3300006852 Bacteria 1101
64 Ga0075433_10867278 3300006852 Bacteria 788
65 Ga0075434_100063136 3300006871 Bacteria 3687
66 Ga0075429_100003963 3300006880 Bacteria 12661
67 Ga0075429_100036167 3300006880 Bacteria 4294
68 Ga0075429_100123008 3300006880 Bacteria 2268
69 Ga0075429_100215911 3300006880 Unclassified 1680
70 Ga0075429_100230363 3300006880 Bacteria 1623
71 Ga0075429_100254518 3300006880 Bacteria 1538
72 Ga0075429_100262676 3300006880 Bacteria 1511
73 Ga0075429_100538356 3300006880 Bacteria 1023
74 Ga0075429_100756353 3300006880 Unclassified 851
75 Ga0097620_100605413 3300006931 Bacteria 1189
76 Ga0097620_101956634 3300006931 Bacteria 647
77 Ga0075435_100202044 3300007076 Bacteria 1684
78 Ga0111539_10875134 3300009094 Unclassified 1045
79 Ga0111539_12382073 3300009094 Unclassified 614
80 Ga0105245_12495019 3300009098 Bacteria 570
81 Ga0114129_10007678 3300009147 Bacteria 15350
82 Ga0114129_10030848 3300009147 Bacteria 7581
83 Ga0114129_10334516 3300009147 Bacteria 2010
84 Ga0114129_10919182 3300009147 Bacteria 1107
85 Ga0114129_11142541 3300009147 Bacteria 973
86 Ga0114129_11217695 3300009147 Unclassified 937
87 Ga0114129_12816722 3300009147 Bacteria 577
88 Ga0105243_10138591 3300009148 Bacteria 2072
89 Ga0105243_10269975 3300009148 Bacteria 1527
90 Ga0105248_13240493 3300009177 Unclassified 518
91 Ga0105237_11335463 3300009545 Unclassified 723
92 Ga0105249_10993941 3300009553 Unclassified 908
93 Ga0163162_10642497 3300013306 Bacteria 1185
94 Ga0157375_10285455 3300013308 Bacteria 1814
95 Ga0157380_10578892 3300014326 Bacteria 1107
96 Ga0163161_10013988 3300017792 Bacteria 5588
97 Ga0207684_10402819 3300025910 Bacteria 1176
98 Ga0207662_10576073 3300025918 Unclassified 781
99 Ga0207646_10148384 3300025922 Bacteria 2114
100 Ga0207709_10157307 3300025935 Bacteria 1581
101 Ga0207709_10465507 3300025935 Unclassified 980
102 Ga0207670_10063225 3300025936 Bacteria 2532
103 Ga0207670_10294485 3300025936 Unclassified 1269
104 Ga0207712_10051143 3300025961 Bacteria 2888
105 Ga0207676_10500289 3300026095 Bacteria 1154
106 Ga0207675_101089089 3300026118 Unclassified 819
107 Ga0207675_101205279 3300026118 Unclassified 777
108 Ga0209968_1005439 3300027526 Bacteria 1917
109 Ga0209966_1083692 3300027695 Unclassified 709
110 Ga0268265_10058155 3300028380 Bacteria 2951
111 Ga0268265_10227442 3300028380 Bacteria 1637
112 Ga0268265_10522672 3300028380 Bacteria 1122
113 Ga0265323_10102376 3300028653 Unclassified 946
114 Ga0316575_10005638 3300031665 Bacteria 4469
115 Ga0316579_10022275 3300031691 Unclassified 2832
116 Ga0316579_10039929 3300031691 Bacteria 2175
117 Ga0316579_10184613 3300031691 Bacteria 1008
118 Ga0316579_10350281 3300031691 Unclassified 714
119 Ga0316576_10113440 3300031727 Bacteria 2032
120 Ga0316576_10151342 3300031727 Bacteria 1748
121 Ga0316576_10192212 3300031727 Bacteria 1538
122 Ga0316578_10002652 3300031728 Bacteria 7941
123 Ga0316578_10152413 3300031728 Bacteria 1393
124 Ga0316578_10390425 3300031728 Unclassified 825
125 Ga0316578_10674933 3300031728 Unclassified 602
