F345946

General Info

Members Datasets Scaffolds Average Seq Length
233 143 466 132

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10065123|Ga0081539_100651231
Length 140
Sequence MSTTLEGKKVLVVDDDQDILSSIQAAFEPTGATIETATNGNRAVEIAEKSQPDLVVLDMMLPGRSGFLVLEKIKAKKPRNSKPYVIMITGNQGARHKMYAESLGVSEYFNKPVKLDKLIASAEKLLGPAAAGAAGPAPTT

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
135 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 2.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 99.14
Stem 0
Stem Tuber 0
Unclassified 15.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10065123 3300005985 Bacteria 1980
2 Ga0058861_11652696 3300004800 Unclassified 537
3 Ga0070658_10703812 3300005327 Unclassified 877
4 Ga0070683_100891707 3300005329 Bacteria 853
5 Ga0070683_102434985 3300005329 Unclassified 502
6 Ga0070670_100125134 3300005331 Bacteria 2219
7 Ga0070670_100717208 3300005331 Bacteria 900
8 Ga0068869_100783772 3300005334 Bacteria 818
9 Ga0070666_10551423 3300005335 Bacteria 838
10 Ga0070682_100855051 3300005337 Bacteria 744
11 Ga0070668_100280136 3300005347 Bacteria 1392
12 Ga0070671_100054404 3300005355 Bacteria 3328
13 Ga0070671_100299276 3300005355 Bacteria 1370
14 Ga0070671_101386471 3300005355 Unclassified 621
15 Ga0070674_100234772 3300005356 Bacteria 1433
16 Ga0070673_100714423 3300005364 Bacteria 921
17 Ga0070659_100034888 3300005366 Bacteria 3915
18 Ga0070667_100109774 3300005367 Bacteria 2391
19 Ga0070667_100197368 3300005367 Bacteria 1784
20 Ga0070667_101958512 3300005367 Bacteria 552
21 Ga0070714_100216581 3300005435 Bacteria 1758
22 Ga0070714_100229627 3300005435 Bacteria 1709
23 Ga0070714_100331078 3300005435 Bacteria 1426
24 Ga0070713_100856053 3300005436 Bacteria 873
25 Ga0070663_100213836 3300005455 Bacteria 1511
26 Ga0070681_11387998 3300005458 Unclassified 626
27 Ga0070685_10467930 3300005466 Bacteria 886
28 Ga0070706_100140779 3300005467 Bacteria 2252
29 Ga0070684_100297974 3300005535 Bacteria 1479
30 Ga0070684_101061469 3300005535 Bacteria 761
31 Ga0068853_100807907 3300005539 Unclassified 898
32 Ga0068853_101553724 3300005539 Bacteria 641
33 Ga0070672_100177409 3300005543 Bacteria 1774
34 Ga0070665_100004143 3300005548 Bacteria 15251
35 Ga0070665_100332490 3300005548 Bacteria 1524
36 Ga0070665_101502663 3300005548 Bacteria 682
37 Ga0070665_101634718 3300005548 Bacteria 652
38 Ga0068857_100014023 3300005577 Bacteria 6974
39 Ga0068852_100841717 3300005616 Bacteria 933
40 Ga0068852_101185135 3300005616 Bacteria 785
41 Ga0068864_100402982 3300005618 Bacteria 1300
42 Ga0068863_100195567 3300005841 Bacteria 1944
43 Ga0068860_100136216 3300005843 Bacteria 2358
44 Ga0068862_100280363 3300005844 Bacteria 1527
45 Ga0068862_101908361 3300005844 Bacteria 604
46 Ga0070717_10172823 3300006028 Bacteria 1880
47 Ga0070717_11641773 3300006028 Unclassified 582
48 Ga0075430_100023899 3300006846 Bacteria 5204
49 Ga0075429_100579739 3300006880 Bacteria 983
50 Ga0105240_11388236 3300009093 Bacteria 739
51 Ga0105240_11898157 3300009093 Unclassified 620
52 Ga0105245_10133487 3300009098 Bacteria 2331
