F345657

General Info

Members Datasets Scaffolds Average Seq Length
232 192 172 305

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8054160619|8054161920
Length 348
Sequence AAGPHRPGPAASPAPPRRIGICHFGEIHTSRNLPPPSRVVTVMKAITTNSYGGPEVLTYTEQPDPKIGPDSVLIRVKAAGVNPVDWKIVAGYLDSIMHVHFPLIPGWDVAGVVEAVGADATEYAIGDHVIGYVRKDEVQHGTYAELVAAPVRTLARKPESLSWQQAAGLPLAGLTAYQSLKRVGVKAGDLVLVHAAAGGVGSLAVQIAVAEGARVIGTASERNHDFLRSLGAEPVTYGDGLADRVRALAPDGVEAALDFVGGGAVDLSQEVLKDRGRVVSIADGEVGAKGGHMVWVRPDSADLTALAILADAGKLTVPVETVLPLSEAAEAFRISQAGRTRGKIILEV

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
3 2643221548 Streptomyces sp. Root55 Isolate Unclassified
4 2643221578 Streptomyces sp. Root63 Isolate Unclassified
5 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
6 2643221613 Oerskovia sp. Root22 Isolate Unclassified
7 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
8 2643221670 Streptomyces sp. Root431 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
11 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
12 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
13 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
14 2643221714 Streptomyces sp. Root264 Isolate Unclassified
15 2643221721 Oerskovia sp. Root918 Isolate Unclassified
16 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
17 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
21 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
22 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
23 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
24 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
25 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
26 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
27 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
28 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
29 2862574272 Streptomyces sp. AcE210 Isolate Nodule
30 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
31 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
32 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
33 2867369537 Streptomyces sp. Z26 Isolate Unclassified
34 2867475112 Streptomyces sp. TM32 Isolate Unclassified
35 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
36 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
37 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
38 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
39 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
40 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
41 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
42 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
43 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
44 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
45 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
46 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
47 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
48 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
49 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
50 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
51 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
52 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
53 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
54 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
57 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
81 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