126 Ga0316578_10708994 3300031728 Bacteria 586
127 Ga0316577_10009970 3300031733 Bacteria 5123
128 Ga0316577_10050702 3300031733 Bacteria 2317
129 Ga0316577_10131908 3300031733 Bacteria 1406
130 Ga0316577_10319718 3300031733 Bacteria 880
131 Ga0316577_10439332 3300031733 Unclassified 741
132 Ga0316577_10591162 3300031733 Unclassified 631
133 Ga0307413_11420095 3300031824 Unclassified 611
134 Ga0307410_10727042 3300031852 Bacteria 839
135 Ga0307406_10188273 3300031901 Bacteria 1509
136 Ga0307416_102428793 3300032002 Bacteria 623
137 Ga0307415_100218603 3300032126 Bacteria 1526
138 Ga0316583_10009717 3300032133 Bacteria 3466
139 Ga0316585_10000171 3300032137 Bacteria 13105
140 Ga0316585_10286842 3300032137 Unclassified 546
141 Ga0316580_10001445 3300032139 Bacteria 6209
142 Ga0316580_10003741 3300032139 Bacteria 4357
143 Ga0316592_1092937 3300033524 Unclassified 691
144 Ga0316596_1073291 3300033541 Unclassified 918
145 Ga0373959_0178187 3300034820 Unclassified 551
146 Ga0316574_0071144 3300035398 Bacteria 2196
147 Ga0316574_0429512 3300035398 Unclassified 829
148 Ga0316582_0028976 3300036647 Bacteria 3358
149 Ga0316582_0100988 3300036647 Bacteria 1910
150 Ga0316582_0264461 3300036647 Unclassified 1179
151 Ga0316582_0609841 3300036647 Bacteria 751
152 Ga0316582_0622444 3300036647 Unclassified 743
153 Ga0316582_0634451 3300036647 Bacteria 735
154 Ga0316582_1245936 3300036647 Unclassified 506
155 Ga0316584_0002663 3300036712 Bacteria 11395
156 Ga0316584_0030975 3300036712 Bacteria 3955
157 Ga0316584_0142979 3300036712 Bacteria 1783
158 Ga0316584_0229170 3300036712 Bacteria 1362
159 Ga0316584_0436834 3300036712 Bacteria 928
160 Ga0316581_0021211 3300037588 Bacteria 1906
161 Ga0439439_0100382 3300041406 Bacteria 796
162 Ga0451795_1250976 3300041456 Unclassified 694
163 Ga0439433_0000489 3300041999 Bacteria 7352
164 Ga0439442_038082 3300042002 Bacteria 1008
165 Ga0439432_171678 3300042006 Bacteria 633
166 Ga0439449_0004226 3300042007 Bacteria 5551
167 Ga0439457_117855 3300042014 Bacteria 626
168 Ga0439462_0150038 3300042015 Bacteria 655
169 Ga0439434_0090175 3300042435 Bacteria 979
170 Ga0451577_0082044 3300042876 Bacteria 2876
171 Ga0451577_0472996 3300042876 Unclassified 1138
172 Ga0451577_0958617 3300042876 Unclassified 769
173 Ga0466972_0027709 3300044658 Bacteria 2802
174 Ga0453683_0162674 3300044673 Unclassified 1412
175 Ga0453683_0481972 3300044673 Unclassified 804
176 Ga0453683_0723467 3300044673 Bacteria 653
177 Ga0466965_0003496 3300044683 Bacteria 6894
178 Ga0453684_0001413 3300044712 Bacteria 69115
179 Ga0453684_0013248 3300044712 Bacteria 13432
180 Ga0453684_0315767 3300044712 Bacteria 1771
181 Ga0453684_0324724 3300044712 Unclassified 1742
182 Ga0453684_0394330 3300044712 Unclassified 1552
183 Ga0453684_0634605 3300044712 Unclassified 1167
184 Ga0453684_0830983 3300044712 Unclassified 994
185 Ga0453684_1179163 3300044712 Unclassified 805
186 Ga0453684_1563232 3300044712 Unclassified 678
187 Ga0453684_1642461 3300044712 Unclassified 658
