F345842

General Info

Members Datasets Scaffolds Average Seq Length
233 145 466 168

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100507790|Ga0070708_1005077902
Length 198
Sequence VRTDRPAPSRPHQPSLPLPPIELLDRIPAKAFTAAVAPLFEGAPRFLSRLAEARPFGSLDELFGQARVIAHAMPRAEQVELIDAHPRLGAPPASVSGLSFVEQGYERDAAERTAVESEAEPRRIAAELDRLNAAYEDRFGFRYCVFVQGRSRTELLPAFAAALEADRRAELSRALDAVVDIARDRAGRPATPPRAGPP

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
98 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
99 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.88
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 24.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100507790 3300005445 Bacteria 1137
2 Ga0070676_10504719 3300005328 Unclassified 859
3 Ga0070666_10234060 3300005335 Bacteria 1298
4 Ga0070680_100140646 3300005336 Unclassified 2024
5 Ga0070682_100608429 3300005337 Bacteria 864
6 Ga0070692_10339904 3300005345 Bacteria 929
7 Ga0070675_100421839 3300005354 Bacteria 1193
8 Ga0070671_101108158 3300005355 Unclassified 695
9 Ga0070674_100065576 3300005356 Bacteria 2549
10 Ga0070659_100042036 3300005366 Unclassified 3574
11 Ga0070659_100776424 3300005366 Unclassified 832
12 Ga0070667_100144695 3300005367 Bacteria 2084
13 Ga0070703_10004962 3300005406 Bacteria 3713
14 Ga0070703_10049158 3300005406 Unclassified 1342
15 Ga0070705_100007884 3300005440 Bacteria 5259
16 Ga0070705_100155525 3300005440 Bacteria 1522
17 Ga0070705_100621434 3300005440 Bacteria 839
18 Ga0070705_100699242 3300005440 Unclassified 796
19 Ga0070694_100005861 3300005444 Bacteria 7453
20 Ga0070694_100389415 3300005444 Bacteria 1089
21 Ga0070708_100027335 3300005445 Bacteria 4894
22 Ga0070708_100039727 3300005445 Bacteria 4119
23 Ga0070708_100088079 3300005445 Bacteria 2822
24 Ga0070708_100101242 3300005445 Bacteria 2638
25 Ga0070708_100275845 3300005445 Bacteria 1582
26 Ga0070708_101240066 3300005445 Unclassified 697
27 Ga0070681_10982991 3300005458 Unclassified 764
28 Ga0068867_101240748 3300005459 Bacteria 686
29 Ga0070685_10173858 3300005466 Bacteria 1382
30 Ga0070706_100000392 3300005467 Bacteria 52726
31 Ga0070706_100035738 3300005467 Bacteria 4587
32 Ga0070706_100316518 3300005467 Bacteria 1456
33 Ga0070707_100002666 3300005468 Bacteria 16968
34 Ga0070707_100104044 3300005468 Bacteria 2752
35 Ga0070707_100311278 3300005468 Bacteria 1531
36 Ga0070698_100003553 3300005471 Bacteria 17128
37 Ga0070698_100601755 3300005471 Unclassified 1040
38 Ga0070698_100750397 3300005471 Bacteria 919
39 Ga0070698_100967759 3300005471 Bacteria 798
40 Ga0070698_101017824 3300005471 Bacteria 776
41 Ga0070699_100003625 3300005518 Bacteria 13656
42 Ga0070699_100036940 3300005518 Bacteria 4226
43 Ga0070679_100483634 3300005530 Unclassified 1182
44 Ga0070679_101277274 3300005530 Unclassified 680
45 Ga0070684_100185347 3300005535 Bacteria 1892
46 Ga0070697_100005921 3300005536 Bacteria 9443
47 Ga0070697_100073033 3300005536 Bacteria 2816
48 Ga0068853_100074948 3300005539 Unclassified 2953
49 Ga0070686_100066172 3300005544 Bacteria 2349
50 Ga0070686_100191357 3300005544 Unclassified 1460
51 Ga0070695_100023818 3300005545 Bacteria 3769
52 Ga0070695_100089864 3300005545 Bacteria 2048
