F345776

General Info

Members Datasets Scaffolds Average Seq Length
233 129 231 156

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10253711|Ga0070666_102537112
Length 175
Sequence MPADPPSPRQPGAVLFACNLNQVRSPMAEALLKLLVGDRIYVDSCGLRLPDMVHDETSDEDVAAGVDPFVEVVMAELGGALAGHRPKTFDELEDDSFDLVVSLTPEAQHRAVELARGRAADIEYWPIIDPTLVEGSREVRLEAYRQVRDALARRIAQRIGLDGPSPIDLPPRGAL

Samples

Sample ID Description Type Environment
1 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
2 2851153111 Caulobacter radicis 736 Isolate Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
121 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
122 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
125 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
126 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
127 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
128 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
129 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.44
Nodule 0
Rhizoplane 3.43
Rhizosphere 81.55
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1037380 3300003775 Bacteria 1289
2 JGI25405J52794_10012667 3300003911 Bacteria 1627
3 Ga0070658_10051531 3300005327 Bacteria 3335
4 Ga0070658_10078835 3300005327 Bacteria 2704
5 Ga0070658_10088652 3300005327 Bacteria 2547
6 Ga0070658_10113000 3300005327 Bacteria 2251
7 Ga0070670_100004147 3300005331 Bacteria 12116
8 Ga0070670_101171488 3300005331 Bacteria 702
9 Ga0070666_10025975 3300005335 Bacteria 3822
10 Ga0070666_10102146 3300005335 Bacteria 1977
11 Ga0070666_10141913 3300005335 Bacteria 1673
12 Ga0070666_10204616 3300005335 Bacteria 1389
13 Ga0070666_10253711 3300005335 Bacteria 1246
14 Ga0070680_100030959 3300005336 Bacteria 4299
15 Ga0070680_100161716 3300005336 Bacteria 1882
16 Ga0070680_101093210 3300005336 Bacteria 689
17 Ga0070660_100015050 3300005339 Bacteria 5580
18 Ga0070660_100072874 3300005339 Bacteria 2685
19 Ga0070660_100101727 3300005339 Bacteria 2277
20 Ga0070660_100395847 3300005339 Bacteria 1142
21 Ga0070691_10151676 3300005341 Bacteria 1189
22 Ga0070661_100037908 3300005344 Bacteria 3508
23 Ga0070661_100818851 3300005344 Bacteria 765
24 Ga0070668_100000274 3300005347 Bacteria 34084
25 Ga0070668_100002570 3300005347 Bacteria 13353
26 Ga0070659_100006376 3300005366 Bacteria 8521
27 Ga0070659_100015044 3300005366 Bacteria 5788
28 Ga0070659_100336484 3300005366 Bacteria 1264
29 Ga0070667_100000152 3300005367 Bacteria 86556
30 Ga0070667_100037013 3300005367 Bacteria 4091
31 Ga0070714_101071312 3300005435 Bacteria 785
32 Ga0070681_10014224 3300005458 Bacteria 7919
33 Ga0070681_10067878 3300005458 Bacteria 3533
34 Ga0070681_10071480 3300005458 Bacteria 3434
35 Ga0070679_100007466 3300005530 Bacteria 10218
36 Ga0070679_100016803 3300005530 Bacteria 7071
37 Ga0070679_100987218 3300005530 Bacteria 786
38 Ga0068853_100004541 3300005539 Bacteria 10772
39 Ga0068853_100556524 3300005539 Bacteria 1087
40 Ga0070665_100000015 3300005548 Bacteria 462744
41 Ga0070665_100003248 3300005548 Bacteria 17474
42 Ga0070665_100009253 3300005548 Bacteria 9977
43 Ga0068855_100047223 3300005563 Bacteria 5087
44 Ga0068855_100248545 3300005563 Bacteria 1984
45 Ga0068855_100665445 3300005563 Bacteria 1117
46 Ga0070664_100536530 3300005564 Bacteria 1081
47 Ga0068854_100143578 3300005578 Bacteria 1834
48 Ga0068854_100507058 3300005578 Bacteria 1017
49 Ga0068856_100088910 3300005614 Bacteria 3071
50 Ga0068856_100248716 3300005614 Bacteria 1793