188 Ga0453684_2439501 3300044712 Unclassified 517
189 Ga0453684_2564072 3300044712 Unclassified 502
190 Ga0466968_0002811 3300044735 Bacteria 6432
191 Ga0451576_0017374 3300045051 Bacteria 7911
192 Ga0451576_0074195 3300045051 Bacteria 3540
193 Ga0451576_0084942 3300045051 Bacteria 3292
194 Ga0451576_0196990 3300045051 Bacteria 2104
195 Ga0451576_0672818 3300045051 Unclassified 1088
196 Ga0451576_0731887 3300045051 Unclassified 1039
197 Ga0451576_1638475 3300045051 Bacteria 667
198 Ga0451576_1912599 3300045051 Unclassified 612
199 Ga0495603_0358285 3300046455 Bacteria 837
200 Ga0495622_0150119 3300046557 Bacteria 1055
201 Ga0496108_0280433 3300048911 Bacteria 1451
202 Ga0496114_0030807 3300048917 Bacteria 4413
203 Ga0501299_059557 3300049522 Unclassified 806
204 Ga0501048_0331239 3300049582 Bacteria 1085
205 Ga0501072_0903060 3300049588 Bacteria 690
206 Ga0501076_0201137 3300049592 Unclassified 1627
207 Ga0501081_0427823 3300049743 Bacteria 982
208 nmdc:mga05p37_1841_c1 3300050507 Bacteria 15100
209 nmdc:mga05p37_1977224_c1 3300050507 Bacteria 553
210 nmdc:mga05p37_269459_c1 3300050507 Bacteria 2035
211 nmdc:mga05p37_301141_c1 3300050507 Unclassified 1905
212 nmdc:mga05p37_484001_c1 3300050507 Bacteria 1425
213 nmdc:mga05p37_744140_c1 3300050507 Bacteria 1082
214 nmdc:mga05p37_847272_c1 3300050507 Unclassified 993
215 nmdc:mga05p37_9105_c1 3300050507 Bacteria 11735
216 nmdc:mga09592_129979_c1 3300050508 Bacteria 2167
217 nmdc:mga09592_245280_c1 3300050508 Unclassified 1552
218 nmdc:mga09592_250293_c1 3300050508 Bacteria 1536
219 nmdc:mga09592_26134_c1 3300050508 Bacteria 4835
220 nmdc:mga09592_475534_c1 3300050508 Bacteria 1077
221 nmdc:mga09592_675295_c1 3300050508 Unclassified 881
222 nmdc:mga09592_849640_c1 3300050508 Bacteria 770
223 nmdc:mga0qj67_1351429_c1 3300050509 Bacteria 551
224 nmdc:mga0qj67_485878_c1 3300050509 Bacteria 993
225 nmdc:mga0qj67_827445_c1 3300050509 Unclassified 732
226 nmdc:mga0qj67_89926_c1 3300050509 Unclassified 2466
227 nmdc:mga06r32_357154_c1 3300050510 Bacteria 1445
228 nmdc:mga06r32_764070_c1 3300050510 Unclassified 929
229 nmdc:mga0rr50_61939_c2 3300050513 Bacteria 2165
230 nmdc:mga0a205_10867_c1 3300050515 Bacteria 8375
231 nmdc:mga0a205_666225_c1 3300050515 Unclassified 891
232 nmdc:mga0a205_782786_c1 3300050515 Bacteria 802
233 Ga0530510_0477024 3300061734 Unclassified 945
234 Ga0114129_10158727
235 SwRhRL2b_contig_1642998
236 JGI25406J46586_10010403
237 Ga0065704_10107359
238 Ga0065704_10275777
239 Ga0065712_10381293
240 Ga0065707_10086007
241 Ga0065707_10116170
242 Ga0065707_10192098
243 Ga0065707_10716798
244 Ga0070682_100771008
245 Ga0070689_100443094
246 Ga0070687_100519907
247 Ga0070700_101405095
248 Ga0070706_101594754
249 Ga0070707_100287389
250 Ga0070698_100215046
251 Ga0070698_100298005
252 Ga0070698_100520246
253 Ga0070698_100746716
254 Ga0070698_101299566
255 Ga0070699_100008422
256 Ga0070699_100040942
257 Ga0070699_100442495
258 Ga0070695_100623091
259 Ga0070695_101301686
260 Ga0070695_101605598
261 Ga0070696_100999000
