F345569

General Info

Members Datasets Scaffolds Average Seq Length
232 168 231 147

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0295535|Ga0495619_0295535_512_1078
Length 188
Sequence LYGVPRVGVPEIETKPNVIKLVRHRMNKPTATMKKTKGNGGSKQGTTGDAPSQLIGARIAALSDWRGDTLARVRRLIREADPEVVEEVKWRKPSNAMLGVPVWSHAGMICTGETYKSVVKMTFAKGASLKEPAGLFNSSLEGNVRRAIDFHEGDKIDEKALKALIRAAVALNISLRATARPQKRAKSA

Samples

Sample ID Description Type Environment
1 2511231017 Pseudomonas sp. GM55 Isolate Nodule
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
114 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0.43
Rhizoplane 4.31
Rhizosphere 92.67
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000956 3300000041 Bacteria 3127
2 ARSoilYngRDRAFT_c00391 3300000042 Bacteria 5826
3 ARcpr5yngRDRAFT_c000253 3300000043 Bacteria 7747
4 ARSoilOldRDRAFT_c000347 3300000044 Bacteria 5931
5 ARCol0yngRDRAFT_1000887 3300000652 Bacteria 2695
6 Ga0065716_1002884 3300005277 Bacteria 1463
7 Ga0065707_10087606 3300005295 Bacteria 4953
8 Ga0065707_10292788 3300005295 Bacteria 1021
9 Ga0070676_10137719 3300005328 Bacteria 1550
10 Ga0070690_100073968 3300005330 Bacteria 2218
11 Ga0070670_100321144 3300005331 Bacteria 1357
12 Ga0070677_10826874 3300005333 Bacteria 531
13 Ga0068869_100058931 3300005334 Bacteria 2809
14 Ga0068868_100139682 3300005338 Bacteria 1988
15 Ga0070660_100063084 3300005339 Bacteria 2880
16 Ga0070668_100912764 3300005347 Bacteria 785
17 Ga0070668_101047189 3300005347 Bacteria 735
18 Ga0070669_100536070 3300005353 Bacteria 974
19 Ga0070669_100749090 3300005353 Bacteria 828
20 Ga0070675_100255215 3300005354 Bacteria 1535
21 Ga0070675_100617593 3300005354 Bacteria 984
22 Ga0070675_100938292 3300005354 Bacteria 794
23 Ga0070674_100239961 3300005356 Bacteria 1418
24 Ga0070673_100213214 3300005364 Bacteria 1669
25 Ga0070673_101569122 3300005364 Bacteria 622
26 Ga0070688_100158001 3300005365 Bacteria 1556
27 Ga0070667_100271156 3300005367 Bacteria 1522
28 Ga0070667_100306818 3300005367 Bacteria 1430
29 Ga0070667_101687857 3300005367 Bacteria 596
30 Ga0070701_10931176 3300005438 Bacteria 602
31 Ga0070694_100068453 3300005444 Bacteria 2440
32 Ga0070694_100415624 3300005444 Bacteria 1056
33 Ga0070678_100091899 3300005456 Bacteria 2330
34 Ga0070678_100638233 3300005456 Bacteria 954
35 Ga0068867_100262927 3300005459 Bacteria 1407
36 Ga0068867_101072276 3300005459 Bacteria 734
37 Ga0070685_10930389 3300005466 Bacteria 649
38 Ga0070679_101691247 3300005530 Bacteria 581
39 Ga0070695_100049848 3300005545 Bacteria 2681
40 Ga0070695_100926384 3300005545 Bacteria 705
41 Ga0070665_101070697 3300005548 Bacteria 818
42 Ga0070702_100348681 3300005615 Bacteria 1042
43 Ga0068852_100442905 3300005616 Bacteria 1285
44 Ga0068859_101656494 3300005617 Bacteria 707
45 Ga0068864_100231702 3300005618 Bacteria 1708
46 Ga0068864_100636280 3300005618 Bacteria 1038
47 Ga0068866_10058731 3300005718 Bacteria 1988
48 Ga0068861_100221717 3300005719 Bacteria 1599
49 Ga0068870_10632764 3300005840 Bacteria 731