116 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
180 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
181 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
182 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
183 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
184 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
185 8002784119 Frankia sp. AgB1.9 Isolate Nodule
186 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
187 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
188 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
189 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
190 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
191 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
192 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.28
Metatranscriptomes 0.86
Isolates 25.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.21
Nodule 0.86
Rhizoplane 5.6
Rhizosphere 59.05
Stem 0
Stem Tuber 0
Unclassified 23.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007423J48922_100235 3300003285 Bacteria 2083
2 rootH1_10027633 3300003316 Bacteria 7980
3 rootH2_10020050 3300003320 Bacteria 7258
4 rootH1_10034134 3300003323 Bacteria 5608
5 JGI25160J50197_1006231 3300003354 Bacteria 4852
6 JGI25160J50197_1017766 3300003354 Bacteria 2240
7 Ga0006562J51391_1089877 3300003578 Bacteria 3832
8 Ga0055526_1000021 3300003771 Bacteria 180007
9 Ga0055537_1000453 3300003773 Bacteria 25925
10 Ga0055524_1000128 3300003775 Bacteria 88986
11 Ga0055534_1000054 3300003784 Bacteria 88986
12 Ga0055528_1000009 3300003790 Bacteria 224150
13 Ga0070683_100076035 3300005329 Bacteria 3138
14 Ga0068868_100231990 3300005338 Bacteria 1548
15 Ga0070705_100026830 3300005440 Bacteria 3138
16 Ga0070663_100071395 3300005455 Bacteria 2526
17 Ga0070684_100215705 3300005535 Bacteria 1750
18 Ga0070684_100224090 3300005535 Bacteria 1716
19 Ga0068853_100024013 3300005539 Bacteria 5110
20 Ga0068853_100030596 3300005539 Bacteria 4549
21 Ga0070664_100161169 3300005564 Bacteria 1984
22 Ga0068856_100162831 3300005614 Bacteria 2242
23 Ga0068856_100323107 3300005614 Bacteria 1560
24 Ga0081455_10012624 3300005937 Bacteria 8412
25 Ga0081539_10035392 3300005985 Bacteria 3003
26 Ga0075428_100595894 3300006844 Bacteria 1180
27 Ga0075430_100155350 3300006846 Bacteria 1905
28 Ga0075431_100004802 3300006847 Bacteria 13302
29 Ga0075431_100344352 3300006847 Bacteria 1499
30 Ga0111539_10031560 3300009094 Bacteria 6435
31 Ga0114129_10316023 3300009147 Bacteria 2077
32 Ga0157375_10129230 3300013308 Bacteria 2644
33 Ga0157380_10014112 3300014326 Bacteria 5840
34 Ga0183367_1010 3300015688 Bacteria 416164
35 Ga0183360_10001 3300015689 Bacteria 3943671
36 Ga0209565_1000048 3300025263 Bacteria 224961
37 Ga0209565_1013491 3300025263 Bacteria 1911
38 Ga0209673_1000001 3300025273 Bacteria 3176258
39 Ga0209675_1000045 3300025291 Bacteria 225750
40 Ga0209564_1000001 3300025295 Bacteria 3176258
41 Ga0209256_1000002 3300025299 Bacteria 1906740
42 Ga0207426_1000871 3300025302 Bacteria 31475
43 Ga0207426_1005472 3300025302 Bacteria 5784
44 Ga0207426_1007344 3300025302 Bacteria 4626
45 Ga0207426_1010214 3300025302 Bacteria 3657
46 Ga0207643_10147579 3300025908 Bacteria 1408
47 Ga0207657_10198386 3300025919 Bacteria 1616
48 Ga0207652_10114598 3300025921 Bacteria 2394
49 Ga0207691_10108273 3300025940 Bacteria 2473
50 Ga0207661_10036228 3300025944 Bacteria 3850
51 Ga0207677_10172902 3300026023 Bacteria 1691