53 Ga0105245_10371320 3300009098 Unclassified 1422
54 Ga0105245_11487152 3300009098 Unclassified 728
55 Ga0105245_12208130 3300009098 Bacteria 604
56 Ga0114129_11501204 3300009147 Bacteria 828
57 Ga0105243_11910019 3300009148 Bacteria 627
58 Ga0105243_12145455 3300009148 Unclassified 595
59 Ga0105241_10016878 3300009174 Bacteria 5358
60 Ga0105241_11150747 3300009174 Bacteria 733
61 Ga0105241_12146127 3300009174 Bacteria 553
62 Ga0105248_12262110 3300009177 Bacteria 619
63 Ga0105237_10196356 3300009545 Bacteria 2018
64 Ga0105237_10274321 3300009545 Bacteria 1689
65 Ga0105237_10631160 3300009545 Bacteria 1078
66 Ga0105238_10739774 3300009551 Bacteria 997
67 Ga0105238_12433374 3300009551 Bacteria 559
68 Ga0105249_10316875 3300009553 Bacteria 1570
69 Ga0105249_10557355 3300009553 Bacteria 1197
70 Ga0105249_11926283 3300009553 Bacteria 664
71 Ga0105249_12451729 3300009553 Bacteria 594
72 Ga0105239_10008877 3300010375 Bacteria 11376
73 Ga0105239_10527252 3300010375 Bacteria 1344
74 Ga0105246_11202523 3300011119 Bacteria 698
75 Ga0157373_10223589 3300013100 Bacteria 1328
76 Ga0157371_10055422 3300013102 Bacteria 2813
77 Ga0157371_10234238 3300013102 Bacteria 1320
78 Ga0157371_10241188 3300013102 Bacteria 1300
79 Ga0157371_10347672 3300013102 Bacteria 1079
80 Ga0157371_10719635 3300013102 Bacteria 748
81 Ga0157371_11078499 3300013102 Bacteria 615
82 Ga0157370_10083770 3300013104 Bacteria 2998
83 Ga0157370_10893814 3300013104 Bacteria 806
84 Ga0157370_11349753 3300013104 Bacteria 642
85 Ga0157369_10127020 3300013105 Bacteria 2703
86 Ga0157369_10147950 3300013105 Bacteria 2483
87 Ga0157369_10389164 3300013105 Bacteria 1447
88 Ga0157369_10972884 3300013105 Bacteria 869
89 Ga0157374_10109582 3300013296 Bacteria 2654
90 Ga0157374_10851349 3300013296 Bacteria 929
91 Ga0157374_10918216 3300013296 Bacteria 893
92 Ga0157374_11548010 3300013296 Bacteria 687
93 Ga0157374_11631955 3300013296 Bacteria 669
94 Ga0157378_10238057 3300013297 Bacteria 1738
95 Ga0157378_12329720 3300013297 Bacteria 587
96 Ga0163162_10892286 3300013306 Bacteria 1003
97 Ga0163162_12865508 3300013306 Bacteria 555
98 Ga0157372_10035024 3300013307 Bacteria 5524
99 Ga0157372_10049068 3300013307 Bacteria 4693
100 Ga0157372_10104763 3300013307 Bacteria 3234
101 Ga0157372_10335641 3300013307 Bacteria 1760
102 Ga0157372_10414262 3300013307 Bacteria 1570
103 Ga0157372_10885939 3300013307 Unclassified 1036
104 Ga0157372_10922857 3300013307 Unclassified 1012
105 Ga0157372_11271082 3300013307 Bacteria 850
106 Ga0157372_12191351 3300013307 Bacteria 635
107 Ga0157375_12885743 3300013308 Bacteria 574
108 Ga0163163_13095352 3300014325 Bacteria 519
109 Ga0157380_10548473 3300014326 Bacteria 1133
110 Ga0182008_10217918 3300014497 Bacteria 976
111 Ga0157379_10037426 3300014968 Unclassified 4326
112 Ga0197907_10481626 3300020069 Unclassified 531
113 Ga0206356_10829392 3300020070 Bacteria 612
114 Ga0206355_1462532 3300020076 Unclassified 538
115 Ga0206353_10813098 3300020082 Unclassified 632
116 Ga0207699_10341919 3300025906 Bacteria 1054