50 Ga0068863_100383639 3300005841 Bacteria 1372
51 Ga0068858_100082934 3300005842 Bacteria 2981
52 Ga0068860_100125732 3300005843 Bacteria 2457
53 Ga0068860_100207425 3300005843 Bacteria 1901
54 Ga0068862_101001105 3300005844 Bacteria 827
55 Ga0068862_101029598 3300005844 Bacteria 815
56 Ga0081538_10022800 3300005981 Bacteria 4522
57 Ga0075432_10000378 3300006058 Bacteria 12876
58 Ga0075367_10052696 3300006178 Bacteria 2409
59 Ga0075427_10000361 3300006194 Bacteria 5011
60 Ga0097621_100013732 3300006237 Bacteria 6046
61 Ga0097621_101427458 3300006237 Bacteria 656
62 Ga0068871_100226443 3300006358 Bacteria 1622
63 Ga0075428_100135876 3300006844 Bacteria 2673
64 Ga0075428_100143079 3300006844 Bacteria 2600
65 Ga0075430_100001491 3300006846 Bacteria 19079
66 Ga0075431_100015985 3300006847 Bacteria 7614
67 Ga0075433_10002422 3300006852 Bacteria 14186
68 Ga0075433_10014064 3300006852 Bacteria 6525
69 Ga0075434_100001203 3300006871 Bacteria 21514
70 Ga0075434_100004436 3300006871 Bacteria 12646
71 Ga0075429_100000388 3300006880 Bacteria 32233
72 Ga0068865_100112428 3300006881 Bacteria 2011
73 Ga0097620_101656608 3300006931 Bacteria 707
74 Ga0075435_100003865 3300007076 Bacteria 10219
75 Ga0111539_10023272 3300009094 Bacteria 7610
76 Ga0111539_10028489 3300009094 Bacteria 6812
77 Ga0111539_12175251 3300009094 Bacteria 644
78 Ga0105247_10011395 3300009101 Bacteria 5362
79 Ga0105247_10241887 3300009101 Bacteria 1230
80 Ga0114129_10006438 3300009147 Bacteria 16649
81 Ga0114129_11338808 3300009147 Bacteria 886
82 Ga0105243_10030905 3300009148 Bacteria 4127
83 Ga0105243_10944269 3300009148 Bacteria 861
84 Ga0105243_11739875 3300009148 Bacteria 653
85 Ga0105242_10066651 3300009176 Bacteria 2974
86 Ga0105242_10333346 3300009176 Bacteria 1396
87 Ga0105237_10575378 3300009545 Bacteria 1133
88 Ga0105238_10211600 3300009551 Bacteria 1915
89 Ga0105249_10016212 3300009553 Bacteria 6608
90 Ga0105249_10497140 3300009553 Bacteria 1264
91 Ga0105249_10850505 3300009553 Bacteria 978
92 Ga0105239_10105814 3300010375 Bacteria 3116
93 Ga0105239_10822290 3300010375 Bacteria 1065
94 Ga0105239_10923087 3300010375 Bacteria 1002
95 Ga0157370_10070274 3300013104 Bacteria 3305
96 Ga0157378_10023616 3300013297 Bacteria 5408
97 Ga0163162_10401607 3300013306 Bacteria 1503
98 Ga0163162_10442951 3300013306 Bacteria 1431
99 Ga0157375_10581793 3300013308 Bacteria 1280
100 Ga0157380_11930860 3300014326 Bacteria 651
101 Ga0157379_10035897 3300014968 Bacteria 4421
102 Ga0157379_10185925 3300014968 Bacteria 1878
103 Ga0157379_10624559 3300014968 Bacteria 1007
104 Ga0157379_10899178 3300014968 Bacteria 840
105 Ga0157376_10070616 3300014969 Bacteria 2965
106 Ga0157376_10178359 3300014969 Bacteria 1940
107 Ga0157376_10806974 3300014969 Bacteria 951
108 Ga0163161_10284270 3300017792 Bacteria 1298
109 Ga0207653_10085280 3300025885 Bacteria 1099
110 Ga0207642_10013191 3300025899 Bacteria 3008
111 Ga0207710_10019226 3300025900 Bacteria 2914
112 Ga0207645_10141506 3300025907 Bacteria 1568
113 Ga0207643_10065188 3300025908 Bacteria 2086