53 Ga0070696_100002316 3300005546 Bacteria 12565
54 Ga0070696_100015109 3300005546 Bacteria 5183
55 Ga0070696_100078644 3300005546 Bacteria 2332
56 Ga0070696_100764212 3300005546 Bacteria 793
57 Ga0070693_100205870 3300005547 Unclassified 1281
58 Ga0070693_100618472 3300005547 Bacteria 784
59 Ga0070704_100052935 3300005549 Bacteria 2866
60 Ga0070704_100093059 3300005549 Bacteria 2252
61 Ga0070704_100301780 3300005549 Unclassified 1335
62 Ga0068855_100053939 3300005563 Bacteria 4729
63 Ga0070702_100185539 3300005615 Bacteria 1365
64 Ga0068852_100397045 3300005616 Bacteria 1356
65 Ga0068859_100808548 3300005617 Bacteria 1025
66 Ga0068858_100953677 3300005842 Bacteria 840
67 Ga0068860_100024673 3300005843 Bacteria 5806
68 Ga0068860_100309205 3300005843 Bacteria 1549
69 Ga0068860_101968850 3300005843 Bacteria 606
70 Ga0068862_100132115 3300005844 Bacteria 2209
71 Ga0068862_101258572 3300005844 Bacteria 740
72 Ga0081539_10002524 3300005985 Bacteria 25575
73 Ga0081539_10005115 3300005985 Bacteria 13714
74 Ga0075433_10220999 3300006852 Unclassified 1683
75 Ga0075434_100979320 3300006871 Unclassified 860
76 Ga0097620_100808429 3300006931 Bacteria 1025
77 Ga0105250_10134803 3300009092 Bacteria 1021
78 Ga0105245_10179410 3300009098 Bacteria 2022
79 Ga0105245_10557216 3300009098 Bacteria 1169
80 Ga0105245_10944472 3300009098 Unclassified 905
81 Ga0105242_10186035 3300009176 Bacteria 1836
82 Ga0105249_10133825 3300009553 Bacteria 2370
83 Ga0105239_10165480 3300010375 Unclassified 2473
84 Ga0105239_10378625 3300010375 Bacteria 1600
85 Ga0105246_11282056 3300011119 Bacteria 678
86 Ga0157374_10811434 3300013296 Bacteria 952
87 Ga0157378_10069002 3300013297 Unclassified 3171
88 Ga0157378_10864635 3300013297 Bacteria 933
89 Ga0157378_11734048 3300013297 Unclassified 672
90 Ga0163162_10531529 3300013306 Bacteria 1305
91 Ga0163162_12610620 3300013306 Bacteria 581
92 Ga0157375_10033353 3300013308 Bacteria 4891
93 Ga0163163_10097494 3300014325 Bacteria 2960
94 Ga0163163_11187567 3300014325 Bacteria 826
95 Ga0182008_10128919 3300014497 Bacteria 1261
96 Ga0157377_10045801 3300014745 Bacteria 2445
97 Ga0163161_10329171 3300017792 Bacteria 1209
98 Ga0207653_10011024 3300025885 Bacteria 2822
99 Ga0207653_10035864 3300025885 Unclassified 1614
100 Ga0207688_10253012 3300025901 Unclassified 1067
101 Ga0207684_10000852 3300025910 Bacteria 35040
102 Ga0207684_10025157 3300025910 Bacteria 5074
103 Ga0207684_10448245 3300025910 Bacteria 1108
104 Ga0207707_10030688 3300025912 Unclassified 4702
105 Ga0207660_10442512 3300025917 Unclassified 1050
106 Ga0207662_10016203 3300025918 Bacteria 4203
107 Ga0207652_10093944 3300025921 Unclassified 2640
108 Ga0207652_10133972 3300025921 Unclassified 2211
109 Ga0207646_10007825 3300025922 Bacteria 10798
110 Ga0207646_10010138 3300025922 Bacteria 9232
111 Ga0207646_10126076 3300025922 Bacteria 2302
112 Ga0207646_10418669 3300025922 Bacteria 1209
113 Ga0207650_10649226 3300025925 Bacteria 889
114 Ga0207659_10104274 3300025926 Bacteria 2144
115 Ga0207690_10018407 3300025932 Bacteria 4284
116 Ga0207709_10647776 3300025935 Unclassified 841
117 Ga0207704_10393859 3300025938 Unclassified 1091
118 Ga0207665_11077239 3300025939 Bacteria 640