52 Ga0207639_10153257 3300026041 Bacteria 1933
53 Ga0207678_10117586 3300026067 Bacteria 2268
54 Ga0207702_10174137 3300026078 Bacteria 1976
55 Ga0207702_10438081 3300026078 Bacteria 1266
56 Ga0207683_10037934 3300026121 Bacteria 4197
57 Ga0207428_10117973 3300027907 Bacteria 2037
58 Ga0307517_10003033 3300028786 Bacteria 26536
59 Ga0307517_10025291 3300028786 Bacteria 7269
60 Ga0307515_10041626 3300028794 Bacteria 7214
61 Ga0307515_10150672 3300028794 Bacteria 2433
62 Ga0307513_10019439 3300031456 Bacteria 8087
63 Ga0307513_10161989 3300031456 Bacteria 2128
64 Ga0307509_10027298 3300031507 Bacteria 6352
65 Ga0307408_100168089 3300031548 Bacteria 1749
66 Ga0307508_10003328 3300031616 Bacteria 16327
67 Ga0307508_10013515 3300031616 Bacteria 7463
68 Ga0307508_10166576 3300031616 Bacteria 1807
69 Ga0307516_10058655 3300031730 Bacteria 3746
70 Ga0307516_10215264 3300031730 Bacteria 1633
71 Ga0307518_10109986 3300031838 Bacteria 1963
72 Ga0307410_10052221 3300031852 Bacteria 2760
73 Ga0307415_100466391 3300032126 Bacteria 1096
74 Ga0307507_10018918 3300033179 Bacteria 7798
75 Ga0373951_0001253 3300035091 Bacteria 6718
76 Ga0373925_0001121 3300037068 Bacteria 23779
77 Ga0395898_0000388 3300037466 Bacteria 96035
78 Ga0395901_0663024 3300038443 Bacteria 1045
79 Ga0436362_1108482 3300039453 Bacteria 6205
80 Ga0439433_0016005 3300041999 Bacteria 1659
81 Ga0439442_028748 3300042002 Bacteria 1159
82 Ga0439449_0017425 3300042007 Bacteria 2697
83 Ga0439457_010976 3300042014 Bacteria 2069
84 Ga0439462_0002583 3300042015 Bacteria 4228
85 Ga0466972_0011549 3300044658 Bacteria 4433
86 Ga0466965_0063370 3300044683 Bacteria 1850
87 Ga0466965_0180968 3300044683 Bacteria 1112
88 Ga0466966_0003625 3300044684 Bacteria 10189
89 Ga0466966_0132295 3300044684 Bacteria 1527
90 Ga0466961_0010603 3300044693 Bacteria 5880
91 Ga0466961_0108501 3300044693 Bacteria 1747
92 Ga0466961_0173679 3300044693 Bacteria 1340
93 Ga0466970_0001013 3300044765 Bacteria 13546
94 Ga0466970_0004388 3300044765 Bacteria 6950
95 Ga0466960_0016718 3300044901 Bacteria 3187
96 Ga0466967_0022923 3300045976 Bacteria 5105
97 Ga0466967_0155550 3300045976 Bacteria 2141
98 Ga0495603_0045987 3300046455 Bacteria 2601
99 Ga0495603_0140546 3300046455 Bacteria 1404
100 Ga0495629_0001920 3300046459 Bacteria 16203
101 Ga0495629_0005483 3300046459 Bacteria 9472
102 Ga0495651_0015735 3300046462 Bacteria 5857
103 Ga0495605_0072557 3300046474 Bacteria 1623
104 Ga0495594_0001105 3300046499 Bacteria 14070
105 Ga0495594_0046162 3300046499 Bacteria 2392
106 Ga0495643_0006777 3300046522 Bacteria 7488
107 Ga0495648_0085005 3300046524 Bacteria 1789
108 Ga0495652_0003361 3300046529 Bacteria 15821
109 Ga0495652_0156843 3300046529 Bacteria 1772
110 Ga0495611_0007874 3300046648 Bacteria 4524
111 Ga0495625_0025250 3300046660 Bacteria 4508
112 Ga0495588_0013510 3300046674 Bacteria 3893
113 Ga0495588_0161289 3300046674 Bacteria 1186
114 Ga0495670_0007491 3300046691 Bacteria 5363
115 Ga0495671_0044892 3300046692 Bacteria 2214
116 Ga0495589_0006425 3300046794 Bacteria 6202
117 Ga0495589_0006476 3300046794 Bacteria 6173
118 Ga0495604_0094512 3300047317 Bacteria 2210
119 Ga0495676_0011777 3300047321 Bacteria 7887
120 Ga0495676_0012678 3300047321 Bacteria 7581
121 Ga0495676_0075369 3300047321 Bacteria 2580
122 Ga0495687_007494 3300047443 Bacteria 6418
123 Ga0495675_0063873 3300047444 Bacteria 2329
124 Ga0495685_001960 3300047447 Bacteria 6385
