F345883

General Info

Members Datasets Scaffolds Average Seq Length
233 170 228 274

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100019645|Ga0070693_1000196452
Length 324
Sequence MDAFPRSNNSNITKLIVSAVGAISSEAWDFAKGLIKMGNCGVIGSSGKESPMTGQIEKGCVFRKLHERDRAFIIPNPWDIGTARLLANLGFEALATTSAGYAFSIGQRDNTVGRERMIAHVREMTAATDLPVSADLENGFGDDPETAAETIRLGAEAGLVGGSIEDSTTTRDDPIYDIQHAAERVRAAAETAHSLNFKFTLTARAENYLFGRRDLNDTIKRLQAYQEAGADVLYAPGLASKDDIASVISSLDRPVNVLMGLAGVKLTLSELSEIGVKRVSVGSVLSRVALSAFLRAAEEMRDHGTFTFADDIVSFGDISAMFPR

Samples

Sample ID Description Type Environment
1 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
2 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
3 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
4 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
5 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
103 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0.43
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 9.44
Rhizosphere 84.98
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10103734 3300005289 Unclassified 2163
2 Ga0065715_10369676 3300005293 Unclassified 923
3 Ga0070670_100108824 3300005331 Bacteria 2388
4 Ga0068869_100027492 3300005334 Bacteria 3966
5 Ga0068869_100091656 3300005334 Bacteria 2286
6 Ga0068869_100170258 3300005334 Bacteria 1701
7 Ga0070682_100109194 3300005337 Bacteria 1841
8 Ga0070660_100102305 3300005339 Unclassified 2271
9 Ga0070661_100223418 3300005344 Unclassified 1445
10 Ga0070692_10098353 3300005345 Bacteria 1600
11 Ga0070659_100152728 3300005366 Unclassified 1884
12 Ga0070659_100448251 3300005366 Unclassified 1094
13 Ga0070667_100291245 3300005367 Unclassified 1468
14 Ga0070703_10000985 3300005406 Bacteria 8970
15 Ga0070709_10000145 3300005434 Bacteria 47402
16 Ga0070713_100204778 3300005436 Bacteria 1784
17 Ga0070711_100000372 3300005439 Bacteria 23211
18 Ga0070705_100020985 3300005440 Bacteria 3467
19 Ga0070705_100096716 3300005440 Bacteria 1854
20 Ga0070694_100036921 3300005444 Bacteria 3238
21 Ga0070694_100078215 3300005444 Bacteria 2294
22 Ga0070694_100126772 3300005444 Bacteria 1838
23 Ga0070708_100155141 3300005445 Bacteria 2131
24 Ga0070662_100092663 3300005457 Bacteria 2271
25 Ga0070681_10162847 3300005458 Bacteria 2154
26 Ga0070706_100013182 3300005467 Bacteria 7648
27 Ga0070698_100305113 3300005471 Unclassified 1523
28 Ga0070699_100000135 3300005518 Bacteria 68724
29 Ga0068853_100014855 3300005539 Bacteria 6394
30 Ga0068853_100149206 3300005539 Bacteria 2103
31 Ga0070686_100269556 3300005544 Bacteria 1251
32 Ga0070695_100196575 3300005545 Bacteria 1438
33 Ga0070695_100425312 3300005545 Unclassified 1012
34 Ga0070696_100000042 3300005546 Bacteria 57704
35 Ga0070696_100099387 3300005546 Bacteria 2082
36 Ga0070693_100019645 3300005547 Bacteria 3547
37 Ga0070693_100032671 3300005547 Bacteria 2864
38 Ga0070665_100023169 3300005548 Bacteria 6254
39 Ga0070704_100051619 3300005549 Bacteria 2897
40 Ga0070704_100060669 3300005549 Bacteria 2703
41 Ga0070704_100202194 3300005549 Bacteria 1604
42 Ga0070704_100341452 3300005549 Bacteria 1261
43 Ga0068855_100033088 3300005563 Bacteria 6173
44 Ga0070702_100036825 3300005615 Bacteria 2713
45 Ga0068852_100176234 3300005616 Bacteria 2008
46 Ga0068859_100313680 3300005617 Bacteria 1662
47 Ga0068859_100373960 3300005617 Bacteria 1520
48 Ga0068851_10000263 3300005834 Bacteria 24713
49 Ga0068863_100004796 3300005841 Bacteria 13321
50 Ga0068863_100014808 3300005841 Bacteria 7499
