F345859

General Info

Members Datasets Scaffolds Average Seq Length
233 164 466 178

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100190896|Ga0070699_1001908962
Length 198
Sequence VFDPRLKPAVARRLKLVGFDVDGVLTDGGLYVGESDTHQMELKRFHIQDGLGVKFLRQAGLVVVLASARRSEATALRGRELKVDEVVQDNPKLAPFATILARRGVAWDECAFVGDDLPDLPVLTRVALPIAVANAVPEVKAAATFVTKRSGGDGAVREVAEVILKARGVWKSLLQQYLQERGDVEARPPASRRSRRAG

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
104 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
105 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
106 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
107 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
108 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
109 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
110 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
111 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
164 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.29
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 11.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100190896 3300005518 Bacteria 1820
2 Ga0065712_10109880 3300005290 Bacteria 1847
3 Ga0068869_100015784 3300005334 Bacteria 5076
4 Ga0068868_100200032 3300005338 Bacteria 1665
5 Ga0068868_100337211 3300005338 Bacteria 1288
6 Ga0070668_100517143 3300005347 Unclassified 1035
7 Ga0070674_100026266 3300005356 Bacteria 3801
8 Ga0070703_10020277 3300005406 Bacteria 1933
9 Ga0070714_100314622 3300005435 Unclassified 1463
10 Ga0070713_100061504 3300005436 Unclassified 3141
11 Ga0070713_100537066 3300005436 Unclassified 1106
12 Ga0070710_10244509 3300005437 Bacteria 1151
13 Ga0070701_10099354 3300005438 Bacteria 1609
14 Ga0070711_100000297 3300005439 Bacteria 25800
15 Ga0070705_100068943 3300005440 Bacteria 2131
16 Ga0070705_100075491 3300005440 Bacteria 2052
17 Ga0070700_100009774 3300005441 Bacteria 5274
18 Ga0070708_100075234 3300005445 Bacteria 3047
19 Ga0070708_100277792 3300005445 Bacteria 1576
20 Ga0070708_100676880 3300005445 Unclassified 971
21 Ga0070678_100261734 3300005456 Bacteria 1455
22 Ga0070706_100021262 3300005467 Bacteria 5976
23 Ga0070707_100000491 3300005468 Bacteria 39194
24 Ga0070707_100000959 3300005468 Bacteria 28639
25 Ga0070707_100396015 3300005468 Bacteria 1341
26 Ga0070707_100488024 3300005468 Bacteria 1193
27 Ga0070698_100000037 3300005471 Bacteria 92307
28 Ga0070698_100081162 3300005471 Bacteria 3238
29 Ga0070698_100116254 3300005471 Bacteria 2638
30 Ga0070699_100066428 3300005518 Bacteria 3131
31 Ga0070699_100276498 3300005518 Bacteria 1504
32 Ga0070697_100026994 3300005536 Bacteria 4592
33 Ga0070697_100107799 3300005536 Bacteria 2318
34 Ga0070697_100133798 3300005536 Bacteria 2081
35 Ga0070697_100349417 3300005536 Bacteria 1277
36 Ga0068853_100399631 3300005539 Bacteria 1286
37 Ga0070696_100061126 3300005546 Bacteria 2635
38 Ga0070693_100449130 3300005547 Bacteria 904
39 Ga0070704_100016875 3300005549 Bacteria 4628
40 Ga0070704_100285960 3300005549 Bacteria 1368
41 Ga0070664_100129906 3300005564 Bacteria 2212
42 Ga0068856_100126777 3300005614 Bacteria 2556
43 Ga0068859_100340001 3300005617 Bacteria 1595
44 Ga0068863_100055665 3300005841 Bacteria 3745