51 Ga0068856_100708164 3300005614 Bacteria 1027
52 Ga0068852_100018348 3300005616 Bacteria 5511
53 Ga0068859_100288489 3300005617 Bacteria 1734
54 Ga0068859_101171121 3300005617 Bacteria 846
55 Ga0068864_100000948 3300005618 Bacteria 24272
56 Ga0068864_100001298 3300005618 Bacteria 20797
57 Ga0068864_100404661 3300005618 Bacteria 1297
58 Ga0068863_100000331 3300005841 Bacteria 48023
59 Ga0068863_100013949 3300005841 Bacteria 7746
60 Ga0068858_100000378 3300005842 Bacteria 46589
61 Ga0068858_100005511 3300005842 Bacteria 12394
62 Ga0068858_100141455 3300005842 Bacteria 2259
63 Ga0068858_100469434 3300005842 Bacteria 1214
64 Ga0068860_100004797 3300005843 Bacteria 13770
65 Ga0068862_100000638 3300005844 Bacteria 36283
66 Ga0068862_100037374 3300005844 Bacteria 4116
67 Ga0081455_10000142 3300005937 Bacteria 84680
68 Ga0081455_10251986 3300005937 Bacteria 1291
69 Ga0075368_10001625 3300006042 Bacteria 7217
70 Ga0075364_10048056 3300006051 Bacteria 2780
71 Ga0075367_10000197 3300006178 Bacteria 19933
72 Ga0075366_10023463 3300006195 Bacteria 3594
73 Ga0097620_100288485 3300006931 Bacteria 1734
74 Ga0097620_101171552 3300006931 Bacteria 846
75 Ga0105240_10000671 3300009093 Bacteria 62794
76 Ga0105240_10001932 3300009093 Bacteria 34400
77 Ga0105240_10023503 3300009093 Bacteria 8149
78 Ga0105240_10143210 3300009093 Bacteria 2856
79 Ga0105240_10331959 3300009093 Bacteria 1730
80 Ga0105241_10843215 3300009174 Bacteria 847
81 Ga0105242_10917882 3300009176 Bacteria 877
82 Ga0105248_10120894 3300009177 Bacteria 2954
83 Ga0105248_10139978 3300009177 Bacteria 2729
84 Ga0105248_10216161 3300009177 Bacteria 2159
85 Ga0105248_10661593 3300009177 Bacteria 1178
86 Ga0105248_10917123 3300009177 Bacteria 989
87 Ga0105237_12232283 3300009545 Bacteria 557
88 Ga0105238_10007222 3300009551 Bacteria 11117
89 Ga0105238_10013308 3300009551 Bacteria 8300
90 Ga0105249_10005492 3300009553 Bacteria 10954
91 Ga0105239_10366164 3300010375 Bacteria 1629
92 Ga0105239_10571681 3300010375 Bacteria 1288
93 Ga0105239_11304959 3300010375 Bacteria 837
94 Ga0157370_10098256 3300013104 Bacteria 2746
95 Ga0157370_11121638 3300013104 Bacteria 710
96 Ga0157370_11123326 3300013104 Unclassified 710
97 Ga0157369_10038364 3300013105 Bacteria 5238
98 Ga0163162_10403232 3300013306 Bacteria 1500
99 Ga0157372_10039714 3300013307 Bacteria 5195
100 Ga0157375_12326365 3300013308 Bacteria 639
101 Ga0163163_10009873 3300014325 Bacteria 8552
102 Ga0163163_10131926 3300014325 Bacteria 2538
103 Ga0163163_10142761 3300014325 Bacteria 2437
104 Ga0157379_10014140 3300014968 Bacteria 6998
105 Ga0213874_10004601 3300021377 Bacteria 3167
106 Ga0213876_10000116 3300021384 Bacteria 86507
107 Ga0213876_10035205 3300021384 Bacteria 2641
108 Ga0209455_1017662 3300025272 Bacteria 1488
109 Ga0207680_10002875 3300025903 Bacteria 8066
110 Ga0207680_10027900 3300025903 Bacteria 3152
111 Ga0207680_10113202 3300025903 Bacteria 1764
112 Ga0207680_10270818 3300025903 Bacteria 1178
113 Ga0207705_10001540 3300025909 Bacteria 18302
114 Ga0207705_10608713 3300025909 Bacteria 849
115 Ga0207707_10007495 3300025912 Bacteria 9508
116 Ga0207707_10021581 3300025912 Bacteria 5627
117 Ga0207695_10002188 3300025913 Bacteria 29491
118 Ga0207695_10002749 3300025913 Bacteria 25651
119 Ga0207695_10003212 3300025913 Bacteria 23276
120 Ga0207695_10053311 3300025913 Bacteria 4231
121 Ga0207695_10099579 3300025913 Bacteria 2904
122 Ga0207695_10550032 3300025913 Bacteria 1036