117 Ga0207705_10026392 3300025909 Bacteria 4142
118 Ga0207705_10839467 3300025909 Bacteria 712
119 Ga0207684_10245935 3300025910 Bacteria 1543
120 Ga0207654_10238232 3300025911 Bacteria 1215
121 Ga0207649_10767528 3300025920 Bacteria 751
122 Ga0207681_10191972 3300025923 Bacteria 1563
123 Ga0207681_10827008 3300025923 Bacteria 774
124 Ga0207681_10978408 3300025923 Bacteria 710
125 Ga0207694_11208782 3300025924 Bacteria 640
126 Ga0207650_10118641 3300025925 Bacteria 2057
127 Ga0207650_10383779 3300025925 Bacteria 1160
128 Ga0207659_10136886 3300025926 Bacteria 1897
129 Ga0207687_10082069 3300025927 Bacteria 2331
130 Ga0207687_10149232 3300025927 Unclassified 1782
131 Ga0207687_10809129 3300025927 Unclassified 799
132 Ga0207700_11487343 3300025928 Bacteria 601
133 Ga0207664_10291509 3300025929 Bacteria 1434
134 Ga0207664_10529006 3300025929 Bacteria 1057
135 Ga0207644_10016864 3300025931 Bacteria 4921
136 Ga0207644_10034759 3300025931 Bacteria 3528
137 Ga0207704_11548064 3300025938 Bacteria 569
138 Ga0207691_10099588 3300025940 Bacteria 2595
139 Ga0207661_10635468 3300025944 Bacteria 981
140 Ga0207679_10126790 3300025945 Bacteria 2041
141 Ga0207679_10597058 3300025945 Bacteria 994
142 Ga0207667_10445984 3300025949 Bacteria 1315
143 Ga0207651_10147428 3300025960 Bacteria 1827
144 Ga0207712_10203857 3300025961 Bacteria 1570
145 Ga0207712_10329493 3300025961 Bacteria 1262
146 Ga0207668_10371008 3300025972 Bacteria 1202
147 Ga0207658_10099010 3300025986 Bacteria 2279
148 Ga0207658_10174189 3300025986 Bacteria 1776
149 Ga0207639_10525084 3300026041 Bacteria 1084
150 Ga0207639_10698095 3300026041 Unclassified 941
151 Ga0207702_10926456 3300026078 Bacteria 864
152 Ga0207641_10760612 3300026088 Bacteria 957
153 Ga0207648_11184420 3300026089 Bacteria 717
154 Ga0207674_10004833 3300026116 Bacteria 16142
155 Ga0207674_10393682 3300026116 Bacteria 1339
156 Ga0207698_10407712 3300026142 Bacteria 1301
157 Ga0268266_10002629 3300028379 Bacteria 18966
158 Ga0268266_10168469 3300028379 Bacteria 1987
159 Ga0268266_10639134 3300028379 Bacteria 1024
160 Ga0268265_10237039 3300028380 Bacteria 1607
161 Ga0268264_10116115 3300028381 Bacteria 2352
162 Ga0268264_11561362 3300028381 Bacteria 671
163 Ga0265338_10197244 3300028800 Bacteria 1521
164 Ga0265777_119183 3300030877 Unclassified 556
165 Ga0265320_10158040 3300031240 Bacteria 1022
166 Ga0265339_10004165 3300031249 Bacteria 9930
167 Ga0307405_10335213 3300031731 Bacteria 1161
168 Ga0307405_11122039 3300031731 Bacteria 677
169 Ga0307413_10972859 3300031824 Bacteria 726
170 Ga0307410_10053288 3300031852 Bacteria 2737
171 Ga0307407_11056002 3300031903 Bacteria 630
172 Ga0307409_100346016 3300031995 Bacteria 1401
173 Ga0307416_101776022 3300032002 Bacteria 721
174 Ga0307414_10114988 3300032004 Bacteria 2057
175 Ga0307411_10872310 3300032005 Bacteria 798
176 Ga0373937_0030939 3300036401 Unclassified 4847
177 Ga0395899_0189466 3300037312 Bacteria 1440
178 Ga0395900_0765695 3300037418 Bacteria 895
179 Ga0395900_1324805 3300037418 Bacteria 634
180 Ga0395898_1218321 3300037466 Bacteria 684