119 Ga0207691_10057362 3300025940 Bacteria 3544
120 Ga0207689_10079893 3300025942 Bacteria 2688
121 Ga0207661_10925783 3300025944 Bacteria 803
122 Ga0207651_10515878 3300025960 Bacteria 1035
123 Ga0207712_10246310 3300025961 Bacteria 1442
124 Ga0207677_10221472 3300026023 Bacteria 1518
125 Ga0207677_10767373 3300026023 Bacteria 861
126 Ga0207677_11367649 3300026023 Bacteria 651
127 Ga0207703_10262857 3300026035 Bacteria 1560
128 Ga0207703_10478056 3300026035 Bacteria 1167
129 Ga0207639_10994205 3300026041 Bacteria 785
130 Ga0207676_10098206 3300026095 Bacteria 2421
131 Ga0207676_10804546 3300026095 Bacteria 917
132 Ga0207675_100162552 3300026118 Unclassified 2131
133 Ga0207675_100862442 3300026118 Bacteria 921
134 Ga0268265_10146805 3300028380 Bacteria 1983
135 Ga0268264_10752114 3300028381 Bacteria 971
136 Ga0265318_10046856 3300028577 Bacteria 1631
137 Ga0265318_10049580 3300028577 Unclassified 1579
138 Ga0265336_10022382 3300028666 Bacteria 2012
139 Ga0265325_10107110 3300031241 Bacteria 1362
140 Ga0265325_10262109 3300031241 Unclassified 780
141 Ga0307408_100194189 3300031548 Bacteria 1638
142 Ga0307413_10957917 3300031824 Unclassified 731
143 Ga0307416_100255097 3300032002 Bacteria 1710
144 Ga0307416_100367273 3300032002 Bacteria 1464
145 Ga0307416_101963340 3300032002 Unclassified 688
146 Ga0307416_102205875 3300032002 Bacteria 652
147 Ga0373926_0084264 3300035083 Unclassified 1178
148 Ga0373929_0050613 3300035085 Bacteria 949
149 Ga0373941_0017422 3300035115 Bacteria 1969
150 Ga0373933_0473828 3300035724 Bacteria 820
151 Ga0373947_0288999 3300035725 Unclassified 1091
152 Ga0373937_0144961 3300036401 Unclassified 2223
153 Ga0373925_0202616 3300037068 Unclassified 1578
154 Ga0395905_0464093 3300037471 Bacteria 1165
155 Ga0451853_2097130 3300041512 Bacteria 1206
156 Ga0439458_0230613 3300042157 Unclassified 512
157 Ga0439459_0024751 3300042438 Bacteria 1180
158 Ga0439460_0056914 3300042461 Bacteria 1185
159 Ga0495603_0031869 3300046455 Bacteria 3173
160 Ga0495629_0654349 3300046459 Bacteria 700
161 Ga0495641_0138804 3300046461 Bacteria 1086
162 Ga0495641_0195755 3300046461 Bacteria 906
163 Ga0495608_0427339 3300046511 Bacteria 808
164 Ga0495618_0258038 3300046514 Unclassified 1092
165 Ga0495640_0178842 3300046533 Bacteria 1353
166 Ga0495634_0622030 3300046642 Bacteria 625
167 Ga0495635_0624021 3300046663 Bacteria 703
168 Ga0495623_0261186 3300046679 Bacteria 970
169 Ga0495658_0159857 3300046683 Bacteria 1389
170 Ga0495613_0258183 3300046689 Bacteria 1215
171 Ga0495624_0141298 3300046690 Bacteria 1475
172 Ga0495600_0550003 3300046809 Bacteria 705
173 Ga0495581_0740514 3300047315 Bacteria 566
174 Ga0495676_0188994 3300047321 Bacteria 1438
175 Ga0495602_0195608 3300048088 Bacteria 1547
176 Ga0496100_0823760 3300048903 Bacteria 727
177 Ga0496102_0846370 3300048905 Bacteria 837
178 Ga0496104_0066154 3300048907 Bacteria 3431
179 Ga0496104_0352710 3300048907 Unclassified 1384
180 Ga0496104_0562911 3300048907 Unclassified 1050
181 Ga0496104_0688471 3300048907 Bacteria 930
182 Ga0496105_0012001 3300048908 Bacteria 6860
183 Ga0496105_0033971 3300048908 Bacteria 4193
184 Ga0496105_0156912 3300048908 Unclassified 1869
185 Ga0496106_0180473 3300048909 Bacteria 1676