125 Ga0495685_006475 3300047447 Bacteria 3834
126 Ga0495681_0036848 3300047470 Bacteria 2415
127 Ga0495681_0088852 3300047470 Bacteria 1367
128 Ga0496100_0110853 3300048903 Bacteria 1906
129 Ga0496104_0005111 3300048907 Bacteria 11451
130 Ga0496105_0015968 3300048908 Bacteria 5988
131 Ga0496106_0033205 3300048909 Bacteria 3850
132 Ga0496106_0110053 3300048909 Bacteria 2144
133 Ga0496108_0004307 3300048911 Bacteria 11445
134 Ga0496109_0001418 3300048912 Bacteria 19886
135 Ga0496109_0084932 3300048912 Bacteria 2921
136 Ga0496109_0311219 3300048912 Bacteria 1486
137 Ga0496110_0000968 3300048913 Bacteria 20114
138 Ga0496113_0003283 3300048916 Bacteria 9659
139 Ga0496114_0309500 3300048917 Bacteria 1395
140 Ga0496117_0051558 3300048920 Bacteria 2907
141 Ga0496118_0173123 3300048921 Bacteria 1315
142 Ga0496119_0037603 3300048922 Bacteria 3142
143 Ga0496121_0049127 3300048924 Bacteria 3581
144 Ga0496122_0000851 3300048925 Bacteria 57425
145 Ga0496125_0000047 3300048928 Bacteria 294084
146 Ga0496126_0039926 3300048929 Bacteria 4352
147 Ga0501031_0033800 3300049568 Bacteria 3338
148 Ga0501032_0013345 3300049569 Bacteria 5848
149 Ga0501032_0058206 3300049569 Bacteria 2595
150 Ga0501033_0356395 3300049570 Bacteria 1024
151 Ga0501034_0044736 3300049571 Bacteria 4476
152 Ga0501038_0003499 3300049574 Bacteria 14625
153 Ga0501043_0115244 3300049579 Bacteria 2109
154 Ga0501047_0042097 3300049581 Bacteria 4414
155 Ga0501047_0092642 3300049581 Bacteria 2900
156 Ga0501035_0067292 3300049822 Bacteria 3179
157 Ga0501035_0072005 3300049822 Bacteria 3059
158 Ga0501035_0175546 3300049822 Bacteria 1848
159 nmdc:mga06z11_100405_c1 3300050494 Bacteria 1587
160 nmdc:mga0qj67_67625_c1 3300050509 Bacteria 2846
161 nmdc:mga06r32_322065_c1 3300050510 Bacteria 1531
162 nmdc:mga08y16_116285_c1 3300050511 Bacteria 2784
163 Ga0495601_0094576 3300053077 Bacteria 1926
164 Ga0495612_0018868 3300053078 Bacteria 2761
165 Ga0500578_0182984 3300053086 Bacteria 1290
166 Ga0500566_0153933 3300053094 Bacteria 1206
167 Ga0500553_058011 3300053101 Bacteria 1829
168 Ga0500569_001314 3300053109 Bacteria 4649
169 Ga0500614_002850 3300053123 Bacteria 3798
170 Ga0500561_0001318 3300053137 Bacteria 4034
171 Ga0500600_0021612 3300053149 Bacteria 3855
172 Ga0500587_003369 3300053739 Bacteria 2239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10037934 Ga0207683_100379344 246
2 3300048917 Ga0496114_0309500 Ga0496114_0309500_134_1060 259
3 3300025919 Ga0207657_10198386 Ga0207657_101983862 260
4 3300013308 Ga0157375_10129230 Ga0157375_101292301 267
5 3300014326 Ga0157380_10014112 Ga0157380_100141125 267
6 3300037068 Ga0373925_0001121 Ga0373925_0001121_20452_21375 267
7 3300041999 Ga0439433_0016005 Ga0439433_0016005_417_1367 269
8 3300042002 Ga0439442_028748 Ga0439442_028748_15_965 269
9 3300042014 Ga0439457_010976 Ga0439457_010976_192_1142 269
10 3300042015 Ga0439462_0002583 Ga0439462_0002583_2023_2973 269
11 3300025940 Ga0207691_10108273 Ga0207691_101082732 272
12 3300035091 Ga0373951_0001253 Ga0373951_0001253_3333_4286 272
13 3300046474 Ga0495605_0072557 Ga0495605_0072557_308_1243 274
14 3300046794 Ga0495589_0006425 Ga0495589_0006425_2292_3227 274
15 3300047447 Ga0495685_006475 Ga0495685_006475_1752_2687 275
16 iso_pu_bacteria 2862178590 2862185971 275
17 3300046455 Ga0495603_0140546 Ga0495603_0140546_203_1135 276
18 3300046794 Ga0495589_0006476 Ga0495589_0006476_3646_4581 276
19 3300047321 Ga0495676_0012678 Ga0495676_0012678_5896_6831 276