181 Ga0395898_1956046 3300037466 Bacteria 506
182 Ga0395905_0276258 3300037471 Bacteria 1566
183 Ga0395905_1437682 3300037471 Bacteria 594
184 Ga0395901_0090227 3300038443 Bacteria 3208
185 Ga0436363_0406208 3300039450 Bacteria 511
186 Ga0451804_0424814 3300041463 Bacteria 511
187 Ga0451577_0492686 3300042876 Bacteria 1113
188 Ga0451577_1359399 3300042876 Unclassified 631
189 Ga0451576_0000651 3300045051 Bacteria 71719
190 Ga0451576_0219099 3300045051 Bacteria 1987
191 Ga0451576_2306995 3300045051 Bacteria 551
192 Ga0495592_0300618 3300046454 Unclassified 1043
193 Ga0495618_0010779 3300046514 Bacteria 5536
194 Ga0495628_0299422 3300046516 Bacteria 1191
195 Ga0495630_0217830 3300046517 Unclassified 1457
196 Ga0495645_0189192 3300046543 Bacteria 1404
197 Ga0495634_0124413 3300046642 Unclassified 1649
198 Ga0495635_0330182 3300046663 Bacteria 1020
199 Ga0495635_1083092 3300046663 Bacteria 508
200 Ga0495657_0103016 3300046675 Unclassified 1816
201 Ga0495613_0009996 3300046689 Bacteria 7048
202 Ga0495613_0327300 3300046689 Bacteria 1057
203 Ga0495613_0408958 3300046689 Bacteria 925
204 Ga0495624_0019018 3300046690 Bacteria 4589
205 Ga0495581_0086264 3300047315 Unclassified 1820
206 Ga0495674_0042236 3300047319 Bacteria 4068
207 Ga0495674_0153563 3300047319 Bacteria 1930
208 Ga0495675_0202062 3300047444 Unclassified 1209
209 Ga0495675_0577942 3300047444 Bacteria 639
210 Ga0495684_0001493 3300047471 Bacteria 18707
211 Ga0495684_0073307 3300047471 Unclassified 2601
212 Ga0495684_0301448 3300047471 Bacteria 1151
213 Ga0495614_0248589 3300048089 Bacteria 813
214 Ga0501034_0001669 3300049571 Bacteria 28602
215 Ga0501034_0351776 3300049571 Bacteria 1401
216 Ga0501037_0070687 3300049573 Bacteria 2539
217 Ga0501047_0010546 3300049581 Bacteria 8739
218 Ga0501047_0512404 3300049581 Unclassified 1026
219 Ga0501070_0095146 3300049586 Bacteria 2465
220 Ga0501070_0274686 3300049586 Unclassified 1375
221 Ga0501235_128734 3300049669 Bacteria 639
222 Ga0501225_0207570 3300049705 Bacteria 625
223 Ga0501080_0017369 3300049742 Bacteria 6652
224 Ga0501080_0760697 3300049742 Unclassified 851
225 Ga0501081_1262160 3300049743 Unclassified 560
226 Ga0501083_0010862 3300049744 Bacteria 6405
227 Ga0501044_0000598 3300049823 Bacteria 43751
228 Ga0501044_0576167 3300049823 Bacteria 1020
229 nmdc:mga09592_701948_c1 3300050508 Bacteria 861
230 nmdc:mga0qj67_1138055_c1 3300050509 Bacteria 609
231 nmdc:mga0qj67_38528_c1 3300050509 Bacteria 3750
232 nmdc:mga06r32_248744_c1 3300050510 Bacteria 1765
233 Ga0495601_0573445 3300053077 Unclassified 725
234 Ga0081539_10065123
235 Ga0058861_11652696
236 Ga0070658_10703812
237 Ga0070683_100891707
238 Ga0070683_102434985
239 Ga0070670_100125134
240 Ga0070670_100717208
241 Ga0068869_100783772
242 Ga0070666_10551423
243 Ga0070682_100855051
244 Ga0070668_100280136
245 Ga0070671_100054404
246 Ga0070671_100299276
247 Ga0070671_101386471
248 Ga0070674_100234772
249 Ga0070673_100714423
250 Ga0070659_100034888
251 Ga0070667_100109774
252 Ga0070667_100197368
253 Ga0070667_101958512
254 Ga0070714_100216581