45 Ga0068858_100235292 3300005842 Bacteria 1737
46 Ga0068858_101078364 3300005842 Bacteria 788
47 Ga0068862_100432579 3300005844 Bacteria 1237
48 Ga0070717_10851330 3300006028 Unclassified 830
49 Ga0070712_100374527 3300006175 Bacteria 1171
50 Ga0068871_100507965 3300006358 Unclassified 1087
51 Ga0075428_100464757 3300006844 Bacteria 1355
52 Ga0075431_100076708 3300006847 Bacteria 3449
53 Ga0075431_100771261 3300006847 Bacteria 936
54 Ga0075434_100576559 3300006871 Bacteria 1144
55 Ga0068865_100104540 3300006881 Bacteria 2079
56 Ga0075436_100002615 3300006914 Bacteria 12375
57 Ga0075436_100037846 3300006914 Bacteria 3331
58 Ga0075436_100336857 3300006914 Bacteria 1085
59 Ga0097620_100339981 3300006931 Bacteria 1595
60 Ga0075435_100178818 3300007076 Bacteria 1792
61 Ga0099794_10143039 3300007265 Bacteria 1212
62 Ga0105245_10076782 3300009098 Bacteria 3044
63 Ga0105245_10209803 3300009098 Bacteria 1874
64 Ga0114129_10173234 3300009147 Bacteria 2940
65 Ga0105243_12210558 3300009148 Unclassified 587
66 Ga0105243_12254641 3300009148 Unclassified 582
67 Ga0105241_10331922 3300009174 Unclassified 1315
68 Ga0105248_10938020 3300009177 Bacteria 977
69 Ga0105237_10060095 3300009545 Bacteria 3802
70 Ga0105249_10138814 3300009553 Bacteria 2328
71 Ga0157369_10200536 3300013105 Bacteria 2095
72 Ga0157378_10696479 3300013297 Unclassified 1035
73 Ga0163162_10439296 3300013306 Bacteria 1437
74 Ga0163162_11203821 3300013306 Bacteria 860
75 Ga0157372_10189210 3300013307 Bacteria 2384
76 Ga0157375_10137637 3300013308 Bacteria 2567
77 Ga0157380_10480550 3300014326 Bacteria 1201
78 Ga0213875_10346435 3300021388 Bacteria 705
79 Ga0224572_1030431 3300024225 Unclassified 1031
80 Ga0207692_10291997 3300025898 Bacteria 990
81 Ga0207688_10224289 3300025901 Bacteria 1133
82 Ga0207693_10337290 3300025915 Bacteria 1180
83 Ga0207646_10000030 3300025922 Bacteria 219473
84 Ga0207646_10001164 3300025922 Bacteria 33385
85 Ga0207659_10474928 3300025926 Bacteria 1056
86 Ga0207687_10046139 3300025927 Bacteria 3015
87 Ga0207704_10275002 3300025938 Unclassified 1277
88 Ga0207711_10898485 3300025941 Bacteria 823
89 Ga0207689_10024570 3300025942 Bacteria 5054
90 Ga0207679_10131770 3300025945 Unclassified 2007
91 Ga0207668_10487568 3300025972 Unclassified 1058
92 Ga0207677_10870866 3300026023 Bacteria 810
93 Ga0207703_10382963 3300026035 Bacteria 1301
94 Ga0207639_10812371 3300026041 Bacteria 872
95 Ga0207708_10030228 3300026075 Bacteria 4108
96 Ga0207702_10102410 3300026078 Bacteria 2530
97 Ga0207676_10973437 3300026095 Bacteria 835
98 Ga0207683_10274514 3300026121 Bacteria 1540
99 Ga0268265_10940617 3300028380 Bacteria 851
100 Ga0268264_10298540 3300028381 Bacteria 1515
101 Ga0265338_10006607 3300028800 Bacteria 14698
102 Ga0265338_10046524 3300028800 Bacteria 3976
103 Ga0265338_10530886 3300028800 Unclassified 826
104 Ga0265330_10086684 3300031235 Unclassified 1346
105 Ga0265325_10001387 3300031241 Bacteria 17099
106 Ga0265325_10027690 3300031241 Bacteria 3061
107 Ga0265325_10282450 3300031241 Bacteria 744
108 Ga0265331_10014653 3300031250 Bacteria 4166
109 Ga0265316_10011504 3300031344 Bacteria 7973
110 Ga0307408_100015516 3300031548 Bacteria 5073
111 Ga0265313_10005589 3300031595 Bacteria 9196