20 3300047321 Ga0495676_0075369 Ga0495676_0075369_1415_2350 276
21 3300006847 Ga0075431_100004802 Ga0075431_10000480212 278
22 3300028794 Ga0307515_10150672 Ga0307515_101506724 278
23 3300048912 Ga0496109_0084932 Ga0496109_0084932_748_1674 278
24 3300050509 nmdc:mga0qj67_67625_c1 nmdc:mga0qj67_67625_c1_1003_1842 278
25 3300044683 Ga0466965_0180968 Ga0466965_0180968_72_971 280
26 3300048903 Ga0496100_0110853 Ga0496100_0110853_816_1724 281
27 3300031456 Ga0307513_10161989 Ga0307513_101619892 285
28 3300031730 Ga0307516_10215264 Ga0307516_102152642 285
29 iso_pu_bacteria 2917736166 2917744899 286
30 3300006844 Ga0075428_100595894 Ga0075428_1005958941 288
31 3300006847 Ga0075431_100344352 Ga0075431_1003443522 288
32 3300009094 Ga0111539_10031560 Ga0111539_100315606 288
33 3300009147 Ga0114129_10316023 Ga0114129_103160231 288
34 3300027907 Ga0207428_10117973 Ga0207428_101179732 288
35 3300037466 Ga0395898_0000388 Ga0395898_0000388_32533_33432 288
36 3300050510 nmdc:mga06r32_322065_c1 nmdc:mga06r32_322065_c1_24_932 288
37 3300050511 nmdc:mga08y16_116285_c1 nmdc:mga08y16_116285_c1_512_1420 288
38 3300044684 Ga0466966_0003625 Ga0466966_0003625_4951_5874 289
39 3300044693 Ga0466961_0010603 Ga0466961_0010603_4682_5605 289
40 3300005338 Ga0068868_100231990 Ga0068868_1002319902 290
41 3300005614 Ga0068856_100162831 Ga0068856_1001628313 290
42 3300026023 Ga0207677_10172902 Ga0207677_101729022 290
43 3300026078 Ga0207702_10174137 Ga0207702_101741373 290
44 3300048912 Ga0496109_0311219 Ga0496109_0311219_140_1051 290
45 3300005539 Ga0068853_100030596 Ga0068853_1000305961 292
46 3300026041 Ga0207639_10153257 Ga0207639_101532572 292
47 3300026067 Ga0207678_10117586 Ga0207678_101175861 292
48 3300003771 Ga0055526_1000021 Ga0055526_10000215 293
49 3300003773 Ga0055537_1000453 Ga0055537_100045318 293
50 3300003775 Ga0055524_1000128 Ga0055524_100012873 293
51 3300003784 Ga0055534_1000054 Ga0055534_100005473 293
52 3300003790 Ga0055528_1000009 Ga0055528_10000095 293
53 3300015689 Ga0183360_10001 Ga0183360_100011117 293
54 3300025263 Ga0209565_1000048 Ga0209565_10000486 293
55 3300025263 Ga0209565_1013491 Ga0209565_10134912 293
56 3300025273 Ga0209673_1000001 Ga0209673_10000012688 293
57 3300025291 Ga0209675_1000045 Ga0209675_1000045160 293
58 3300025295 Ga0209564_1000001 Ga0209564_10000016 293
59 3300025299 Ga0209256_1000002 Ga0209256_10000021546 293
60 3300048924 Ga0496121_0049127 Ga0496121_0049127_791_1819 293
61 iso_pu_bacteria 2941489479 2941492839 293
62 iso_pu_bacteria 2995948881 2995952136 293
63 3300031548 Ga0307408_100168089 Ga0307408_1001680891 294
64 3300032126 Ga0307415_100466391 Ga0307415_1004663911 294
65 3300005329 Ga0070683_100076035 Ga0070683_1000760354 295
66 3300005535 Ga0070684_100224090 Ga0070684_1002240902 295
67 3300005564 Ga0070664_100161169 Ga0070664_1001611692 295
68 3300005614 Ga0068856_100323107 Ga0068856_1003231072 295
69 3300025921 Ga0207652_10114598 Ga0207652_101145983 295
70 3300025944 Ga0207661_10036228 Ga0207661_100362283 295
71 3300026078 Ga0207702_10438081 Ga0207702_104380812 295
72 3300046499 Ga0495594_0046162 Ga0495594_0046162_507_1418 295
73 3300005535 Ga0070684_100215705 Ga0070684_1002157052 296
74 3300046674 Ga0495588_0161289 Ga0495588_0161289_150_1076 296
75 3300048907 Ga0496104_0005111 Ga0496104_0005111_8956_9864 296
76 3300048908 Ga0496105_0015968 Ga0496105_0015968_2839_3747 296
77 3300048909 Ga0496106_0033205 Ga0496106_0033205_370_1278 296