123 Ga0207671_11327989 3300025914 Bacteria 559
124 Ga0207660_10000779 3300025917 Bacteria 21186
125 Ga0207660_10075395 3300025917 Bacteria 2464
126 Ga0207660_10126885 3300025917 Bacteria 1938
127 Ga0207660_10357617 3300025917 Bacteria 1171
128 Ga0207657_10012168 3300025919 Bacteria 8502
129 Ga0207657_10040011 3300025919 Bacteria 4157
130 Ga0207657_10053048 3300025919 Bacteria 3515
131 Ga0207652_10024314 3300025921 Bacteria 5025
132 Ga0207652_10587327 3300025921 Bacteria 1000
133 Ga0207652_10663326 3300025921 Bacteria 932
134 Ga0207694_10069016 3300025924 Bacteria 2761
135 Ga0207694_10144047 3300025924 Bacteria 1917
136 Ga0207650_10000235 3300025925 Bacteria 61521
137 Ga0207644_10029931 3300025931 Bacteria 3780
138 Ga0207690_10000111 3300025932 Bacteria 66639
139 Ga0207690_10013522 3300025932 Bacteria 4904
140 Ga0207690_10374357 3300025932 Bacteria 1130
141 Ga0207711_10013342 3300025941 Bacteria 6823
142 Ga0207711_10037007 3300025941 Bacteria 4142
143 Ga0207711_11497273 3300025941 Bacteria 618
144 Ga0207667_10024419 3300025949 Bacteria 6636
145 Ga0207667_10051432 3300025949 Bacteria 4343
146 Ga0207667_10059910 3300025949 Bacteria 3985
147 Ga0207712_10000675 3300025961 Bacteria 26389
148 Ga0207668_10000016 3300025972 Bacteria 159703
149 Ga0207668_10000441 3300025972 Bacteria 26198
150 Ga0207658_10000189 3300025986 Bacteria 65788
151 Ga0207658_10065941 3300025986 Bacteria 2721
152 Ga0207703_10000399 3300026035 Bacteria 46666
153 Ga0207703_10010109 3300026035 Bacteria 7394
154 Ga0207703_10204964 3300026035 Bacteria 1754
155 Ga0207703_10267152 3300026035 Bacteria 1548
156 Ga0207639_10038066 3300026041 Bacteria 3576
157 Ga0207639_10063878 3300026041 Bacteria 2852
158 Ga0207702_10188255 3300026078 Bacteria 1905
159 Ga0207641_10000070 3300026088 Bacteria 152598
160 Ga0207641_10003947 3300026088 Bacteria 12958
161 Ga0207676_10000472 3300026095 Bacteria 33789
162 Ga0207676_10000602 3300026095 Bacteria 29493
163 Ga0207698_10395334 3300026142 Bacteria 1319
164 Ga0209813_10017943 3300027866 Bacteria 1949
165 Ga0268266_10000005 3300028379 Bacteria 1448194
166 Ga0268266_10001029 3300028379 Bacteria 35121
167 Ga0268266_10006677 3300028379 Bacteria 10526
168 Ga0268265_10005746 3300028380 Bacteria 8469
169 Ga0268264_10000118 3300028381 Bacteria 193487
170 Ga0268264_10000378 3300028381 Bacteria 64934
171 Ga0265337_1104605 3300028556 Bacteria 770
172 Ga0265338_10327502 3300028800 Bacteria 1107
173 Ga0265327_10000290 3300031251 Bacteria 98475
174 Ga0307513_10000506 3300031456 Bacteria 56167
175 Ga0307513_10008748 3300031456 Bacteria 12896
176 Ga0316576_10207738 3300031727 Bacteria 1474
177 Ga0395899_0046843 3300037312 Bacteria 3219
178 Ga0395898_1045014 3300037466 Bacteria 751
179 Ga0436364_1149017 3300037853 Bacteria 2933
180 Ga0395901_0163336 3300038443 Bacteria 2338
181 Ga0436365_0045162 3300039437 Bacteria 2695
182 Ga0436365_0947453 3300039437 Bacteria 15265
183 Ga0436363_0037111 3300039450 Unclassified 548
184 Ga0436363_0224534 3300039450 Bacteria 4047
185 Ga0451577_0408273 3300042876 Bacteria 1233
186 Ga0466957_0433151 3300044842 Bacteria 904
187 Ga0495583_0036128 3300046506 Bacteria 2353
188 Ga0495606_0354388 3300046507 Bacteria 778
189 Ga0495611_0071582 3300046648 Bacteria 1585
190 Ga0495625_0045630 3300046660 Bacteria 3166
191 Ga0495625_0294600 3300046660 Bacteria 1040
192 Ga0495588_0405289 3300046674 Bacteria 716
193 Ga0495669_0000042 3300046684 Bacteria 87033
194 Ga0495669_0000097 3300046684 Bacteria 54707