186 Ga0496106_0440474 3300048909 Unclassified 1047
187 Ga0496106_0643227 3300048909 Bacteria 848
188 Ga0496107_0366986 3300048910 Unclassified 1071
189 Ga0496107_0518649 3300048910 Unclassified 884
190 Ga0496108_0023326 3300048911 Bacteria 5090
191 Ga0496108_0054075 3300048911 Bacteria 3369
192 Ga0496108_0896926 3300048911 Bacteria 761
193 Ga0496109_0059965 3300048912 Bacteria 3476
194 Ga0496109_0065370 3300048912 Bacteria 3329
195 Ga0496109_0123789 3300048912 Bacteria 2410
196 Ga0496109_0490108 3300048912 Bacteria 1160
197 Ga0496109_0513556 3300048912 Bacteria 1131
198 Ga0496110_0123472 3300048913 Bacteria 2335
199 Ga0496110_0406335 3300048913 Bacteria 1241
200 Ga0496111_0064586 3300048914 Bacteria 2655
201 Ga0496111_0103496 3300048914 Bacteria 2094
202 Ga0496111_0161114 3300048914 Unclassified 1666
203 Ga0496111_0295446 3300048914 Unclassified 1201
204 Ga0496112_0041043 3300048915 Bacteria 4526
205 Ga0496112_0059321 3300048915 Bacteria 3770
206 Ga0496112_0396150 3300048915 Unclassified 1321
207 Ga0496113_0004700 3300048916 Bacteria 8424
208 Ga0496113_0011083 3300048916 Bacteria 5996
209 Ga0496113_0241689 3300048916 Unclassified 1441
210 Ga0496113_0289341 3300048916 Bacteria 1311
211 Ga0496114_0204094 3300048917 Bacteria 1732
212 Ga0496114_1480789 3300048917 Bacteria 567
213 Ga0501067_0082331 3300049583 Bacteria 1785
214 Ga0501068_0050240 3300049584 Bacteria 2521
215 Ga0501069_0192702 3300049585 Bacteria 1180
216 Ga0501069_0480568 3300049585 Bacteria 740
217 Ga0501072_0276975 3300049588 Bacteria 1335
218 Ga0501080_0715231 3300049742 Unclassified 883
219 Ga0501081_0205333 3300049743 Unclassified 1430
220 Ga0501081_0444579 3300049743 Bacteria 963
221 Ga0501045_0691734 3300049824 Unclassified 753
222 nmdc:mga0n895_243684_c1 3300050512 Unclassified 1824
223 Ga0495601_0058174 3300053077 Unclassified 2449
224 Ga0495601_0903575 3300053077 Bacteria 558
225 Ga0495612_0000184 3300053078 Bacteria 26490
226 Ga0495612_0339100 3300053078 Bacteria 678
227 Ga0495619_0079059 3300053085 Bacteria 2212
228 Ga0501084_0175852 3300054114 Bacteria 1807
229 Ga0590071_008079 3300059421 Unclassified 2485
230 Ga0590074_001131 3300059423 Bacteria 4197
231 Ga0590075_003320 3300059424 Bacteria 3834
232 Ga0590077_000959 3300059426 Bacteria 7357
233 Ga0501082_1300051 3300060353 Bacteria 635
234 Ga0070708_100507790
235 Ga0070676_10504719
236 Ga0070666_10234060
237 Ga0070680_100140646
238 Ga0070682_100608429
239 Ga0070692_10339904
240 Ga0070675_100421839
241 Ga0070671_101108158
242 Ga0070674_100065576
243 Ga0070659_100042036
244 Ga0070659_100776424
245 Ga0070667_100144695
246 Ga0070703_10004962
247 Ga0070703_10049158
248 Ga0070705_100007884
249 Ga0070705_100155525
250 Ga0070705_100621434
251 Ga0070705_100699242
252 Ga0070694_100005861
253 Ga0070694_100389415
254 Ga0070708_100027335
255 Ga0070708_100039727
256 Ga0070708_100088079
257 Ga0070708_100101242
258 Ga0070708_100275845
259 Ga0070708_101240066
260 Ga0070681_10982991
261 Ga0068867_101240748
262 Ga0070685_10173858
263 Ga0070706_100000392
264 Ga0070706_100035738
265 Ga0070706_100316518
266 Ga0070707_100002666
267 Ga0070707_100104044
268 Ga0070707_100311278
269 Ga0070698_100003553
270 Ga0070698_100601755