114 Ga0207649_10256922 3300025920 Bacteria 1261
115 Ga0207650_10038367 3300025925 Bacteria 3497
116 Ga0207650_10139989 3300025925 Bacteria 1901
117 Ga0207659_10453998 3300025926 Bacteria 1080
118 Ga0207659_10859044 3300025926 Bacteria 780
119 Ga0207706_10256948 3300025933 Bacteria 1525
120 Ga0207686_10146616 3300025934 Bacteria 1638
121 Ga0207670_10248923 3300025936 Bacteria 1372
122 Ga0207669_10257208 3300025937 Bacteria 1304
123 Ga0207691_10028829 3300025940 Bacteria 5195
124 Ga0207689_10006256 3300025942 Bacteria 10551
125 Ga0207651_10270813 3300025960 Bacteria 1399
126 Ga0207668_10788858 3300025972 Bacteria 840
127 Ga0207668_11950134 3300025972 Bacteria 529
128 Ga0207658_10329991 3300025986 Bacteria 1323
129 Ga0207658_11075089 3300025986 Bacteria 735
130 Ga0207677_10961463 3300026023 Bacteria 773
131 Ga0207703_10092108 3300026035 Bacteria 2550
132 Ga0207641_10619263 3300026088 Bacteria 1061
133 Ga0207648_10019684 3300026089 Bacteria 6090
134 Ga0207676_10838250 3300026095 Bacteria 899
135 Ga0207676_11582239 3300026095 Bacteria 653
136 Ga0207675_100186394 3300026118 Bacteria 1989
137 Ga0207683_10257464 3300026121 Bacteria 1593
138 Ga0207683_10692392 3300026121 Bacteria 945
139 Ga0207428_10000272 3300027907 Bacteria 69872
140 Ga0268265_10221507 3300028380 Bacteria 1656
141 Ga0268264_10259427 3300028381 Bacteria 1618
142 Ga0265339_10001918 3300031249 Bacteria 15257
143 Ga0265316_10034259 3300031344 Bacteria 4126
144 Ga0265313_10004038 3300031595 Bacteria 11443
145 Ga0373960_0109492 3300035121 Bacteria 905
146 Ga0373931_0036448 3300035691 Bacteria 2564
147 Ga0373925_0201288 3300037068 Bacteria 1584
148 Ga0373925_0404541 3300037068 Bacteria 1114
149 Ga0436364_0172671 3300037853 Bacteria 1654
150 Ga0439466_0105174 3300041411 Bacteria 878
151 Ga0439465_0004533 3300041413 Bacteria 4490
152 Ga0439460_0225413 3300042461 Bacteria 643
153 Ga0495603_0422876 3300046455 Bacteria 763
154 Ga0495584_0063241 3300046491 Bacteria 1860
155 Ga0495644_0187646 3300046523 Bacteria 795
156 Ga0495598_0093103 3300046537 Bacteria 986
157 Ga0495658_0075501 3300046683 Bacteria 1967
158 Ga0495671_0115924 3300046692 Bacteria 1308
159 Ga0496101_0561570 3300048904 Bacteria 902
160 Ga0496101_0873911 3300048904 Bacteria 708
161 Ga0496105_0384138 3300048908 Bacteria 1117
162 Ga0496106_0291119 3300048909 Bacteria 1309
163 Ga0496107_0138096 3300048910 Bacteria 1801
164 Ga0496110_0410754 3300048913 Bacteria 1234
165 Ga0496111_0285414 3300048914 Bacteria 1224
166 Ga0496114_0321392 3300048917 Bacteria 1367
167 Ga0496114_1176221 3300048917 Bacteria 653
168 Ga0496115_0040150 3300048918 Bacteria 3719
169 Ga0496126_0480655 3300048929 Bacteria 995
170 Ga0501031_0615234 3300049568 Bacteria 699
171 Ga0501032_0299217 3300049569 Bacteria 1040
172 Ga0501033_0245263 3300049570 Bacteria 1270
173 Ga0501034_0332668 3300049571 Bacteria 1450
174 Ga0501036_1699322 3300049572 Bacteria 509
175 Ga0501038_0261080 3300049574 Bacteria 1369
176 Ga0501039_1008016 3300049575 Bacteria 647