255 Ga0070714_100229627
256 Ga0070714_100331078
257 Ga0070713_100856053
258 Ga0070663_100213836
259 Ga0070681_11387998
260 Ga0070685_10467930
261 Ga0070706_100140779
262 Ga0070684_100297974
263 Ga0070684_101061469
264 Ga0068853_100807907
265 Ga0068853_101553724
266 Ga0070672_100177409
267 Ga0070665_100004143
268 Ga0070665_100332490
269 Ga0070665_101502663
270 Ga0070665_101634718
271 Ga0068857_100014023
272 Ga0068852_100841717
273 Ga0068852_101185135
274 Ga0068864_100402982
275 Ga0068863_100195567
276 Ga0068860_100136216
277 Ga0068862_100280363
278 Ga0068862_101908361
279 Ga0070717_10172823
280 Ga0070717_11641773
281 Ga0075430_100023899
282 Ga0075429_100579739
283 Ga0105240_11388236
284 Ga0105240_11898157
285 Ga0105245_10133487
286 Ga0105245_10371320
287 Ga0105245_11487152
288 Ga0105245_12208130
289 Ga0114129_11501204
290 Ga0105243_11910019
291 Ga0105243_12145455
292 Ga0105241_10016878
293 Ga0105241_11150747
294 Ga0105241_12146127
295 Ga0105248_12262110
296 Ga0105237_10196356
297 Ga0105237_10274321
298 Ga0105237_10631160
299 Ga0105238_10739774
300 Ga0105238_12433374
301 Ga0105249_10316875
302 Ga0105249_10557355
303 Ga0105249_11926283
304 Ga0105249_12451729
305 Ga0105239_10008877
306 Ga0105239_10527252
307 Ga0105246_11202523
308 Ga0157373_10223589
309 Ga0157371_10055422
310 Ga0157371_10234238
311 Ga0157371_10241188
312 Ga0157371_10347672
313 Ga0157371_10719635
314 Ga0157371_11078499
315 Ga0157370_10083770
316 Ga0157370_10893814
317 Ga0157370_11349753
318 Ga0157369_10127020
319 Ga0157369_10147950
320 Ga0157369_10389164
321 Ga0157369_10972884
322 Ga0157374_10109582
323 Ga0157374_10851349
324 Ga0157374_10918216
325 Ga0157374_11548010
326 Ga0157374_11631955
327 Ga0157378_10238057
328 Ga0157378_12329720
329 Ga0163162_10892286
330 Ga0163162_12865508
331 Ga0157372_10035024
332 Ga0157372_10049068
333 Ga0157372_10104763
334 Ga0157372_10335641
335 Ga0157372_10414262
336 Ga0157372_10885939
337 Ga0157372_10922857
338 Ga0157372_11271082
339 Ga0157372_12191351
340 Ga0157375_12885743
341 Ga0163163_13095352
342 Ga0157380_10548473
343 Ga0182008_10217918
344 Ga0157379_10037426
345 Ga0197907_10481626
346 Ga0206356_10829392
347 Ga0206355_1462532
348 Ga0206353_10813098
349 Ga0207699_10341919
350 Ga0207705_10026392
351 Ga0207705_10839467
352 Ga0207684_10245935
353 Ga0207654_10238232
354 Ga0207649_10767528
355 Ga0207681_10191972
356 Ga0207681_10827008
357 Ga0207681_10978408
358 Ga0207694_11208782
359 Ga0207650_10118641
360 Ga0207650_10383779
361 Ga0207659_10136886
362 Ga0207687_10082069
363 Ga0207687_10149232
364 Ga0207687_10809129
365 Ga0207700_11487343
366 Ga0207664_10291509
367 Ga0207664_10529006
368 Ga0207644_10016864
369 Ga0207644_10034759
370 Ga0207704_11548064
371 Ga0207691_10099588
372 Ga0207661_10635468
373 Ga0207679_10126790
374 Ga0207679_10597058
375 Ga0207667_10445984
376 Ga0207651_10147428
377 Ga0207712_10203857
378 Ga0207712_10329493
379 Ga0207668_10371008
380 Ga0207658_10099010
381 Ga0207658_10174189
382 Ga0207639_10525084
383 Ga0207639_10698095
384 Ga0207702_10926456
385 Ga0207641_10760612