195 Ga0495669_0093036 3300046684 Bacteria 1394
196 Ga0495677_0020211 3300047445 Bacteria 2415
197 Ga0495677_0028265 3300047445 Bacteria 2036
198 Ga0496101_0926486 3300048904 Bacteria 686
199 Ga0496101_1577804 3300048904 Bacteria 510
200 Ga0496102_0061354 3300048905 Bacteria 3441
201 Ga0496103_0398442 3300048906 Bacteria 884
202 Ga0496109_0911458 3300048912 Bacteria 817
203 Ga0496112_1116693 3300048915 Bacteria 706
204 Ga0496115_0002754 3300048918 Bacteria 12635
205 Ga0496115_0008854 3300048918 Bacteria 7460
206 Ga0496126_0567060 3300048929 Bacteria 899
207 Ga0501033_0016709 3300049570 Bacteria 5551
208 Ga0501034_0260758 3300049571 Bacteria 1676
209 Ga0501037_0046334 3300049573 Bacteria 3189
210 Ga0501043_0480966 3300049579 Bacteria 930
211 Ga0501047_0429306 3300049581 Bacteria 1152
212 Ga0501047_0652414 3300049581 Bacteria 872
213 Ga0501047_1088990 3300049581 Bacteria 612
214 Ga0501073_0890457 3300049589 Bacteria 613
215 Ga0501035_0057364 3300049822 Bacteria 3472
216 Ga0501044_0002124 3300049823 Bacteria 22745
217 nmdc:mga00v17_5085_c1 3300050491 Bacteria 6908
218 nmdc:mga04h51_21297_c1 3300050495 Bacteria 1949
219 nmdc:mga07m45_673605_c1 3300050496 Bacteria 596
220 nmdc:mga07m45_72105_c1 3300050496 Bacteria 1966
221 Ga0500635_0169653 3300053080 Bacteria 840
222 Ga0500643_021288 3300053087 Bacteria 2103
223 Ga0500647_0071450 3300053091 Bacteria 1668
224 Ga0500641_0031597 3300053096 Bacteria 2089
225 Ga0500562_001202 3300053108 Bacteria 6371
226 Ga0500595_008701 3300053119 Bacteria 4133
227 Ga0500595_122973 3300053119 Bacteria 733
228 Ga0500603_310731 3300053150 Bacteria 511
229 Ga0500638_018696 3300053162 Bacteria 3237
230 Ga0500637_0009893 3300053178 Bacteria 4877
231 Ga0500601_003452 3300053737 Bacteria 1714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_1116693 Ga0496112_1116693_298_696 124
2 3300005331 Ga0070670_100004147 Ga0070670_10000414712 125
3 3300005335 Ga0070666_10025975 Ga0070666_100259754 125
4 3300005347 Ga0070668_100000274 Ga0070668_10000027423 125
5 3300005367 Ga0070667_100000152 Ga0070667_10000015235 125
6 3300005548 Ga0070665_100009253 Ga0070665_1000092539 125
7 3300005617 Ga0068859_100288489 Ga0068859_1002884892 125
8 3300005618 Ga0068864_100001298 Ga0068864_10000129816 125
9 3300005841 Ga0068863_100013949 Ga0068863_1000139496 125
10 3300005842 Ga0068858_100005511 Ga0068858_10000551110 125
11 3300005843 Ga0068860_100004797 Ga0068860_1000047978 125
12 3300005844 Ga0068862_100000638 Ga0068862_10000063829 125
13 3300006931 Ga0097620_100288485 Ga0097620_1002884853 125
14 3300009177 Ga0105248_10216161 Ga0105248_102161613 125
15 3300009553 Ga0105249_10005492 Ga0105249_100054926 125
16 3300013306 Ga0163162_10403232 Ga0163162_104032322 125
17 3300014325 Ga0163163_10131926 Ga0163163_101319264 125
18 3300014968 Ga0157379_10014140 Ga0157379_100141408 125
19 3300025903 Ga0207680_10002875 Ga0207680_100028756 125
20 3300025925 Ga0207650_10000235 Ga0207650_1000023521 125
21 3300025941 Ga0207711_10037007 Ga0207711_100370074 125
22 3300025961 Ga0207712_10000675 Ga0207712_100006756 125
23 3300025972 Ga0207668_10000441 Ga0207668_100004419 125
24 3300025986 Ga0207658_10000189 Ga0207658_1000018927 125
25 3300026035 Ga0207703_10010109 Ga0207703_100101096 125
26 3300026088 Ga0207641_10003947 Ga0207641_100039479 125
27 3300026095 Ga0207676_10000472 Ga0207676_1000047216 125
28 3300028379 Ga0268266_10006677 Ga0268266_1000667711 125
29 3300028380 Ga0268265_10005746 Ga0268265_100057469 125