271 Ga0070698_100750397
272 Ga0070698_100967759
273 Ga0070698_101017824
274 Ga0070699_100003625
275 Ga0070699_100036940
276 Ga0070679_100483634
277 Ga0070679_101277274
278 Ga0070684_100185347
279 Ga0070697_100005921
280 Ga0070697_100073033
281 Ga0068853_100074948
282 Ga0070686_100066172
283 Ga0070686_100191357
284 Ga0070695_100023818
285 Ga0070695_100089864
286 Ga0070696_100002316
287 Ga0070696_100015109
288 Ga0070696_100078644
289 Ga0070696_100764212
290 Ga0070693_100205870
291 Ga0070693_100618472
292 Ga0070704_100052935
293 Ga0070704_100093059
294 Ga0070704_100301780
295 Ga0068855_100053939
296 Ga0070702_100185539
297 Ga0068852_100397045
298 Ga0068859_100808548
299 Ga0068858_100953677
300 Ga0068860_100024673
301 Ga0068860_100309205
302 Ga0068860_101968850
303 Ga0068862_100132115
304 Ga0068862_101258572
305 Ga0081539_10002524
306 Ga0081539_10005115
307 Ga0075433_10220999
308 Ga0075434_100979320
309 Ga0097620_100808429
310 Ga0105250_10134803
311 Ga0105245_10179410
312 Ga0105245_10557216
313 Ga0105245_10944472
314 Ga0105242_10186035
315 Ga0105249_10133825
316 Ga0105239_10165480
317 Ga0105239_10378625
318 Ga0105246_11282056
319 Ga0157374_10811434
320 Ga0157378_10069002
321 Ga0157378_10864635
322 Ga0157378_11734048
323 Ga0163162_10531529
324 Ga0163162_12610620
325 Ga0157375_10033353
326 Ga0163163_10097494
327 Ga0163163_11187567
328 Ga0182008_10128919
329 Ga0157377_10045801
330 Ga0163161_10329171
331 Ga0207653_10011024
332 Ga0207653_10035864
333 Ga0207688_10253012
334 Ga0207684_10000852
335 Ga0207684_10025157
336 Ga0207684_10448245
337 Ga0207707_10030688
338 Ga0207660_10442512
339 Ga0207662_10016203
340 Ga0207652_10093944
341 Ga0207652_10133972
342 Ga0207646_10007825
343 Ga0207646_10010138
344 Ga0207646_10126076
345 Ga0207646_10418669
346 Ga0207650_10649226
347 Ga0207659_10104274
348 Ga0207690_10018407
349 Ga0207709_10647776
350 Ga0207704_10393859
351 Ga0207665_11077239
352 Ga0207691_10057362
353 Ga0207689_10079893
354 Ga0207661_10925783
355 Ga0207651_10515878
356 Ga0207712_10246310
357 Ga0207677_10221472
358 Ga0207677_10767373
359 Ga0207677_11367649
360 Ga0207703_10262857
361 Ga0207703_10478056
362 Ga0207639_10994205
363 Ga0207676_10098206
364 Ga0207676_10804546
365 Ga0207675_100162552
366 Ga0207675_100862442
367 Ga0268265_10146805
368 Ga0268264_10752114
369 Ga0265318_10046856
370 Ga0265318_10049580
371 Ga0265336_10022382
372 Ga0265325_10107110
373 Ga0265325_10262109
374 Ga0307408_100194189
375 Ga0307413_10957917
376 Ga0307416_100255097
377 Ga0307416_100367273
378 Ga0307416_101963340
379 Ga0307416_102205875
380 Ga0373926_0084264
381 Ga0373929_0050613
382 Ga0373941_0017422
383 Ga0373933_0473828
384 Ga0373947_0288999
385 Ga0373937_0144961
386 Ga0373925_0202616
387 Ga0395905_0464093
388 Ga0451853_2097130
389 Ga0439458_0230613
390 Ga0439459_0024751
391 Ga0439460_0056914
392 Ga0495603_0031869
393 Ga0495629_0654349
394 Ga0495641_0138804
395 Ga0495641_0195755
396 Ga0495608_0427339
397 Ga0495618_0258038
398 Ga0495640_0178842
399 Ga0495634_0622030
400 Ga0495635_0624021
401 Ga0495623_0261186
402 Ga0495658_0159857
403 Ga0495613_0258183
404 Ga0495624_0141298
405 Ga0495600_0550003
406 Ga0495581_0740514
407 Ga0495676_0188994
408 Ga0495602_0195608