51 Ga0068858_100398066 3300005842 Bacteria 1323
52 Ga0068858_100657980 3300005842 Bacteria 1018
53 Ga0081455_10199973 3300005937 Bacteria 1497
54 Ga0081540_1084665 3300005983 Unclassified 1414
55 Ga0070717_10213152 3300006028 Bacteria 1695
56 Ga0068871_100258986 3300006358 Unclassified 1517
57 Ga0075428_100001615 3300006844 Bacteria 24100
58 Ga0075428_100033998 3300006844 Bacteria 5624
59 Ga0075428_100337613 3300006844 Bacteria 1618
60 Ga0075430_100066128 3300006846 Bacteria 3036
61 Ga0075431_100192477 3300006847 Bacteria 2089
62 Ga0075433_10001869 3300006852 Bacteria 15820
63 Ga0075433_10028393 3300006852 Bacteria 4756
64 Ga0075434_100009175 3300006871 Bacteria 9217
65 Ga0075434_100048131 3300006871 Bacteria 4231
66 Ga0075436_100000560 3300006914 Bacteria 24223
67 Ga0075436_100073156 3300006914 Bacteria 2372
68 Ga0097620_100313660 3300006931 Bacteria 1662
69 Ga0097620_100373975 3300006931 Bacteria 1520
70 Ga0075435_100030042 3300007076 Bacteria 4270
71 Ga0075435_100081911 3300007076 Unclassified 2652
72 Ga0105251_10008284 3300009011 Bacteria 6280
73 Ga0111539_10075303 3300009094 Unclassified 3976
74 Ga0111539_10216673 3300009094 Bacteria 2230
75 Ga0111539_10514970 3300009094 Unclassified 1394
76 Ga0114129_10245465 3300009147 Bacteria 2406
77 Ga0114129_10256132 3300009147 Bacteria 2347
78 Ga0114129_10631563 3300009147 Bacteria 1384
79 Ga0105241_10069469 3300009174 Bacteria 2731
80 Ga0105248_10260739 3300009177 Bacteria 1951
81 Ga0105248_10394800 3300009177 Bacteria 1558
82 Ga0105248_10787058 3300009177 Bacteria 1073
83 Ga0105237_10454042 3300009545 Bacteria 1287
84 Ga0105238_10046942 3300009551 Bacteria 4355
85 Ga0105239_10321886 3300010375 Unclassified 1744
86 Ga0105246_10375982 3300011119 Bacteria 1172
87 Ga0157369_10013643 3300013105 Bacteria 9189
88 Ga0157374_10113419 3300013296 Unclassified 2609
89 Ga0157378_10059928 3300013297 Bacteria 3396
90 Ga0157375_10220823 3300013308 Bacteria 2053
91 Ga0163163_10508641 3300014325 Bacteria 1266
92 Ga0157377_10000078 3300014745 Bacteria 74509
93 Ga0157379_10048918 3300014968 Bacteria 3775
94 Ga0157376_10021826 3300014969 Bacteria 4977
95 Ga0157376_10082481 3300014969 Bacteria 2763
96 Ga0182006_1117815 3300015261 Bacteria 926
97 Ga0182007_10011221 3300015262 Bacteria 3495
98 Ga0183361_10005 3300016635 Bacteria 413599
99 Ga0207713_1062851 3300025735 Bacteria 1405
100 Ga0207653_10000036 3300025885 Bacteria 101828
101 Ga0207680_10154088 3300025903 Bacteria 1535
102 Ga0207699_10000031 3300025906 Bacteria 137708
103 Ga0207684_10001227 3300025910 Bacteria 28467
104 Ga0207671_10587285 3300025914 Bacteria 888
105 Ga0207663_10000450 3300025916 Bacteria 17866
106 Ga0207663_10218468 3300025916 Unclassified 1385
107 Ga0207660_10378260 3300025917 Bacteria 1138
108 Ga0207657_10009805 3300025919 Bacteria 9598
109 Ga0207649_10144443 3300025920 Bacteria 1632
110 Ga0207694_10456210 3300025924 Bacteria 1067
111 Ga0207700_10077641 3300025928 Bacteria 2580
112 Ga0207706_10019838 3300025933 Bacteria 6043
113 Ga0207689_10011994 3300025942 Bacteria 7427
114 Ga0207689_10040294 3300025942 Bacteria 3867
115 Ga0207689_10173294 3300025942 Bacteria 1779
116 Ga0207667_10520849 3300025949 Bacteria 1204
117 Ga0207703_10554679 3300026035 Bacteria 1084
118 Ga0207703_10751470 3300026035 Unclassified 929
119 Ga0207708_10087188 3300026075 Bacteria 2403
120 Ga0207702_10475389 3300026078 Bacteria 1215
121 Ga0207641_10041911 3300026088 Bacteria 3839
122 Ga0207641_10094167 3300026088 Bacteria 2626