30 3300028381 Ga0268264_10000118 Ga0268264_10000118209 125
31 3300028381 Ga0268264_10000378 Ga0268264_1000037848 125
32 3300048905 Ga0496102_0061354 Ga0496102_0061354_1149_1544 125
33 3300048906 Ga0496103_0398442 Ga0496103_0398442_437_832 125
34 3300026041 Ga0207639_10038066 Ga0207639_100380666 126
35 3300005327 Ga0070658_10051531 Ga0070658_100515312 128
36 3300005614 Ga0068856_100088910 Ga0068856_1000889103 128
37 3300013104 Ga0157370_11123326 Ga0157370_111233261 128
38 3300048904 Ga0496101_0926486 Ga0496101_0926486_15_464 128
39 3300048904 Ga0496101_1577804 Ga0496101_1577804_40_435 130
40 3300039450 Ga0436363_0037111 Ga0436363_0037111_85_528 137
41 3300053080 Ga0500635_0169653 Ga0500635_0169653_386_811 137
42 3300053091 Ga0500647_0071450 Ga0500647_0071450_629_1063 137
43 3300053150 Ga0500603_310731 Ga0500603_310731_49_483 137
44 3300053162 Ga0500638_018696 Ga0500638_018696_2163_2597 137
45 3300053178 Ga0500637_0009893 Ga0500637_0009893_1542_1976 137
46 3300053737 Ga0500601_003452 Ga0500601_003452_84_518 137
47 3300028556 Ga0265337_1104605 Ga0265337_11046052 139
48 3300005564 Ga0070664_100536530 Ga0070664_1005365302 141
49 3300049571 Ga0501034_0260758 Ga0501034_0260758_1010_1468 142
50 3300005327 Ga0070658_10088652 Ga0070658_100886523 143
51 3300005336 Ga0070680_101093210 Ga0070680_1010932102 143
52 3300005366 Ga0070659_100336484 Ga0070659_1003364843 143
53 3300005435 Ga0070714_101071312 Ga0070714_1010713121 143
54 3300005530 Ga0070679_100987218 Ga0070679_1009872182 143
55 3300009093 Ga0105240_10331959 Ga0105240_103319593 143
56 3300025272 Ga0209455_1017662 Ga0209455_10176621 143
57 3300025909 Ga0207705_10608713 Ga0207705_106087131 143
58 3300025917 Ga0207660_10357617 Ga0207660_103576171 143
59 3300025921 Ga0207652_10587327 Ga0207652_105873271 143
60 3300025921 Ga0207652_10663326 Ga0207652_106633262 143
61 3300025932 Ga0207690_10374357 Ga0207690_103743572 143
62 3300037312 Ga0395899_0046843 Ga0395899_0046843_2406_2870 143
63 3300037466 Ga0395898_1045014 Ga0395898_1045014_149_613 143
64 3300038443 Ga0395901_0163336 Ga0395901_0163336_419_883 143
65 3300042876 Ga0451577_0408273 Ga0451577_0408273_193_654 143
66 3300046660 Ga0495625_0294600 Ga0495625_0294600_52_507 143
67 3300046674 Ga0495588_0405289 Ga0495588_0405289_82_537 143
68 3300046684 Ga0495669_0000097 Ga0495669_0000097_6763_7218 143
69 3300047445 Ga0495677_0028265 Ga0495677_0028265_961_1416 143
70 3300049570 Ga0501033_0016709 Ga0501033_0016709_278_730 143
71 3300049573 Ga0501037_0046334 Ga0501037_0046334_121_573 143
72 3300049579 Ga0501043_0480966 Ga0501043_0480966_235_687 143
73 3300049581 Ga0501047_0429306 Ga0501047_0429306_120_572 143
74 3300049822 Ga0501035_0057364 Ga0501035_0057364_2370_2822 143
75 3300049823 Ga0501044_0002124 Ga0501044_0002124_11506_11958 143
76 3300005331 Ga0070670_101171488 Ga0070670_1011714882 144
77 3300005335 Ga0070666_10102146 Ga0070666_101021462 144
78 3300005335 Ga0070666_10204616 Ga0070666_102046162 144
79 3300005347 Ga0070668_100002570 Ga0070668_1000025707 144
80 3300005367 Ga0070667_100037013 Ga0070667_1000370135 144
81 3300005548 Ga0070665_100003248 Ga0070665_10000324814 144
82 3300005617 Ga0068859_101171121 Ga0068859_1011711211 144
83 3300005618 Ga0068864_100000948 Ga0068864_10000094810 144
84 3300005618 Ga0068864_100404661 Ga0068864_1004046612 144
85 3300005841 Ga0068863_100000331 Ga0068863_10000033120 144
86 3300005842 Ga0068858_100000378 Ga0068858_10000037819 144