177 Ga0501041_0447228 3300049577 Bacteria 820
178 Ga0501042_0089743 3300049578 Bacteria 2205
179 Ga0501046_0018494 3300049580 Bacteria 5797
180 Ga0501046_0398177 3300049580 Bacteria 995
181 Ga0501047_0014125 3300049581 Bacteria 7588
182 Ga0501047_0092730 3300049581 Bacteria 2899
183 Ga0501048_0292342 3300049582 Bacteria 1159
184 Ga0501048_0966939 3300049582 Bacteria 613
185 Ga0501068_0377889 3300049584 Bacteria 912
186 Ga0501070_0220383 3300049586 Bacteria 1556
187 Ga0501072_0146886 3300049588 Bacteria 1880
188 Ga0501072_0276178 3300049588 Bacteria 1337
189 Ga0501073_0484491 3300049589 Bacteria 855
190 Ga0501073_1245170 3300049589 Bacteria 510
191 Ga0501075_0151993 3300049591 Bacteria 1764
192 Ga0501076_0158164 3300049592 Bacteria 1845
193 Ga0501077_0031872 3300049593 Bacteria 3353
194 Ga0501225_0120592 3300049705 Bacteria 779
195 Ga0501079_0090998 3300049741 Bacteria 2364
196 Ga0501079_0093216 3300049741 Bacteria 2333
197 Ga0501080_0084874 3300049742 Bacteria 2942
198 Ga0501081_0011890 3300049743 Bacteria 5702
199 Ga0501081_0031236 3300049743 Bacteria 3609
200 Ga0501083_0661412 3300049744 Bacteria 679
201 Ga0501035_0175459 3300049822 Bacteria 1849
202 Ga0501044_0000462 3300049823 Bacteria 49411
203 Ga0501044_0151609 3300049823 Bacteria 2300
204 Ga0501045_0126448 3300049824 Bacteria 1899
205 Ga0501045_0256318 3300049824 Bacteria 1302
206 nmdc:mga00v17_425916_c1 3300050491 Bacteria 862
207 nmdc:mga06z11_119325_c1 3300050494 Bacteria 1470
208 nmdc:mga05p37_214865_c1 3300050507 Bacteria 2323
209 nmdc:mga05p37_29410_c1 3300050507 Bacteria 6705
210 nmdc:mga09592_45284_c1 3300050508 Bacteria 3706
211 nmdc:mga0qj67_18241_c1 3300050509 Bacteria 5348
212 nmdc:mga06r32_19867_c1 3300050510 Bacteria 6174
213 nmdc:mga06r32_891432_c1 3300050510 Bacteria 846
214 nmdc:mga06r32_910691_c1 3300050510 Bacteria 835
215 nmdc:mga08y16_8082_c1 3300050511 Bacteria 11006
216 nmdc:mga0n895_266_c1 3300050512 Bacteria 34104
217 nmdc:mga0n895_847_c1 3300050512 Bacteria 21992
218 nmdc:mga0rr50_2712_c1 3300050513 Bacteria 10041
219 nmdc:mga0a205_6863_c1 3300050515 Bacteria 10299
220 nmdc:mga0a205_7621_c1 3300050515 Bacteria 9814
221 Ga0495612_0177012 3300053078 Bacteria 936
222 Ga0495619_0295535 3300053085 Bacteria 1122
223 Ga0500616_0009374 3300053153 Bacteria 5961
224 Ga0501084_0098468 3300054114 Bacteria 2455
225 Ga0501084_0110435 3300054114 Bacteria 2310
226 Ga0501084_1355099 3300054114 Bacteria 596
227 Ga0501082_0037258 3300060353 Bacteria 4191
228 Ga0501082_0116208 3300060353 Bacteria 2317
229 Ga0501082_0135117 3300060353 Bacteria 2140
230 Ga0501082_1623533 3300060353 Bacteria 564
231 Ga0530510_0134187 3300061734 Bacteria 1822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2511231017 2511329822 125
2 3300005444 Ga0070694_100415624 Ga0070694_1004156241 126
3 3300006852 Ga0075433_10002422 Ga0075433_100024223 126
4 3300006871 Ga0075434_100001203 Ga0075434_1000012034 126
5 3300050512 nmdc:mga0n895_847_c1 nmdc:mga0n895_847_c1_9163_9543 126
6 3300050515 nmdc:mga0a205_6863_c1 nmdc:mga0a205_6863_c1_7919_8299 126