123 Ga0207676_10165536 3300026095 Unclassified 1921
124 Ga0265762_1000107 3300030760 Bacteria 12140
125 Ga0307513_10234638 3300031456 Bacteria 1645
126 Ga0373929_0000001 3300035085 Bacteria 956023
127 Ga0395905_0311896 3300037471 Bacteria 1462
128 Ga0453683_0013191 3300044673 Bacteria 5401
129 Ga0453683_0194101 3300044673 Bacteria 1289
130 Ga0466961_0084350 3300044693 Unclassified 2009
131 Ga0451576_0012331 3300045051 Bacteria 9609
132 Ga0466967_0027079 3300045976 Unclassified 4763
133 Ga0495627_019602 3300046453 Bacteria 2265
134 Ga0495591_026217 3300046458 Bacteria 1815
135 Ga0495650_0004093 3300046471 Bacteria 10182
136 Ga0495580_0014167 3300046472 Bacteria 6055
137 Ga0495605_0000362 3300046474 Bacteria 43622
138 Ga0495594_0000506 3300046499 Bacteria 19879
139 Ga0495607_0000485 3300046501 Bacteria 39753
140 Ga0495607_0121157 3300046501 Bacteria 1373
141 Ga0495583_0000701 3300046506 Bacteria 43155
142 Ga0495583_0016276 3300046506 Bacteria 4007
143 Ga0495610_0020152 3300046512 Bacteria 3709
144 Ga0495616_0000492 3300046513 Bacteria 30078
145 Ga0495616_0072368 3300046513 Bacteria 1665
146 Ga0495620_0000219 3300046515 Bacteria 43161
147 Ga0495631_0010055 3300046518 Bacteria 4701
148 Ga0495648_0021570 3300046524 Bacteria 4456
149 Ga0495587_0079708 3300046536 Bacteria 1898
150 Ga0495609_0000019 3300046538 Bacteria 297777
151 Ga0495609_0000317 3300046538 Bacteria 43158
152 Ga0495597_0002162 3300046542 Bacteria 12921
153 Ga0495645_0056299 3300046543 Bacteria 2855
154 Ga0495633_0000476 3300046558 Bacteria 40643
155 Ga0495656_0002469 3300046615 Bacteria 6152
156 Ga0495611_0002449 3300046648 Bacteria 8479
157 Ga0495661_0000012 3300046665 Bacteria 276804
158 Ga0495661_0000232 3300046665 Bacteria 64230
159 Ga0495646_0035904 3300046680 Bacteria 3072
160 Ga0495646_0162182 3300046680 Bacteria 1237
161 Ga0495670_0006038 3300046691 Bacteria 5933
162 Ga0495671_0011966 3300046692 Bacteria 4753
163 Ga0495649_0060073 3300046694 Bacteria 2045
164 Ga0495589_0000007 3300046794 Bacteria 276444
165 Ga0495589_0001312 3300046794 Bacteria 14600
166 Ga0495660_0013923 3300046810 Bacteria 4662
167 Ga0495636_0104728 3300047318 Bacteria 1240
168 Ga0495674_0004135 3300047319 Bacteria 14014
169 Ga0495672_0137027 3300047320 Bacteria 1282
170 Ga0495683_0000289 3300047323 Bacteria 43297
171 Ga0495683_0054369 3300047323 Bacteria 1995
172 Ga0495687_000003 3300047443 Bacteria 859509
173 Ga0495677_0000005 3300047445 Bacteria 243336
174 Ga0495679_000958 3300047446 Bacteria 17892
175 Ga0495673_0003042 3300047469 Bacteria 11288
176 Ga0495681_0045934 3300047470 Bacteria 2086
177 Ga0495626_0121855 3300048091 Bacteria 1120
178 Ga0496100_0000122 3300048903 Bacteria 44143
179 Ga0496100_0130354 3300048903 Bacteria 1770
180 Ga0496101_0000064 3300048904 Bacteria 124993
181 Ga0496101_0078226 3300048904 Bacteria 2439
182 Ga0496103_0000153 3300048906 Bacteria 72323
183 Ga0496103_0181285 3300048906 Bacteria 1354
184 Ga0496103_0221427 3300048906 Bacteria 1217
185 Ga0496104_0116154 3300048907 Bacteria 2568
186 Ga0496104_0553190 3300048907 Bacteria 1061
187 Ga0496105_0015923 3300048908 Bacteria 5998
188 Ga0496105_0076735 3300048908 Bacteria 2759
189 Ga0496106_0060843 3300048909 Bacteria 2863
190 Ga0496108_0022713 3300048911 Bacteria 5160
191 Ga0496108_0047467 3300048911 Bacteria 3589
192 Ga0496109_0251811 3300048912 Bacteria 1663
193 Ga0496109_0677101 3300048912 Bacteria 969
194 Ga0496112_0016416 3300048915 Bacteria 6936
195 Ga0496112_0059190 3300048915 Bacteria 3774