87 3300005842 Ga0068858_100141455 Ga0068858_1001414553 144
88 3300005844 Ga0068862_100037374 Ga0068862_1000373743 144
89 3300006042 Ga0075368_10001625 Ga0075368_100016257 144
90 3300006051 Ga0075364_10048056 Ga0075364_100480564 144
91 3300006178 Ga0075367_10000197 Ga0075367_1000019718 144
92 3300006195 Ga0075366_10023463 Ga0075366_100234633 144
93 3300006931 Ga0097620_101171552 Ga0097620_1011715522 144
94 3300009174 Ga0105241_10843215 Ga0105241_108432152 144
95 3300009176 Ga0105242_10917882 Ga0105242_109178822 144
96 3300009177 Ga0105248_10120894 Ga0105248_101208943 144
97 3300009177 Ga0105248_10139978 Ga0105248_101399784 144
98 3300009177 Ga0105248_10917123 Ga0105248_109171232 144
99 3300009545 Ga0105237_12232283 Ga0105237_122322831 144
100 3300010375 Ga0105239_10366164 Ga0105239_103661643 144
101 3300010375 Ga0105239_11304959 Ga0105239_113049592 144
102 3300013308 Ga0157375_12326365 Ga0157375_123263652 144
103 3300014325 Ga0163163_10142761 Ga0163163_101427613 144
104 3300021384 Ga0213876_10035205 Ga0213876_100352054 144
105 3300025903 Ga0207680_10027900 Ga0207680_100279003 144
106 3300025914 Ga0207671_11327989 Ga0207671_113279891 144
107 3300025931 Ga0207644_10029931 Ga0207644_100299312 144
108 3300025941 Ga0207711_10013342 Ga0207711_100133428 144
109 3300025972 Ga0207668_10000016 Ga0207668_1000001664 144
110 3300025986 Ga0207658_10065941 Ga0207658_100659413 144
111 3300026035 Ga0207703_10000399 Ga0207703_1000039919 144
112 3300026035 Ga0207703_10267152 Ga0207703_102671522 144
113 3300026088 Ga0207641_10000070 Ga0207641_1000007083 144
114 3300026095 Ga0207676_10000602 Ga0207676_100006029 144
115 3300027866 Ga0209813_10017943 Ga0209813_100179433 144
116 3300028379 Ga0268266_10001029 Ga0268266_100010299 144
117 3300031456 Ga0307513_10008748 Ga0307513_1000874812 144
118 3300031727 Ga0316576_10207738 Ga0316576_102077382 144
119 3300039437 Ga0436365_0045162 Ga0436365_0045162_1663_2142 144
120 3300044842 Ga0466957_0433151 Ga0466957_0433151_314_778 144
121 3300046506 Ga0495583_0036128 Ga0495583_0036128_705_1190 144
122 3300046507 Ga0495606_0354388 Ga0495606_0354388_51_536 144
123 3300046648 Ga0495611_0071582 Ga0495611_0071582_455_937 144
124 3300046660 Ga0495625_0045630 Ga0495625_0045630_2371_2856 144
125 3300046684 Ga0495669_0093036 Ga0495669_0093036_173_658 144
126 3300048912 Ga0496109_0911458 Ga0496109_0911458_144_590 144
127 3300049581 Ga0501047_0652414 Ga0501047_0652414_331_810 144
128 3300049581 Ga0501047_1088990 Ga0501047_1088990_109_579 144
129 3300049589 Ga0501073_0890457 Ga0501073_0890457_108_584 144
130 3300050491 nmdc:mga00v17_5085_c1 nmdc:mga00v17_5085_c1_2004_2477 144
131 3300050495 nmdc:mga04h51_21297_c1 nmdc:mga04h51_21297_c1_1401_1874 144
132 3300050496 nmdc:mga07m45_673605_c1 nmdc:mga07m45_673605_c1_96_569 144
133 3300050496 nmdc:mga07m45_72105_c1 nmdc:mga07m45_72105_c1_1398_1871 144
134 3300053087 Ga0500643_021288 Ga0500643_021288_470_946 144
135 3300053096 Ga0500641_0031597 Ga0500641_0031597_1285_1761 144
136 3300053108 Ga0500562_001202 Ga0500562_001202_1560_2030 144
137 3300053119 Ga0500595_122973 Ga0500595_122973_80_553 144
138 3300031456 Ga0307513_10000506 Ga0307513_1000050632 145
139 3300005327 Ga0070658_10078835 Ga0070658_100788354 146
140 3300005339 Ga0070660_100101727 Ga0070660_1001017274 146
141 3300005366 Ga0070659_100015044 Ga0070659_1000150444 146
142 3300005458 Ga0070681_10071480 Ga0070681_100714802 146
143 3300005530 Ga0070679_100007466 Ga0070679_1000074668 146