112 Ga0316575_10075708 3300031665 Bacteria 1355
113 Ga0265314_10343258 3300031711 Unclassified 824
114 Ga0307405_10641686 3300031731 Bacteria 872
115 Ga0316577_10032909 3300031733 Bacteria 2896
116 Ga0307410_10085743 3300031852 Bacteria 2223
117 Ga0307409_100008045 3300031995 Bacteria 6361
118 Ga0307416_100430922 3300032002 Bacteria 1366
119 Ga0373923_0098442 3300035111 Bacteria 1287
120 Ga0373945_0114036 3300035116 Bacteria 1069
121 Ga0373953_0069800 3300035117 Bacteria 1448
122 Ga0373956_0007195 3300035119 Bacteria 4483
123 Ga0373943_0148867 3300035170 Bacteria 1267
124 Ga0373955_0023631 3300035172 Bacteria 3133
125 Ga0373955_0030904 3300035172 Bacteria 2801
126 Ga0373927_0487322 3300035695 Bacteria 815
127 Ga0373933_0000545 3300035724 Bacteria 23433
128 Ga0373937_0000074 3300036401 Bacteria 91289
129 Ga0373937_0097766 3300036401 Bacteria 2723
130 Ga0316584_0078073 3300036712 Bacteria 2480
131 Ga0373925_0110181 3300037068 Bacteria 2126
132 Ga0436364_0663405 3300037853 Bacteria 2569
133 Ga0400484_01960 3300038725 Bacteria 2302
134 Ga0400484_15480 3300038725 Bacteria 1143
135 Ga0400484_24042 3300038725 Unclassified 1746
136 Ga0400490_12789 3300038726 Bacteria 16595
137 Ga0400490_33618 3300038726 Bacteria 1647
138 Ga0400490_33696 3300038726 Bacteria 3416
139 Ga0400490_39225 3300038726 Unclassified 1523
140 Ga0400490_59624 3300038726 Bacteria 5104
141 Ga0400491_08147 3300038727 Unclassified 3798
142 Ga0400485_00345 3300038735 Bacteria 7996
143 Ga0400485_04227 3300038735 Bacteria 12381
144 Ga0400488_02584 3300038741 Bacteria 2234
145 Ga0400488_26906 3300038741 Bacteria 1035
146 Ga0400486_07680 3300038742 Bacteria 16080
147 Ga0400486_18753 3300038742 Bacteria 46597
148 Ga0400486_22534 3300038742 Bacteria 13410
149 Ga0400483_195000 3300039062 Bacteria 103610
150 Ga0400483_273915 3300039062 Bacteria 20473
151 Ga0400489_52417 3300039093 Bacteria 32559
152 Ga0400489_68411 3300039093 Bacteria 1135
153 Ga0400489_75995 3300039093 Bacteria 10957
154 Ga0400487_07837 3300039110 Bacteria 5661
155 Ga0400487_43802 3300039110 Bacteria 1135
156 Ga0400487_55410 3300039110 Bacteria 3184
157 Ga0436365_1047424 3300039437 Bacteria 1108
158 Ga0436365_1709451 3300039437 Bacteria 1207
159 Ga0451577_0130660 3300042876 Bacteria 2253
160 Ga0451577_0248756 3300042876 Unclassified 1609
161 Ga0451577_0858435 3300042876 Unclassified 818
162 Ga0453683_0005776 3300044673 Bacteria 8570
163 Ga0453683_0010355 3300044673 Bacteria 6178
164 Ga0453683_0013118 3300044673 Bacteria 5419
165 Ga0453683_0251863 3300044673 Bacteria 1126
166 Ga0453684_0005601 3300044712 Bacteria 24726
167 Ga0453684_0255225 3300044712 Bacteria 2011
168 Ga0453684_0332066 3300044712 Bacteria 1719
169 Ga0453684_1226242 3300044712 Unclassified 786
170 Ga0495651_0001464 3300046462 Bacteria 18261
171 Ga0495653_0045441 3300046463 Bacteria 3405
172 Ga0495639_0072436 3300046475 Bacteria 1593
173 Ga0495664_0233848 3300046477 Bacteria 1112
174 Ga0495630_0011109 3300046517 Bacteria 6516
175 Ga0495652_0105260 3300046529 Bacteria 2280
176 Ga0495586_0084513 3300046535 Bacteria 1747
177 Ga0495586_0096650 3300046535 Bacteria 1636
178 Ga0495587_0000113 3300046536 Bacteria 61684