196 Ga0496112_0317492 3300048915 Bacteria 1502
197 Ga0496113_0039549 3300048916 Bacteria 3471
198 Ga0496113_0090428 3300048916 Bacteria 2358
199 Ga0496113_0141796 3300048916 Bacteria 1891
200 Ga0496117_0000134 3300048920 Bacteria 161270
201 Ga0496118_0000139 3300048921 Bacteria 128723
202 Ga0496119_0032325 3300048922 Bacteria 3489
203 Ga0496121_0000202 3300048924 Bacteria 131089
204 Ga0496121_0007948 3300048924 Bacteria 12675
205 Ga0496121_0012741 3300048924 Bacteria 9112
206 Ga0496124_0171271 3300048927 Bacteria 1681
207 Ga0495678_000412 3300049459 Bacteria 43250
208 Ga0495682_0114675 3300049460 Bacteria 965
209 Ga0501072_0015425 3300049588 Bacteria 5857
210 Ga0501075_0000426 3300049591 Bacteria 24768
211 Ga0501077_0001439 3300049593 Bacteria 14309
212 Ga0501080_0005680 3300049742 Bacteria 11152
213 Ga0501080_0304416 3300049742 Bacteria 1445
214 nmdc:mga05p37_322162_c1 3300050507 Unclassified 1829
215 nmdc:mga05p37_555148_c1 3300050507 Bacteria 1306
216 nmdc:mga09592_151710_c1 3300050508 Bacteria 1999
217 nmdc:mga0qj67_183847_c1 3300050509 Bacteria 1698
218 nmdc:mga08y16_407518_c1 3300050511 Unclassified 1391
219 nmdc:mga08y16_51978_c1 3300050511 Unclassified 4287
220 nmdc:mga0n895_102957_c1 3300050512 Bacteria 2866
221 nmdc:mga0n895_379050_c1 3300050512 Bacteria 1431
222 nmdc:mga0rr50_109969_c1 3300050513 Bacteria 2179
223 nmdc:mga08x19_33_c1 3300050514 Bacteria 203200
224 nmdc:mga08x19_34028_c1 3300050514 Bacteria 3219
225 Ga0500618_024039 3300053125 Bacteria 1470
226 Ga0500627_0015034 3300053158 Bacteria 2981
227 Ga0501082_0000444 3300060353 Bacteria 36630
228 Ga0530510_0221327 3300061734 Bacteria 1407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10220823 Ga0157375_102208232 257
2 3300046542 Ga0495597_0002162 Ga0495597_0002162_2801_3634 257
3 3300048912 Ga0496109_0251811 Ga0496109_0251811_110_964 257
4 3300005436 Ga0070713_100204778 Ga0070713_1002047781 258
5 3300006028 Ga0070717_10213152 Ga0070717_102131522 258
6 3300025928 Ga0207700_10077641 Ga0207700_100776412 258
7 3300046810 Ga0495660_0013923 Ga0495660_0013923_2051_2884 258
8 3300009011 Ga0105251_10008284 Ga0105251_100082846 259
9 3300025735 Ga0207713_1062851 Ga0207713_10628512 259
10 3300046453 Ga0495627_019602 Ga0495627_019602_830_1663 259
11 3300046458 Ga0495591_026217 Ga0495591_026217_508_1341 259
12 3300046471 Ga0495650_0004093 Ga0495650_0004093_5455_6288 259
13 3300046474 Ga0495605_0000362 Ga0495605_0000362_11927_12760 259
14 3300046499 Ga0495594_0000506 Ga0495594_0000506_8775_9608 259
15 3300046501 Ga0495607_0121157 Ga0495607_0121157_181_1014 259
16 3300046506 Ga0495583_0000701 Ga0495583_0000701_11919_12752 259
17 3300046512 Ga0495610_0020152 Ga0495610_0020152_1795_2628 259
18 3300046515 Ga0495620_0000219 Ga0495620_0000219_30406_31239 259
19 3300046518 Ga0495631_0010055 Ga0495631_0010055_1500_2333 259
20 3300046524 Ga0495648_0021570 Ga0495648_0021570_2921_3754 259
21 3300046538 Ga0495609_0000317 Ga0495609_0000317_30403_31236 259
22 3300046558 Ga0495633_0000476 Ga0495633_0000476_30519_31352 259
23 3300046665 Ga0495661_0000232 Ga0495661_0000232_11938_12771 259
24 3300046691 Ga0495670_0006038 Ga0495670_0006038_2703_3536 259
25 3300046692 Ga0495671_0011966 Ga0495671_0011966_1641_2474 259
26 3300046794 Ga0495589_0001312 Ga0495589_0001312_3483_4316 259
27 3300047323 Ga0495683_0000289 Ga0495683_0000289_30530_31363 259
28 3300047469 Ga0495673_0003042 Ga0495673_0003042_6236_7069 259
29 3300047470 Ga0495681_0045934 Ga0495681_0045934_851_1684 259