78 3300048911 Ga0496108_0004307 Ga0496108_0004307_8391_9299 296
79 3300048912 Ga0496109_0001418 Ga0496109_0001418_8887_9795 296
80 3300048913 Ga0496110_0000968 Ga0496110_0000968_16854_17762 296
81 3300048916 Ga0496113_0003283 Ga0496113_0003283_4539_5447 296
82 3300005985 Ga0081539_10035392 Ga0081539_100353923 297
83 3300039453 Ga0436362_1108482 Ga0436362_1108482_3058_3966 297
84 3300044684 Ga0466966_0132295 Ga0466966_0132295_343_1248 297
85 3300044693 Ga0466961_0108501 Ga0466961_0108501_472_1377 297
86 3300048929 Ga0496126_0039926 Ga0496126_0039926_1855_2781 298
87 iso_pu_bacteria 2867369537 2867374685 298
88 3300025908 Ga0207643_10147579 Ga0207643_101475792 299
89 iso_pu_bacteria 2867312974 2867313019 299
90 iso_pu_bacteria 2867319477 2867325043 299
91 3300031852 Ga0307410_10052221 Ga0307410_100522213 300
92 iso_pu_bacteria 3006425503 3006427138 300
93 iso_pu_bacteria 8002784119 8002785501 300
94 iso_pu_bacteria 2784132148 2784588352 301
95 iso_pu_bacteria 2866612099 2866614695 301
96 iso_pu_bacteria 8008574985 8008578424 301
97 iso_pu_bacteria 2547132111 2547406728 302
98 iso_pu_bacteria 2616644941 2616900576 302
99 iso_pu_bacteria 2643221548 2643759979 302
100 iso_pu_bacteria 2643221578 2643904684 302
101 iso_pu_bacteria 2643221601 2644015077 302
102 iso_pu_bacteria 2643221631 2644176837 302
103 iso_pu_bacteria 2643221670 2644389299 302
104 iso_pu_bacteria 2643221673 2644406050 302
105 iso_pu_bacteria 2643221678 2644438475 302
106 iso_pu_bacteria 2643221682 2644460325 302
107 iso_pu_bacteria 2643221714 2644629247 302
108 iso_pu_bacteria 2808606359 2808847885 302
109 iso_pu_bacteria 2808606375 2808918633 302
110 iso_pu_bacteria 2808606700 2810363024 302
111 iso_pu_bacteria 2811994879 2812360104 302
112 iso_pu_bacteria 2811994917 2812482163 302
113 iso_pu_bacteria 2818991463 2819696608 302
114 iso_pu_bacteria 2818991472 2819743204 302
115 iso_pu_bacteria 2852635781 2852637920 302
116 iso_pu_bacteria 2862281513 2862289410 302
117 iso_pu_bacteria 2862507626 2862514170 302
118 iso_pu_bacteria 2862574272 2862583474 302
119 iso_pu_bacteria 2867475112 2867481003 302
120 iso_pu_bacteria 2905926851 2905930735 302
121 iso_pu_bacteria 2919468124 2919473682 302
122 iso_pu_bacteria 2935390628 2935391066 302
123 iso_pu_bacteria 2946003308 2946006863 302
124 iso_pu_bacteria 2946045630 2946051820 302
125 iso_pu_bacteria 2946064051 2946065782 302
126 iso_pu_bacteria 2946072368 2946074130 302
127 iso_pu_bacteria 2947224130 2947231611 302
128 iso_pu_bacteria 2966598605 2966604190 302
129 iso_pu_bacteria 2997600082 2997601840 302
130 iso_pu_bacteria 8047893842 8047900076 302
131 iso_pu_bacteria 8048356638 8048358852 302
132 iso_pu_bacteria 8048369669 8048377023 302
133 iso_pu_bacteria 8048379754 8048386078 302
134 iso_pu_bacteria 8056667051 8056667972 302
135 3300005440 Ga0070705_100026830 Ga0070705_1000268302 303
136 3300046462 Ga0495651_0015735 Ga0495651_0015735_1238_2161 303
137 iso_pu_bacteria 2643221613 2644082946 303
138 iso_pu_bacteria 2643221690 2644504416 303
139 iso_pu_bacteria 2643221694 2644524097 303
140 iso_pu_bacteria 2643221721 2644665902 303
141 iso_pu_bacteria 2643221722 2644668197 303
142 iso_pu_bacteria 2932431166 2932432940 303
143 iso_pu_bacteria 2935890801 2935891696 303
144 3300028786 Ga0307517_10003033 Ga0307517_1000303323 304
145 3300028786 Ga0307517_10025291 Ga0307517_100252912 304
146 3300031507 Ga0307509_10027298 Ga0307509_100272986 304