179 Ga0495634_0132543 3300046642 Bacteria 1587
180 Ga0495599_0263320 3300046678 Bacteria 1047
181 Ga0495604_0021951 3300047317 Bacteria 5095
182 Ga0495675_0000317 3300047444 Bacteria 34404
183 Ga0495602_0000069 3300048088 Bacteria 101160
184 Ga0496104_1078518 3300048907 Bacteria 707
185 Ga0496109_0442666 3300048912 Bacteria 1228
186 Ga0496115_0994221 3300048918 Unclassified 641
187 Ga0501036_0169841 3300049572 Bacteria 1838
188 Ga0501036_0288582 3300049572 Bacteria 1373
189 Ga0501039_0029966 3300049575 Bacteria 4193
190 Ga0501039_0067329 3300049575 Bacteria 2781
191 Ga0501040_0039744 3300049576 Bacteria 3200
192 Ga0501041_0006706 3300049577 Bacteria 6746
193 Ga0501041_0036602 3300049577 Bacteria 2973
194 Ga0501042_0047828 3300049578 Bacteria 3050
195 Ga0501046_0061629 3300049580 Bacteria 2932
196 Ga0501048_0106066 3300049582 Unclassified 1983
197 Ga0501068_0492952 3300049584 Bacteria 794
198 Ga0501071_0636830 3300049587 Bacteria 820
199 Ga0501072_0014763 3300049588 Bacteria 5988
200 Ga0501073_0291410 3300049589 Bacteria 1126
201 Ga0501074_0637440 3300049590 Bacteria 753
202 Ga0501075_0026365 3300049591 Bacteria 4278
203 Ga0501076_0000899 3300049592 Bacteria 19343
204 Ga0501077_0012308 3300049593 Bacteria 5358
205 Ga0501079_0005336 3300049741 Bacteria 9566
206 Ga0501079_0665753 3300049741 Bacteria 819
207 Ga0501080_0004344 3300049742 Bacteria 12587
208 Ga0501080_0465709 3300049742 Bacteria 1132
209 Ga0501081_0051264 3300049743 Bacteria 2846
210 Ga0501081_0115096 3300049743 Bacteria 1911
211 Ga0501083_0198826 3300049744 Bacteria 1308
212 Ga0501083_0203328 3300049744 Bacteria 1292
213 Ga0501035_0150522 3300049822 Bacteria 2020
214 Ga0501035_1064324 3300049822 Bacteria 633
215 Ga0501044_0153387 3300049823 Bacteria 2284
216 Ga0501044_0457613 3300049823 Bacteria 1182
217 Ga0501044_0569373 3300049823 Bacteria 1028
218 Ga0501045_0002703 3300049824 Bacteria 12102
219 Ga0501045_0028795 3300049824 Bacteria 4009
220 nmdc:mga09592_304526_c2 3300050508 Bacteria 780
221 nmdc:mga06r32_29217_c1 3300050510 Bacteria 5165
222 nmdc:mga06r32_871350_c1 3300050510 Bacteria 858
223 nmdc:mga0n895_314235_c1 3300050512 Bacteria 1588
224 nmdc:mga0rr50_1305932_c1 3300050513 Bacteria 615
225 nmdc:mga0rr50_86696_c1 3300050513 Bacteria 2429
226 nmdc:mga08x19_187038_c1 3300050514 Bacteria 1416
227 nmdc:mga0a205_311001_c1 3300050515 Bacteria 1447
228 Ga0495595_0284727 3300053084 Unclassified 830
229 Ga0501084_0022004 3300054114 Bacteria 5319
230 Ga0501082_0009704 3300060353 Bacteria 8288
231 Ga0530510_0016766 3300061734 Bacteria 5187
232 Ga0530510_0080967 3300061734 Bacteria 2364
233 2673166802 2671180531 Bacteria 9045424
234 Ga0070699_100190896
235 Ga0065712_10109880
236 Ga0068869_100015784
237 Ga0068868_100200032
238 Ga0068868_100337211
239 Ga0070668_100517143
240 Ga0070674_100026266
241 Ga0070703_10020277
242 Ga0070714_100314622
243 Ga0070713_100061504
244 Ga0070713_100537066
245 Ga0070710_10244509
246 Ga0070701_10099354
247 Ga0070711_100000297
248 Ga0070705_100068943
249 Ga0070705_100075491
250 Ga0070700_100009774
251 Ga0070708_100075234
252 Ga0070708_100277792
253 Ga0070708_100676880
254 Ga0070678_100261734
255 Ga0070706_100021262
256 Ga0070707_100000491
257 Ga0070707_100000959