386 Ga0207648_11184420
387 Ga0207674_10004833
388 Ga0207674_10393682
389 Ga0207698_10407712
390 Ga0268266_10002629
391 Ga0268266_10168469
392 Ga0268266_10639134
393 Ga0268265_10237039
394 Ga0268264_10116115
395 Ga0268264_11561362
396 Ga0265338_10197244
397 Ga0265777_119183
398 Ga0265320_10158040
399 Ga0265339_10004165
400 Ga0307405_10335213
401 Ga0307405_11122039
402 Ga0307413_10972859
403 Ga0307410_10053288
404 Ga0307407_11056002
405 Ga0307409_100346016
406 Ga0307416_101776022
407 Ga0307414_10114988
408 Ga0307411_10872310
409 Ga0373937_0030939
410 Ga0395899_0189466
411 Ga0395900_0765695
412 Ga0395900_1324805
413 Ga0395898_1218321
414 Ga0395898_1956046
415 Ga0395905_0276258
416 Ga0395905_1437682
417 Ga0395901_0090227
418 Ga0436363_0406208
419 Ga0451804_0424814
420 Ga0451577_0492686
421 Ga0451577_1359399
422 Ga0451576_0000651
423 Ga0451576_0219099
424 Ga0451576_2306995
425 Ga0495592_0300618
426 Ga0495618_0010779
427 Ga0495628_0299422
428 Ga0495630_0217830
429 Ga0495645_0189192
430 Ga0495634_0124413
431 Ga0495635_0330182
432 Ga0495635_1083092
433 Ga0495657_0103016
434 Ga0495613_0009996
435 Ga0495613_0327300
436 Ga0495613_0408958
437 Ga0495624_0019018
438 Ga0495581_0086264
439 Ga0495674_0042236
440 Ga0495674_0153563
441 Ga0495675_0202062
442 Ga0495675_0577942
443 Ga0495684_0001493
444 Ga0495684_0073307
445 Ga0495684_0301448
446 Ga0495614_0248589
447 Ga0501034_0001669
448 Ga0501034_0351776
449 Ga0501037_0070687
450 Ga0501047_0010546
451 Ga0501047_0512404
452 Ga0501070_0095146
453 Ga0501070_0274686
454 Ga0501235_128734
455 Ga0501225_0207570
456 Ga0501080_0017369
457 Ga0501080_0760697
458 Ga0501081_1262160
459 Ga0501083_0010862
460 Ga0501044_0000598
461 Ga0501044_0576167
462 nmdc:mga09592_701948_c1
463 nmdc:mga0qj67_1138055_c1
464 nmdc:mga0qj67_38528_c1
465 nmdc:mga06r32_248744_c1
466 Ga0495601_0573445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

10

123

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9701 8 126
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9556 8 126
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9547 8 126
1zy2-assembly1.cif.gz_A crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.9514 9 126
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9512 8 126
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9581 8 87 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9546 7 125 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9541 8 126 3.40.50.2300
1zy2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9514 9 126 3.40.50.2300
1zy2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9504 9 124 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3B0CLW4-F1-model_v4 Response regulator 0.9623 7 127 GO:0000160
GO:0003677
GO:0010468
AF-A0A832HHL6-F1-model_v4 Response regulator 0.9549 1 130 GO:0000160
AF-A0A7Y3JZZ6-F1-model_v4 Response regulator 0.9547 1 128 GO:0000160
AF-A0A1F9TWZ8-F1-model_v4 Response regulatory domain-containing protein 0.9521 6 126 GO:0000160
AF-A0A1Y5FFJ8-F1-model_v4 Response regulatory domain-containing protein 0.9509 8 126 GO:0000160

Map