30 3300049459 Ga0495678_000412 Ga0495678_000412_11919_12752 259
31 3300053125 Ga0500618_024039 Ga0500618_024039_584_1417 259
32 3300005334 Ga0068869_100170258 Ga0068869_1001702582 268
33 3300014745 Ga0157377_10000078 Ga0157377_1000007839 268
34 3300025942 Ga0207689_10173294 Ga0207689_101732942 268
35 3300005331 Ga0070670_100108824 Ga0070670_1001088242 269
36 iso_pu_bacteria 2791355137 2792837894 269
37 iso_pu_bacteria 2844533157 2844535223 269
38 iso_pu_bacteria 2904615490 2904622489 269
39 3300005434 Ga0070709_10000145 Ga0070709_100001457 270
40 3300025906 Ga0207699_10000031 Ga0207699_100000317 270
41 iso_pu_bacteria 2562617112 2563057815 270
42 iso_pu_bacteria 2711768613 2713473485 270
43 3300005334 Ga0068869_100091656 Ga0068869_1000916561 271
44 3300005549 Ga0070704_100202194 Ga0070704_1002021942 271
45 3300005983 Ga0081540_1084665 Ga0081540_10846651 271
46 3300025942 Ga0207689_10011994 Ga0207689_100119942 271
47 3300005334 Ga0068869_100027492 Ga0068869_1000274924 272
48 3300006844 Ga0075428_100337613 Ga0075428_1003376132 272
49 3300025942 Ga0207689_10040294 Ga0207689_100402944 272
50 3300049591 Ga0501075_0000426 Ga0501075_0000426_3060_3878 272
51 3300049593 Ga0501077_0001439 Ga0501077_0001439_4764_5582 272
52 3300049742 Ga0501080_0005680 Ga0501080_0005680_4397_5215 272
53 3300060353 Ga0501082_0000444 Ga0501082_0000444_21985_22803 272
54 3300061734 Ga0530510_0221327 Ga0530510_0221327_164_982 272
55 3300005289 Ga0065704_10103734 Ga0065704_101037342 273
56 3300005293 Ga0065715_10369676 Ga0065715_103696761 273
57 3300005337 Ga0070682_100109194 Ga0070682_1001091942 273
58 3300005339 Ga0070660_100102305 Ga0070660_1001023052 273
59 3300005344 Ga0070661_100223418 Ga0070661_1002234182 273
60 3300005345 Ga0070692_10098353 Ga0070692_100983531 273
61 3300005366 Ga0070659_100152728 Ga0070659_1001527281 273
62 3300005366 Ga0070659_100448251 Ga0070659_1004482511 273
63 3300005367 Ga0070667_100291245 Ga0070667_1002912452 273
64 3300005406 Ga0070703_10000985 Ga0070703_100009851 273
65 3300005439 Ga0070711_100000372 Ga0070711_10000037222 273
66 3300005440 Ga0070705_100020985 Ga0070705_1000209852 273
67 3300005440 Ga0070705_100096716 Ga0070705_1000967162 273
68 3300005444 Ga0070694_100036921 Ga0070694_1000369212 273
69 3300005444 Ga0070694_100078215 Ga0070694_1000782153 273
70 3300005444 Ga0070694_100126772 Ga0070694_1001267722 273
71 3300005445 Ga0070708_100155141 Ga0070708_1001551413 273
72 3300005457 Ga0070662_100092663 Ga0070662_1000926632 273
73 3300005458 Ga0070681_10162847 Ga0070681_101628472 273
74 3300005467 Ga0070706_100013182 Ga0070706_1000131823 273
75 3300005471 Ga0070698_100305113 Ga0070698_1003051132 273
76 3300005518 Ga0070699_100000135 Ga0070699_10000013521 273
77 3300005539 Ga0068853_100014855 Ga0068853_1000148552 273
78 3300005539 Ga0068853_100149206 Ga0068853_1001492063 273
79 3300005544 Ga0070686_100269556 Ga0070686_1002695562 273
80 3300005545 Ga0070695_100196575 Ga0070695_1001965752 273
81 3300005545 Ga0070695_100425312 Ga0070695_1004253121 273
82 3300005546 Ga0070696_100000042 Ga0070696_10000004232 273
83 3300005546 Ga0070696_100099387 Ga0070696_1000993871 273
84 3300005547 Ga0070693_100019645 Ga0070693_1000196452 273
85 3300005547 Ga0070693_100032671 Ga0070693_1000326712 273
86 3300005548 Ga0070665_100023169 Ga0070665_1000231691 273
87 3300005549 Ga0070704_100051619 Ga0070704_1000516192 273
88 3300005549 Ga0070704_100060669 Ga0070704_1000606692 273