258 Ga0070707_100396015
259 Ga0070707_100488024
260 Ga0070698_100000037
261 Ga0070698_100081162
262 Ga0070698_100116254
263 Ga0070699_100066428
264 Ga0070699_100276498
265 Ga0070697_100026994
266 Ga0070697_100107799
267 Ga0070697_100133798
268 Ga0070697_100349417
269 Ga0068853_100399631
270 Ga0070696_100061126
271 Ga0070693_100449130
272 Ga0070704_100016875
273 Ga0070704_100285960
274 Ga0070664_100129906
275 Ga0068856_100126777
276 Ga0068859_100340001
277 Ga0068863_100055665
278 Ga0068858_100235292
279 Ga0068858_101078364
280 Ga0068862_100432579
281 Ga0070717_10851330
282 Ga0070712_100374527
283 Ga0068871_100507965
284 Ga0075428_100464757
285 Ga0075431_100076708
286 Ga0075431_100771261
287 Ga0075434_100576559
288 Ga0068865_100104540
289 Ga0075436_100002615
290 Ga0075436_100037846
291 Ga0075436_100336857
292 Ga0097620_100339981
293 Ga0075435_100178818
294 Ga0099794_10143039
295 Ga0105245_10076782
296 Ga0105245_10209803
297 Ga0114129_10173234
298 Ga0105243_12210558
299 Ga0105243_12254641
300 Ga0105241_10331922
301 Ga0105248_10938020
302 Ga0105237_10060095
303 Ga0105249_10138814
304 Ga0157369_10200536
305 Ga0157378_10696479
306 Ga0163162_10439296
307 Ga0163162_11203821
308 Ga0157372_10189210
309 Ga0157375_10137637
310 Ga0157380_10480550
311 Ga0213875_10346435
312 Ga0224572_1030431
313 Ga0207692_10291997
314 Ga0207688_10224289
315 Ga0207693_10337290
316 Ga0207646_10000030
317 Ga0207646_10001164
318 Ga0207659_10474928
319 Ga0207687_10046139
320 Ga0207704_10275002
321 Ga0207711_10898485
322 Ga0207689_10024570
323 Ga0207679_10131770
324 Ga0207668_10487568
325 Ga0207677_10870866
326 Ga0207703_10382963
327 Ga0207639_10812371
328 Ga0207708_10030228
329 Ga0207702_10102410
330 Ga0207676_10973437
331 Ga0207683_10274514
332 Ga0268265_10940617
333 Ga0268264_10298540
334 Ga0265338_10006607
335 Ga0265338_10046524
336 Ga0265338_10530886
337 Ga0265330_10086684
338 Ga0265325_10001387
339 Ga0265325_10027690
340 Ga0265325_10282450
341 Ga0265331_10014653
342 Ga0265316_10011504
343 Ga0307408_100015516
344 Ga0265313_10005589
345 Ga0316575_10075708
346 Ga0265314_10343258
347 Ga0307405_10641686
348 Ga0316577_10032909
349 Ga0307410_10085743
350 Ga0307409_100008045
351 Ga0307416_100430922
352 Ga0373923_0098442
353 Ga0373945_0114036
354 Ga0373953_0069800
355 Ga0373956_0007195
356 Ga0373943_0148867
357 Ga0373955_0023631
358 Ga0373955_0030904
359 Ga0373927_0487322
360 Ga0373933_0000545
361 Ga0373937_0000074
362 Ga0373937_0097766
363 Ga0316584_0078073
364 Ga0373925_0110181
365 Ga0436364_0663405
366 Ga0400484_01960
367 Ga0400484_15480
368 Ga0400484_24042
369 Ga0400490_12789
370 Ga0400490_33618
371 Ga0400490_33696
372 Ga0400490_39225
373 Ga0400490_59624
374 Ga0400491_08147
375 Ga0400485_00345
376 Ga0400485_04227
377 Ga0400488_02584
378 Ga0400488_26906
379 Ga0400486_07680
380 Ga0400486_18753
381 Ga0400486_22534
382 Ga0400483_195000
383 Ga0400483_273915
384 Ga0400489_52417
385 Ga0400489_68411
386 Ga0400489_75995
387 Ga0400487_07837
388 Ga0400487_43802
389 Ga0400487_55410
390 Ga0436365_1047424
391 Ga0436365_1709451
392 Ga0451577_0130660
393 Ga0451577_0248756
394 Ga0451577_0858435
395 Ga0453683_0005776
396 Ga0453683_0010355
397 Ga0453683_0013118
398 Ga0453683_0251863