262 Ga0070704_100534669
263 Ga0070704_101016609
264 Ga0070702_100596297
265 Ga0068859_100605381
266 Ga0068859_101956331
267 Ga0068864_100111787
268 Ga0068861_100940549
269 Ga0068861_102194617
270 Ga0068870_11456503
271 Ga0068862_100013292
272 Ga0068862_100275572
273 Ga0068862_100935276
274 Ga0068862_102099746
275 Ga0081539_10001336
276 Ga0081539_10013994
277 Ga0081539_10360798
278 Ga0070715_10078759
279 Ga0075427_10001297
280 Ga0075428_100506746
281 Ga0075428_100880114
282 Ga0075428_101030493
283 Ga0075428_101067600
284 Ga0075428_102124431
285 Ga0075430_100092159
286 Ga0075430_100281620
287 Ga0075430_100379911
288 Ga0075430_100436071
289 Ga0075431_100037274
290 Ga0075431_100144976
291 Ga0075431_100432542
292 Ga0075431_100447822
293 Ga0075431_100995680
294 Ga0075431_101384481
295 Ga0075433_10460879
296 Ga0075433_10475547
297 Ga0075433_10867278
298 Ga0075434_100063136
299 Ga0075429_100003963
300 Ga0075429_100036167
301 Ga0075429_100123008
302 Ga0075429_100215911
303 Ga0075429_100230363
304 Ga0075429_100254518
305 Ga0075429_100262676
306 Ga0075429_100538356
307 Ga0075429_100756353
308 Ga0097620_100605413
309 Ga0097620_101956634
310 Ga0075435_100202044
311 Ga0111539_10875134
312 Ga0111539_12382073
313 Ga0105245_12495019
314 Ga0114129_10007678
315 Ga0114129_10030848
316 Ga0114129_10334516
317 Ga0114129_10919182
318 Ga0114129_11142541
319 Ga0114129_11217695
320 Ga0114129_12816722
321 Ga0105243_10138591
322 Ga0105243_10269975
323 Ga0105248_13240493
324 Ga0105237_11335463
325 Ga0105249_10993941
326 Ga0163162_10642497
327 Ga0157375_10285455
328 Ga0157380_10578892
329 Ga0163161_10013988
330 Ga0207684_10402819
331 Ga0207662_10576073
332 Ga0207646_10148384
333 Ga0207709_10157307
334 Ga0207709_10465507
335 Ga0207670_10063225
336 Ga0207670_10294485
337 Ga0207712_10051143
338 Ga0207676_10500289
339 Ga0207675_101089089
340 Ga0207675_101205279
341 Ga0209968_1005439
342 Ga0209966_1083692
343 Ga0268265_10058155
344 Ga0268265_10227442
345 Ga0268265_10522672
346 Ga0265323_10102376
347 Ga0316575_10005638
348 Ga0316579_10022275
349 Ga0316579_10039929
350 Ga0316579_10184613
351 Ga0316579_10350281
352 Ga0316576_10113440
353 Ga0316576_10151342
354 Ga0316576_10192212
355 Ga0316578_10002652
356 Ga0316578_10152413
357 Ga0316578_10390425
358 Ga0316578_10674933
359 Ga0316578_10708994
360 Ga0316577_10009970
361 Ga0316577_10050702
362 Ga0316577_10131908
363 Ga0316577_10319718
364 Ga0316577_10439332
365 Ga0316577_10591162
366 Ga0307413_11420095
367 Ga0307410_10727042
368 Ga0307406_10188273
369 Ga0307416_102428793
370 Ga0307415_100218603
371 Ga0316583_10009717
372 Ga0316585_10000171
373 Ga0316585_10286842
374 Ga0316580_10001445
375 Ga0316580_10003741
376 Ga0316592_1092937
377 Ga0316596_1073291
378 Ga0373959_0178187
379 Ga0316574_0071144
380 Ga0316574_0429512
381 Ga0316582_0028976
382 Ga0316582_0100988
383 Ga0316582_0264461
384 Ga0316582_0609841
385 Ga0316582_0622444
386 Ga0316582_0634451
387 Ga0316582_1245936
388 Ga0316584_0002663
389 Ga0316584_0030975
390 Ga0316584_0142979
391 Ga0316584_0229170
392 Ga0316584_0436834