147 3300031616 Ga0307508_10003328 Ga0307508_1000332817 304
148 3300031616 Ga0307508_10013515 Ga0307508_100135153 304
149 3300031616 Ga0307508_10166576 Ga0307508_101665762 304
150 3300031730 Ga0307516_10058655 Ga0307516_100586551 304
151 3300031838 Ga0307518_10109986 Ga0307518_101099863 304
152 3300033179 Ga0307507_10018918 Ga0307507_100189187 304
153 3300038443 Ga0395901_0663024 Ga0395901_0663024_49_975 304
154 3300046459 Ga0495629_0005483 Ga0495629_0005483_2556_3479 304
155 3300046522 Ga0495643_0006777 Ga0495643_0006777_81_1163 304
156 3300046524 Ga0495648_0085005 Ga0495648_0085005_488_1411 304
157 3300046660 Ga0495625_0025250 Ga0495625_0025250_1937_2860 304
158 3300046691 Ga0495670_0007491 Ga0495670_0007491_1431_2372 304
159 3300046692 Ga0495671_0044892 Ga0495671_0044892_903_1826 304
160 3300047443 Ga0495687_007494 Ga0495687_007494_5221_6144 304
161 3300047447 Ga0495685_001960 Ga0495685_001960_5206_6147 304
162 3300047470 Ga0495681_0036848 Ga0495681_0036848_1402_2325 304
163 3300047470 Ga0495681_0088852 Ga0495681_0088852_81_1022 304
164 3300053077 Ga0495601_0094576 Ga0495601_0094576_157_1080 304
165 3300053078 Ga0495612_0018868 Ga0495612_0018868_97_1020 304
166 3300053086 Ga0500578_0182984 Ga0500578_0182984_78_1019 304
167 3300053094 Ga0500566_0153933 Ga0500566_0153933_192_1115 304
168 3300053101 Ga0500553_058011 Ga0500553_058011_561_1484 304
169 3300053109 Ga0500569_001314 Ga0500569_001314_3436_4377 304
170 3300053123 Ga0500614_002850 Ga0500614_002850_1771_2694 304
171 3300053137 Ga0500561_0001318 Ga0500561_0001318_291_1214 304
172 3300053149 Ga0500600_0021612 Ga0500600_0021612_2782_3723 304
173 3300053739 Ga0500587_003369 Ga0500587_003369_1091_2032 304
174 3300005455 Ga0070663_100071395 Ga0070663_1000713952 305
175 3300044765 Ga0466970_0001013 Ga0466970_0001013_1097_2017 305
176 3300046529 Ga0495652_0003361 Ga0495652_0003361_11749_12669 305
177 iso_pu_bacteria 2946064051 2946068297 305
178 iso_pu_bacteria 2997451912 2997457362 305
179 3300003316 rootH1_10027633 rootH1_100276338 306
180 3300003320 rootH2_10020050 rootH2_100200503 306
181 3300003323 rootH1_10034134 rootH1_100341348 306
182 3300003354 JGI25160J50197_1006231 JGI25160J50197_10062314 306
183 3300003354 JGI25160J50197_1017766 JGI25160J50197_10177661 306
184 3300003578 Ga0006562J51391_1089877 Ga0006562J51391_10898773 306
185 3300005539 Ga0068853_100024013 Ga0068853_1000240133 306
186 3300015688 Ga0183367_1010 Ga0183367_1010140 306
187 3300025302 Ga0207426_1000871 Ga0207426_100087118 306
188 3300025302 Ga0207426_1005472 Ga0207426_10054722 306
189 3300025302 Ga0207426_1007344 Ga0207426_10073443 306
190 3300025302 Ga0207426_1010214 Ga0207426_10102142 306
191 3300028794 Ga0307515_10041626 Ga0307515_100416266 306
192 3300031456 Ga0307513_10019439 Ga0307513_100194394 306
193 3300042007 Ga0439449_0017425 Ga0439449_0017425_627_1586 306
194 3300044658 Ga0466972_0011549 Ga0466972_0011549_1153_2082 306
195 3300044683 Ga0466965_0063370 Ga0466965_0063370_576_1505 306
196 3300044693 Ga0466961_0173679 Ga0466961_0173679_254_1183 306
197 3300044765 Ga0466970_0004388 Ga0466970_0004388_3417_4391 306
198 3300044901 Ga0466960_0016718 Ga0466960_0016718_1532_2461 306
199 3300046455 Ga0495603_0045987 Ga0495603_0045987_912_1850 306
200 3300046459 Ga0495629_0001920 Ga0495629_0001920_3691_4629 306
201 3300046499 Ga0495594_0001105 Ga0495594_0001105_2925_3863 306
202 3300046529 Ga0495652_0156843 Ga0495652_0156843_70_993 306