399 Ga0453684_0005601
400 Ga0453684_0255225
401 Ga0453684_0332066
402 Ga0453684_1226242
403 Ga0495651_0001464
404 Ga0495653_0045441
405 Ga0495639_0072436
406 Ga0495664_0233848
407 Ga0495630_0011109
408 Ga0495652_0105260
409 Ga0495586_0084513
410 Ga0495586_0096650
411 Ga0495587_0000113
412 Ga0495634_0132543
413 Ga0495599_0263320
414 Ga0495604_0021951
415 Ga0495675_0000317
416 Ga0495602_0000069
417 Ga0496104_1078518
418 Ga0496109_0442666
419 Ga0496115_0994221
420 Ga0501036_0169841
421 Ga0501036_0288582
422 Ga0501039_0029966
423 Ga0501039_0067329
424 Ga0501040_0039744
425 Ga0501041_0006706
426 Ga0501041_0036602
427 Ga0501042_0047828
428 Ga0501046_0061629
429 Ga0501048_0106066
430 Ga0501068_0492952
431 Ga0501071_0636830
432 Ga0501072_0014763
433 Ga0501073_0291410
434 Ga0501074_0637440
435 Ga0501075_0026365
436 Ga0501076_0000899
437 Ga0501077_0012308
438 Ga0501079_0005336
439 Ga0501079_0665753
440 Ga0501080_0004344
441 Ga0501080_0465709
442 Ga0501081_0051264
443 Ga0501081_0115096
444 Ga0501083_0198826
445 Ga0501083_0203328
446 Ga0501035_0150522
447 Ga0501035_1064324
448 Ga0501044_0153387
449 Ga0501044_0457613
450 Ga0501044_0569373
451 Ga0501045_0002703
452 Ga0501045_0028795
453 nmdc:mga09592_304526_c2
454 nmdc:mga06r32_29217_c1
455 nmdc:mga06r32_871350_c1
456 nmdc:mga0n895_314235_c1
457 nmdc:mga0rr50_1305932_c1
458 nmdc:mga0rr50_86696_c1
459 nmdc:mga08x19_187038_c1
460 nmdc:mga0a205_311001_c1
461 Ga0495595_0284727
462 Ga0501084_0022004
463 Ga0501082_0009704
464 Ga0530510_0016766
465 Ga0530510_0080967
466 2673166802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

86

159

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrj-assembly3.cif.gz_I crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium 0.9675 10 185
3ij5-assembly1.cif.gz_A 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis 0.9668 7 177
3n1u-assembly1.cif.gz_A structure of putative had superfamily (subfamily iii a) hydrolase from legionella pneumophila 0.9668 10 181
3hyc-assembly3.cif.gz_E crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form 0.9648 7 178
4umf-assembly1.cif.gz_C crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule 0.9645 11 182
ID Description Score Start End Superfamily
3ij5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9651 7 178 3.40.50.1000
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9642 11 182 3.40.50.1000
3mmzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9491 15 170 3.40.50.1000
4hgnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9464 14 176 3.40.50.1000
4navA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9447 5 185 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V9AZC2-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase 0.9892 22 185 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A3D2GLE6-F1-model_v4 Phenylphosphate carboxylase subunit delta 0.9862 7 182 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A4Q6FI13-F1-model_v4 deleted 0.9845 53 182
AF-A0A2H5VZP5-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) 0.9837 7 182 GO:0008781
GO:0009103
GO:0019143
GO:0046872
AF-A0A645ISL0-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) 0.9833 71 182 GO:0008781
GO:0019143

Map