89 3300005549 Ga0070704_100341452 Ga0070704_1003414522 273
90 3300005563 Ga0068855_100033088 Ga0068855_1000330885 273
91 3300005615 Ga0070702_100036825 Ga0070702_1000368252 273
92 3300005616 Ga0068852_100176234 Ga0068852_1001762342 273
93 3300005617 Ga0068859_100313680 Ga0068859_1003136802 273
94 3300005617 Ga0068859_100373960 Ga0068859_1003739602 273
95 3300005834 Ga0068851_10000263 Ga0068851_100002639 273
96 3300005841 Ga0068863_100004796 Ga0068863_1000047965 273
97 3300005841 Ga0068863_100014808 Ga0068863_1000148084 273
98 3300005842 Ga0068858_100398066 Ga0068858_1003980661 273
99 3300005842 Ga0068858_100657980 Ga0068858_1006579801 273
100 3300005937 Ga0081455_10199973 Ga0081455_101999731 273
101 3300006358 Ga0068871_100258986 Ga0068871_1002589862 273
102 3300006844 Ga0075428_100001615 Ga0075428_1000016159 273
103 3300006844 Ga0075428_100033998 Ga0075428_1000339983 273
104 3300006846 Ga0075430_100066128 Ga0075430_1000661283 273
105 3300006847 Ga0075431_100192477 Ga0075431_1001924773 273
106 3300006852 Ga0075433_10001869 Ga0075433_100018697 273
107 3300006852 Ga0075433_10028393 Ga0075433_100283934 273
108 3300006871 Ga0075434_100009175 Ga0075434_1000091754 273
109 3300006871 Ga0075434_100048131 Ga0075434_1000481315 273
110 3300006914 Ga0075436_100000560 Ga0075436_10000056014 273
111 3300006914 Ga0075436_100073156 Ga0075436_1000731561 273
112 3300006931 Ga0097620_100313660 Ga0097620_1003136602 273
113 3300006931 Ga0097620_100373975 Ga0097620_1003739752 273
114 3300007076 Ga0075435_100030042 Ga0075435_1000300424 273
115 3300007076 Ga0075435_100081911 Ga0075435_1000819112 273
116 3300009094 Ga0111539_10075303 Ga0111539_100753032 273
117 3300009094 Ga0111539_10216673 Ga0111539_102166731 273
118 3300009094 Ga0111539_10514970 Ga0111539_105149702 273
119 3300009147 Ga0114129_10245465 Ga0114129_102454652 273
120 3300009147 Ga0114129_10256132 Ga0114129_102561321 273
121 3300009147 Ga0114129_10631563 Ga0114129_106315632 273
122 3300009174 Ga0105241_10069469 Ga0105241_100694692 273
123 3300009177 Ga0105248_10260739 Ga0105248_102607391 273
124 3300009177 Ga0105248_10394800 Ga0105248_103948001 273
125 3300009177 Ga0105248_10787058 Ga0105248_107870581 273
126 3300009545 Ga0105237_10454042 Ga0105237_104540421 273
127 3300009551 Ga0105238_10046942 Ga0105238_100469424 273
128 3300010375 Ga0105239_10321886 Ga0105239_103218862 273
129 3300011119 Ga0105246_10375982 Ga0105246_103759821 273
130 3300013105 Ga0157369_10013643 Ga0157369_100136433 273
131 3300013296 Ga0157374_10113419 Ga0157374_101134192 273
132 3300013297 Ga0157378_10059928 Ga0157378_100599283 273
133 3300014325 Ga0163163_10508641 Ga0163163_105086412 273
134 3300014968 Ga0157379_10048918 Ga0157379_100489182 273
135 3300014969 Ga0157376_10021826 Ga0157376_100218266 273
136 3300014969 Ga0157376_10082481 Ga0157376_100824813 273
137 3300015261 Ga0182006_1117815 Ga0182006_11178151 273
138 3300015262 Ga0182007_10011221 Ga0182007_100112213 273
139 3300016635 Ga0183361_10005 Ga0183361_1000547 273
140 3300025885 Ga0207653_10000036 Ga0207653_1000003686 273
141 3300025903 Ga0207680_10154088 Ga0207680_101540882 273
142 3300025910 Ga0207684_10001227 Ga0207684_100012271 273
143 3300025914 Ga0207671_10587285 Ga0207671_105872851 273
144 3300025916 Ga0207663_10000450 Ga0207663_1000045010 273
145 3300025916 Ga0207663_10218468 Ga0207663_102184682 273
146 3300025917 Ga0207660_10378260 Ga0207660_103782601 273
147 3300025919 Ga0207657_10009805 Ga0207657_1000980510 273