409 Ga0496100_0823760
410 Ga0496102_0846370
411 Ga0496104_0066154
412 Ga0496104_0352710
413 Ga0496104_0562911
414 Ga0496104_0688471
415 Ga0496105_0012001
416 Ga0496105_0033971
417 Ga0496105_0156912
418 Ga0496106_0180473
419 Ga0496106_0440474
420 Ga0496106_0643227
421 Ga0496107_0366986
422 Ga0496107_0518649
423 Ga0496108_0023326
424 Ga0496108_0054075
425 Ga0496108_0896926
426 Ga0496109_0059965
427 Ga0496109_0065370
428 Ga0496109_0123789
429 Ga0496109_0490108
430 Ga0496109_0513556
431 Ga0496110_0123472
432 Ga0496110_0406335
433 Ga0496111_0064586
434 Ga0496111_0103496
435 Ga0496111_0161114
436 Ga0496111_0295446
437 Ga0496112_0041043
438 Ga0496112_0059321
439 Ga0496112_0396150
440 Ga0496113_0004700
441 Ga0496113_0011083
442 Ga0496113_0241689
443 Ga0496113_0289341
444 Ga0496114_0204094
445 Ga0496114_1480789
446 Ga0501067_0082331
447 Ga0501068_0050240
448 Ga0501069_0192702
449 Ga0501069_0480568
450 Ga0501072_0276975
451 Ga0501080_0715231
452 Ga0501081_0205333
453 Ga0501081_0444579
454 Ga0501045_0691734
455 nmdc:mga0n895_243684_c1
456 Ga0495601_0058174
457 Ga0495601_0903575
458 Ga0495612_0000184
459 Ga0495612_0339100
460 Ga0495619_0079059
461 Ga0501084_0175852
462 Ga0590071_008079
463 Ga0590074_001131
464 Ga0590075_003320
465 Ga0590077_000959
466 Ga0501082_1300051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09349

OHCU_decarbox

OHCU decarboxylase

25

187

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o74-assembly3.cif.gz_F structure of ohcu decarboxylase in complex with guanine 0.886 5 164
2o74-assembly3.cif.gz_F structure of ohcu decarboxylase in complex with guanine 0.8567 5 164
2q37-assembly1.cif.gz_A-2 crystal structure of ohcu decarboxylase in the presence of (s)-allantoin 0.8553 21 163
5z5m-assembly1.cif.gz_D crystal structure of (s)-allantoin synthase 0.8273 5 163
3o7j-assembly1.cif.gz_A crystal structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase from klebsiella pneumoniae 0.8187 7 159
ID Description Score Start End Superfamily
af_Q54SV3_483_649_1.10.3330.10 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.914 6 163 1.10.3330.10
af_A0A1D8PJ87_5_184_1.10.3330.10 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.9014 6 165 1.10.3330.10
2o70F00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8838 5 164 1.10.3330.10
af_Q54SV3_483_649_1.10.3330.10 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8725 6 163 1.10.3330.10
af_A0A1D8PJ87_5_184_1.10.3330.10 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8708 6 165 1.10.3330.10
ID Description Score Start End GO Terms
AF-A0A536P165-F1-model_v4 Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase domain-containing protein 0.9757 59 162 GO:0006144
AF-A0A534ZZL5-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9677 7 164 GO:0005777
GO:0006144
GO:0016747
GO:0019628
GO:0051997
AF-A0A1Q7WI77-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9643 58 162 GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A536P165-F1-model_v4 Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase domain-containing protein 0.9575 59 162 GO:0006144
AF-A0A535VX61-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9574 3 159 GO:0005777
GO:0006144
GO:0019628
GO:0051997

Map