393 Ga0316581_0021211
394 Ga0439439_0100382
395 Ga0451795_1250976
396 Ga0439433_0000489
397 Ga0439442_038082
398 Ga0439432_171678
399 Ga0439449_0004226
400 Ga0439457_117855
401 Ga0439462_0150038
402 Ga0439434_0090175
403 Ga0451577_0082044
404 Ga0451577_0472996
405 Ga0451577_0958617
406 Ga0466972_0027709
407 Ga0453683_0162674
408 Ga0453683_0481972
409 Ga0453683_0723467
410 Ga0466965_0003496
411 Ga0453684_0001413
412 Ga0453684_0013248
413 Ga0453684_0315767
414 Ga0453684_0324724
415 Ga0453684_0394330
416 Ga0453684_0634605
417 Ga0453684_0830983
418 Ga0453684_1179163
419 Ga0453684_1563232
420 Ga0453684_1642461
421 Ga0453684_2439501
422 Ga0453684_2564072
423 Ga0466968_0002811
424 Ga0451576_0017374
425 Ga0451576_0074195
426 Ga0451576_0084942
427 Ga0451576_0196990
428 Ga0451576_0672818
429 Ga0451576_0731887
430 Ga0451576_1638475
431 Ga0451576_1912599
432 Ga0495603_0358285
433 Ga0495622_0150119
434 Ga0496108_0280433
435 Ga0496114_0030807
436 Ga0501299_059557
437 Ga0501048_0331239
438 Ga0501072_0903060
439 Ga0501076_0201137
440 Ga0501081_0427823
441 nmdc:mga05p37_1841_c1
442 nmdc:mga05p37_1977224_c1
443 nmdc:mga05p37_269459_c1
444 nmdc:mga05p37_301141_c1
445 nmdc:mga05p37_484001_c1
446 nmdc:mga05p37_744140_c1
447 nmdc:mga05p37_847272_c1
448 nmdc:mga05p37_9105_c1
449 nmdc:mga09592_129979_c1
450 nmdc:mga09592_245280_c1
451 nmdc:mga09592_250293_c1
452 nmdc:mga09592_26134_c1
453 nmdc:mga09592_475534_c1
454 nmdc:mga09592_675295_c1
455 nmdc:mga09592_849640_c1
456 nmdc:mga0qj67_1351429_c1
457 nmdc:mga0qj67_485878_c1
458 nmdc:mga0qj67_827445_c1
459 nmdc:mga0qj67_89926_c1
460 nmdc:mga06r32_357154_c1
461 nmdc:mga06r32_764070_c1
462 nmdc:mga0rr50_61939_c2
463 nmdc:mga0a205_10867_c1
464 nmdc:mga0a205_666225_c1
465 nmdc:mga0a205_782786_c1
466 Ga0530510_0477024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

28

129

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8261 3 105
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.813 1 105
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.806 1 105
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.805 3 105
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.7911 1 105
ID Description Score Start End Superfamily
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8256 1 98 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.818 1 98 3.30.70.100
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8057 2 93 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7936 2 102 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7726 2 102 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2V9QIW7-F1-model_v4 L-rhamnose/proton symporter RhaT 0.9826 1 85 GO:0005886
GO:0015153
GO:0015293
GO:0016857
GO:0019301
AF-A0A2V9XGE6-F1-model_v4 L-rhamnose mutarotase 0.9819 1 87 GO:0016857
GO:0019301
AF-X1DUB9-F1-model_v4 L-rhamnose mutarotase 0.9647 1 72 GO:0016857
GO:0019301
AF-Q5BRL3-F1-model_v4 SJCHGC07853 protein 0.964 3 66 GO:0016857
GO:0019301
AF-A0A7V9DG13-F1-model_v4 L-rhamnose mutarotase 0.9634 1 59 GO:0016857
GO:0019301

Map