148 3300025920 Ga0207649_10144443 Ga0207649_101444432 273
149 3300025924 Ga0207694_10456210 Ga0207694_104562101 273
150 3300025933 Ga0207706_10019838 Ga0207706_100198385 273
151 3300025949 Ga0207667_10520849 Ga0207667_105208491 273
152 3300026035 Ga0207703_10554679 Ga0207703_105546791 273
153 3300026035 Ga0207703_10751470 Ga0207703_107514701 273
154 3300026075 Ga0207708_10087188 Ga0207708_100871882 273
155 3300026078 Ga0207702_10475389 Ga0207702_104753892 273
156 3300026088 Ga0207641_10041911 Ga0207641_100419112 273
157 3300026088 Ga0207641_10094167 Ga0207641_100941673 273
158 3300026095 Ga0207676_10165536 Ga0207676_101655361 273
159 3300030760 Ga0265762_1000107 Ga0265762_10001079 273
160 3300031456 Ga0307513_10234638 Ga0307513_102346382 273
161 3300035085 Ga0373929_0000001 Ga0373929_0000001_708773_709594 273
162 3300037471 Ga0395905_0311896 Ga0395905_0311896_183_1034 273
163 3300044673 Ga0453683_0013191 Ga0453683_0013191_2780_3628 273
164 3300044673 Ga0453683_0194101 Ga0453683_0194101_316_1137 273
165 3300044693 Ga0466961_0084350 Ga0466961_0084350_98_946 273
166 3300045051 Ga0451576_0012331 Ga0451576_0012331_1418_2266 273
167 3300045976 Ga0466967_0027079 Ga0466967_0027079_1993_2829 273
168 3300046472 Ga0495580_0014167 Ga0495580_0014167_3527_4363 273
169 3300046501 Ga0495607_0000485 Ga0495607_0000485_30434_31261 273
170 3300046506 Ga0495583_0016276 Ga0495583_0016276_510_1349 273
171 3300046513 Ga0495616_0000492 Ga0495616_0000492_1318_2145 273
172 3300046513 Ga0495616_0072368 Ga0495616_0072368_758_1597 273
173 3300046536 Ga0495587_0079708 Ga0495587_0079708_328_1164 273
174 3300046538 Ga0495609_0000019 Ga0495609_0000019_207057_207884 273
175 3300046543 Ga0495645_0056299 Ga0495645_0056299_791_1645 273
176 3300046615 Ga0495656_0002469 Ga0495656_0002469_4041_4868 273
177 3300046648 Ga0495611_0002449 Ga0495611_0002449_3453_4286 273
178 3300046665 Ga0495661_0000012 Ga0495661_0000012_81404_82231 273
179 3300046680 Ga0495646_0035904 Ga0495646_0035904_1693_2547 273
180 3300046680 Ga0495646_0162182 Ga0495646_0162182_90_926 273
181 3300046694 Ga0495649_0060073 Ga0495649_0060073_1017_1862 273
182 3300046794 Ga0495589_0000007 Ga0495589_0000007_81044_81871 273
183 3300047318 Ga0495636_0104728 Ga0495636_0104728_171_1004 273
184 3300047319 Ga0495674_0004135 Ga0495674_0004135_11404_12243 273
185 3300047320 Ga0495672_0137027 Ga0495672_0137027_417_1256 273
186 3300047323 Ga0495683_0054369 Ga0495683_0054369_601_1440 273
187 3300047443 Ga0495687_000003 Ga0495687_000003_207084_207911 273
188 3300047445 Ga0495677_0000005 Ga0495677_0000005_194796_195623 273
189 3300047446 Ga0495679_000958 Ga0495679_000958_4047_4880 273
190 3300048091 Ga0495626_0121855 Ga0495626_0121855_90_929 273
191 3300048903 Ga0496100_0000122 Ga0496100_0000122_42816_43655 273
192 3300048903 Ga0496100_0130354 Ga0496100_0130354_486_1325 273
193 3300048904 Ga0496101_0000064 Ga0496101_0000064_49393_50232 273
194 3300048904 Ga0496101_0078226 Ga0496101_0078226_1080_1901 273
195 3300048906 Ga0496103_0000153 Ga0496103_0000153_42901_43740 273
196 3300048906 Ga0496103_0181285 Ga0496103_0181285_247_1068 273
197 3300048906 Ga0496103_0221427 Ga0496103_0221427_339_1175 273
198 3300048907 Ga0496104_0116154 Ga0496104_0116154_1660_2496 273
199 3300048907 Ga0496104_0553190 Ga0496104_0553190_185_1006 273
200 3300048908 Ga0496105_0015923 Ga0496105_0015923_4840_5676 273
201 3300048908 Ga0496105_0076735 Ga0496105_0076735_390_1229 273
202 3300048909 Ga0496106_0060843 Ga0496106_0060843_1820_2641 273