203 3300046648 Ga0495611_0007874 Ga0495611_0007874_725_1663 306
204 3300046674 Ga0495588_0013510 Ga0495588_0013510_805_1743 306
205 3300047317 Ga0495604_0094512 Ga0495604_0094512_946_1869 306
206 3300047321 Ga0495676_0011777 Ga0495676_0011777_5021_5959 306
207 3300047444 Ga0495675_0063873 Ga0495675_0063873_55_978 306
208 3300048909 Ga0496106_0110053 Ga0496106_0110053_209_1147 306
209 3300049568 Ga0501031_0033800 Ga0501031_0033800_958_1884 306
210 3300049569 Ga0501032_0013345 Ga0501032_0013345_1433_2359 306
211 3300049569 Ga0501032_0058206 Ga0501032_0058206_1126_2064 306
212 3300049570 Ga0501033_0356395 Ga0501033_0356395_51_977 306
213 3300049571 Ga0501034_0044736 Ga0501034_0044736_3528_4454 306
214 3300049574 Ga0501038_0003499 Ga0501038_0003499_4127_5065 306
215 3300049579 Ga0501043_0115244 Ga0501043_0115244_1015_1941 306
216 3300049581 Ga0501047_0042097 Ga0501047_0042097_1659_2585 306
217 3300049581 Ga0501047_0092642 Ga0501047_0092642_534_1472 306
218 3300049822 Ga0501035_0067292 Ga0501035_0067292_423_1352 306
219 3300049822 Ga0501035_0072005 Ga0501035_0072005_440_1366 306
220 3300049822 Ga0501035_0175546 Ga0501035_0175546_528_1466 306
221 3300050494 nmdc:mga06z11_100405_c1 nmdc:mga06z11_100405_c1_98_1066 306
222 iso_pu_bacteria 8054160619 8054161920 306
223 3300003285 Ga0007423J48922_100235 Ga0007423J48922_1002351 307
224 3300005937 Ga0081455_10012624 Ga0081455_100126248 307
225 3300006846 Ga0075430_100155350 Ga0075430_1001553501 307
226 3300045976 Ga0466967_0022923 Ga0466967_0022923_1008_1934 307
227 3300045976 Ga0466967_0155550 Ga0466967_0155550_1078_2031 307
228 3300048920 Ga0496117_0051558 Ga0496117_0051558_1683_2606 307
229 3300048921 Ga0496118_0173123 Ga0496118_0173123_351_1274 307
230 3300048922 Ga0496119_0037603 Ga0496119_0037603_1488_2411 307
231 3300048925 Ga0496122_0000851 Ga0496122_0000851_39153_40076 307
232 3300048928 Ga0496125_0000047 Ga0496125_0000047_100343_101266 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

199

296

0.94

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

68

159

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

230

346

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.9215 2 306
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9181 1 307
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9153 1 307
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.9128 2 306
2vn8-assembly2.cif.gz_B crystal structure of human reticulon 4 interacting protein 1 in complex with nadph 0.9041 2 307
ID Description Score Start End Superfamily
af_Q0JDV3_9_115_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9794 1 92 3.90.180.10
5a4dE01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.956 1 307 3.90.180.10
5a4dE01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9505 1 307 3.90.180.10
af_A0A0P0W8W7_12_109_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9493 16 116 3.90.180.10
af_P47199_9_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9437 2 121 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A165S1Q9-F1-model_v4 Oxidoreductase 0.9837 1 86
AF-A0A1G7PUL5-F1-model_v4 Alcohol dehydrogenase GroES-like domain-containing protein 0.9823 1 133
AF-W7CC76-F1-model_v4 deleted 0.978 1 88
AF-A0A523GLX5-F1-model_v4 NADP-dependent oxidoreductase 0.9757 1 107
AF-A0A227J0B0-F1-model_v4 NADPH:quinone reductase 0.9753 116 196

Feature Viewer

pLDDT pTM Quality
95.75 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map