144 3300005539 Ga0068853_100004541 Ga0068853_1000045414 146
145 3300005937 Ga0081455_10251986 Ga0081455_102519862 146
146 3300025909 Ga0207705_10001540 Ga0207705_100015409 146
147 3300025917 Ga0207660_10000779 Ga0207660_1000077914 146
148 3300025919 Ga0207657_10012168 Ga0207657_100121687 146
149 3300025949 Ga0207667_10051432 Ga0207667_100514324 146
150 3300026041 Ga0207639_10063878 Ga0207639_100638781 146
151 3300026142 Ga0207698_10395334 Ga0207698_103953342 146
152 3300003911 JGI25405J52794_10012667 JGI25405J52794_100126673 147
153 3300005344 Ga0070661_100818851 Ga0070661_1008188512 147
154 3300005539 Ga0068853_100556524 Ga0068853_1005565241 147
155 3300005937 Ga0081455_10000142 Ga0081455_100001425 147
156 3300005327 Ga0070658_10113000 Ga0070658_101130003 148
157 3300005335 Ga0070666_10253711 Ga0070666_102537112 148
158 3300005336 Ga0070680_100030959 Ga0070680_1000309596 148
159 3300005336 Ga0070680_100161716 Ga0070680_1001617163 148
160 3300005339 Ga0070660_100015050 Ga0070660_1000150504 148
161 3300005339 Ga0070660_100072874 Ga0070660_1000728743 148
162 3300005339 Ga0070660_100395847 Ga0070660_1003958472 148
163 3300005341 Ga0070691_10151676 Ga0070691_101516762 148
164 3300005344 Ga0070661_100037908 Ga0070661_1000379083 148
165 3300005366 Ga0070659_100006376 Ga0070659_1000063767 148
166 3300005458 Ga0070681_10014224 Ga0070681_100142244 148
167 3300005458 Ga0070681_10067878 Ga0070681_100678784 148
168 3300005530 Ga0070679_100016803 Ga0070679_10001680312 148
169 3300005548 Ga0070665_100000015 Ga0070665_10000001568 148
170 3300005563 Ga0068855_100047223 Ga0068855_1000472235 148
171 3300005563 Ga0068855_100248545 Ga0068855_1002485453 148
172 3300005578 Ga0068854_100143578 Ga0068854_1001435784 148
173 3300005578 Ga0068854_100507058 Ga0068854_1005070582 148
174 3300005614 Ga0068856_100248716 Ga0068856_1002487162 148
175 3300005614 Ga0068856_100708164 Ga0068856_1007081642 148
176 3300005616 Ga0068852_100018348 Ga0068852_1000183484 148
177 3300009093 Ga0105240_10000671 Ga0105240_100006713 148
178 3300009093 Ga0105240_10023503 Ga0105240_100235036 148
179 3300009093 Ga0105240_10143210 Ga0105240_101432105 148
180 3300009551 Ga0105238_10007222 Ga0105238_1000722215 148
181 3300009551 Ga0105238_10013308 Ga0105238_100133084 148
182 3300010375 Ga0105239_10571681 Ga0105239_105716811 148
183 3300013104 Ga0157370_10098256 Ga0157370_100982563 148
184 3300013104 Ga0157370_11121638 Ga0157370_111216381 148
185 3300013105 Ga0157369_10038364 Ga0157369_100383648 148
186 3300013307 Ga0157372_10039714 Ga0157372_100397142 148
187 3300014325 Ga0163163_10009873 Ga0163163_100098734 148
188 3300025903 Ga0207680_10270818 Ga0207680_102708182 148
189 3300025912 Ga0207707_10007495 Ga0207707_1000749510 148
190 3300025912 Ga0207707_10021581 Ga0207707_100215812 148
191 3300025913 Ga0207695_10002188 Ga0207695_100021888 148
192 3300025913 Ga0207695_10002749 Ga0207695_1000274928 148
193 3300025913 Ga0207695_10053311 Ga0207695_100533113 148
194 3300025913 Ga0207695_10099579 Ga0207695_100995794 148
195 3300025913 Ga0207695_10550032 Ga0207695_105500322 148
196 3300025917 Ga0207660_10075395 Ga0207660_100753954 148
197 3300025917 Ga0207660_10126885 Ga0207660_101268853 148
198 3300025919 Ga0207657_10040011 Ga0207657_100400113 148
199 3300025919 Ga0207657_10053048 Ga0207657_100530483 148
200 3300025921 Ga0207652_10024314 Ga0207652_100243144 148
201 3300025924 Ga0207694_10069016 Ga0207694_100690163 148
202 3300025924 Ga0207694_10144047 Ga0207694_101440473 148