203 3300048911 Ga0496108_0022713 Ga0496108_0022713_13_834 273
204 3300048911 Ga0496108_0047467 Ga0496108_0047467_156_977 273
205 3300048912 Ga0496109_0677101 Ga0496109_0677101_60_890 273
206 3300048915 Ga0496112_0016416 Ga0496112_0016416_5236_6075 273
207 3300048915 Ga0496112_0059190 Ga0496112_0059190_30_851 273
208 3300048915 Ga0496112_0317492 Ga0496112_0317492_614_1435 273
209 3300048916 Ga0496113_0039549 Ga0496113_0039549_383_1222 273
210 3300048916 Ga0496113_0090428 Ga0496113_0090428_191_1012 273
211 3300048916 Ga0496113_0141796 Ga0496113_0141796_59_892 273
212 3300048920 Ga0496117_0000134 Ga0496117_0000134_85066_85905 273
213 3300048921 Ga0496118_0000139 Ga0496118_0000139_42809_43648 273
214 3300048922 Ga0496119_0032325 Ga0496119_0032325_2574_3413 273
215 3300048924 Ga0496121_0000202 Ga0496121_0000202_66784_67623 273
216 3300048924 Ga0496121_0007948 Ga0496121_0007948_6661_7497 273
217 3300048924 Ga0496121_0012741 Ga0496121_0012741_7898_8737 273
218 3300048927 Ga0496124_0171271 Ga0496124_0171271_766_1605 273
219 3300049460 Ga0495682_0114675 Ga0495682_0114675_10_849 273
220 3300049588 Ga0501072_0015425 Ga0501072_0015425_3372_4193 273
221 3300049742 Ga0501080_0304416 Ga0501080_0304416_344_1174 273
222 3300050507 nmdc:mga05p37_322162_c1 nmdc:mga05p37_322162_c1_922_1749 273
223 3300050507 nmdc:mga05p37_555148_c1 nmdc:mga05p37_555148_c1_236_1060 273
224 3300050508 nmdc:mga09592_151710_c1 nmdc:mga09592_151710_c1_469_1296 273
225 3300050509 nmdc:mga0qj67_183847_c1 nmdc:mga0qj67_183847_c1_279_1112 273
226 3300050511 nmdc:mga08y16_407518_c1 nmdc:mga08y16_407518_c1_81_908 273
227 3300050511 nmdc:mga08y16_51978_c1 nmdc:mga08y16_51978_c1_987_1874 273
228 3300050512 nmdc:mga0n895_102957_c1 nmdc:mga0n895_102957_c1_1586_2410 273
229 3300050512 nmdc:mga0n895_379050_c1 nmdc:mga0n895_379050_c1_412_1233 273
230 3300050513 nmdc:mga0rr50_109969_c1 nmdc:mga0rr50_109969_c1_1310_2137 273
231 3300050514 nmdc:mga08x19_33_c1 nmdc:mga08x19_33_c1_128431_129261 273
232 3300050514 nmdc:mga08x19_34028_c1 nmdc:mga08x19_34028_c1_405_1235 273
233 3300053158 Ga0500627_0015034 Ga0500627_0015034_1882_2736 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

62

301

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9838 4 273
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.981 4 273
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9668 4 273
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.966 4 273
4mg4-assembly2.cif.gz_F crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9242 5 248
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9887 4 231 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9717 4 231 3.20.20.60
4lsbB02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9586 233 273 6.10.250.2750
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9248 2 231 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9133 2 231 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A5R2MZN5-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9948 77 205 GO:0016829
AF-A0A7Y7Y737-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9945 97 205 GO:0016829
AF-A0A524Q9N9-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9925 1 192 GO:0016829
AF-A0A2V9J6C0-F1-model_v4 2-methylisocitrate lyase 0.9908 2 176 GO:0016829
AF-A0A538P0J9-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9895 3 272 GO:0016829

Feature Viewer

pLDDT pTM Quality
92.53 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map