203 3300025932 Ga0207690_10000111 Ga0207690_1000011168 148
204 3300025949 Ga0207667_10024419 Ga0207667_100244193 148
205 3300025949 Ga0207667_10059910 Ga0207667_100599104 148
206 3300026078 Ga0207702_10188255 Ga0207702_101882553 148
207 3300028379 Ga0268266_10000005 Ga0268266_100000051048 148
208 3300048918 Ga0496115_0002754 Ga0496115_0002754_152_676 148
209 3300048918 Ga0496115_0008854 Ga0496115_0008854_5220_5744 148
210 iso_pu_bacteria 2849573788 2849576965 148
211 iso_pu_bacteria 2851153111 2851156071 148
212 3300021377 Ga0213874_10004601 Ga0213874_100046014 149
213 3300021384 Ga0213876_10000116 Ga0213876_1000011653 149
214 3300037853 Ga0436364_1149017 Ga0436364_1149017_1315_1764 149
215 3300028800 Ga0265338_10327502 Ga0265338_103275021 150
216 3300031251 Ga0265327_10000290 Ga0265327_1000029091 150
217 3300039437 Ga0436365_0947453 Ga0436365_0947453_8781_9245 150
218 3300039450 Ga0436363_0224534 Ga0436363_0224534_1550_2014 150
219 3300046684 Ga0495669_0000042 Ga0495669_0000042_79585_80103 150
220 3300047445 Ga0495677_0020211 Ga0495677_0020211_1196_1714 150
221 3300048929 Ga0496126_0567060 Ga0496126_0567060_272_724 150
222 3300053119 Ga0500595_008701 Ga0500595_008701_622_1077 150
223 3300005335 Ga0070666_10141913 Ga0070666_101419132 151
224 3300005563 Ga0068855_100665445 Ga0068855_1006654452 151
225 3300005842 Ga0068858_100469434 Ga0068858_1004694341 151
226 3300009093 Ga0105240_10001932 Ga0105240_100019328 151
227 3300009177 Ga0105248_10661593 Ga0105248_106615932 151
228 3300025903 Ga0207680_10113202 Ga0207680_101132023 151
229 3300025913 Ga0207695_10003212 Ga0207695_1000321213 151
230 3300025932 Ga0207690_10013522 Ga0207690_100135223 151
231 3300025941 Ga0207711_11497273 Ga0207711_114972732 151
232 3300026035 Ga0207703_10204964 Ga0207703_102049641 151
233 3300003775 Ga0055524_1037380 Ga0055524_10373802 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

14

158

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.8839 4 143
1jl3-assembly4.cif.gz_D crystal structure of b. subtilis arsc 0.8827 7 144
1ljl-assembly1.cif.gz_A wild type pi258 s. aureus arsenate reductase 0.8819 6 143
1jl3-assembly1.cif.gz_A crystal structure of b. subtilis arsc 0.8759 6 144
2fxi-assembly1.cif.gz_A arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site 0.8758 4 144
ID Description Score Start End Superfamily
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8785 7 144 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8644 7 144 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8447 6 144 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8406 6 144 3.40.50.2300
3rh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8249 6 144 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A257HMA7-F1-model_v4 Low molecular weight phosphatase family protein 0.9866 5 144 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A2K9N961-F1-model_v4 Low molecular weight phosphatase family protein 0.9818 5 146 GO:0004726
GO:0030946
GO:0140793
AF-A0A2A5G7C6-F1-model_v4 Protein-tyrosine-phosphatase 0.9798 5 144 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A3D9HRN9-F1-model_v4 Protein-tyrosine phosphatase 0.978 3 144 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A2S5LF52-F1-model_v4 Low molecular weight phosphatase family protein 0.9767 5 140 GO:0004726
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
86.84 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map