7 3300025920 Ga0207649_10256922 Ga0207649_102569223 127
8 3300009148 Ga0105243_10944269 Ga0105243_109442691 129
9 3300014968 Ga0157379_10624559 Ga0157379_106245591 129
10 3300014969 Ga0157376_10070616 Ga0157376_100706164 129
11 3300025986 Ga0207658_11075089 Ga0207658_110750892 129
12 3300005295 Ga0065707_10087606 Ga0065707_100876065 131
13 3300005328 Ga0070676_10137719 Ga0070676_101377191 131
14 3300005330 Ga0070690_100073968 Ga0070690_1000739683 131
15 3300005333 Ga0070677_10826874 Ga0070677_108268741 131
16 3300005334 Ga0068869_100058931 Ga0068869_1000589314 131
17 3300005338 Ga0068868_100139682 Ga0068868_1001396823 131
18 3300005353 Ga0070669_100749090 Ga0070669_1007490902 131
19 3300005354 Ga0070675_100255215 Ga0070675_1002552152 131
20 3300005356 Ga0070674_100239961 Ga0070674_1002399612 131
21 3300005364 Ga0070673_100213214 Ga0070673_1002132143 131
22 3300005365 Ga0070688_100158001 Ga0070688_1001580014 131
23 3300005367 Ga0070667_100271156 Ga0070667_1002711562 131
24 3300005438 Ga0070701_10931176 Ga0070701_109311762 131
25 3300005456 Ga0070678_100091899 Ga0070678_1000918992 131
26 3300005459 Ga0068867_100262927 Ga0068867_1002629272 131
27 3300005466 Ga0070685_10930389 Ga0070685_109303891 131
28 3300005548 Ga0070665_101070697 Ga0070665_1010706972 131
29 3300005615 Ga0070702_100348681 Ga0070702_1003486812 131
30 3300005617 Ga0068859_101656494 Ga0068859_1016564942 131
31 3300005618 Ga0068864_100231702 Ga0068864_1002317024 131
32 3300005718 Ga0068866_10058731 Ga0068866_100587314 131
33 3300005719 Ga0068861_100221717 Ga0068861_1002217172 131
34 3300005840 Ga0068870_10632764 Ga0068870_106327642 131
35 3300005841 Ga0068863_100383639 Ga0068863_1003836392 131
36 3300005843 Ga0068860_100125732 Ga0068860_1001257324 131
37 3300005844 Ga0068862_101001105 Ga0068862_1010011052 131
38 3300006237 Ga0097621_100013732 Ga0097621_1000137328 131
39 3300006358 Ga0068871_100226443 Ga0068871_1002264434 131
40 3300006881 Ga0068865_100112428 Ga0068865_1001124283 131
41 3300006931 Ga0097620_101656608 Ga0097620_1016566082 131
42 3300009148 Ga0105243_10030905 Ga0105243_100309059 131
43 3300009176 Ga0105242_10066651 Ga0105242_100666515 131
44 3300009551 Ga0105238_10211600 Ga0105238_102116003 131
45 3300009553 Ga0105249_10016212 Ga0105249_100162128 131
46 3300013297 Ga0157378_10023616 Ga0157378_100236166 131
47 3300013308 Ga0157375_10581793 Ga0157375_105817932 131
48 3300014968 Ga0157379_10035897 Ga0157379_100358975 131
49 3300014969 Ga0157376_10178359 Ga0157376_101783595 131
50 3300017792 Ga0163161_10284270 Ga0163161_102842702 131
51 3300025899 Ga0207642_10013191 Ga0207642_100131916 131
52 3300025907 Ga0207645_10141506 Ga0207645_101415064 131
53 3300025908 Ga0207643_10065188 Ga0207643_100651881 131
54 3300025925 Ga0207650_10038367 Ga0207650_100383672 131
55 3300025926 Ga0207659_10453998 Ga0207659_104539982 131
56 3300025934 Ga0207686_10146616 Ga0207686_101466161 131
57 3300025936 Ga0207670_10248923 Ga0207670_102489232 131
58 3300025937 Ga0207669_10257208 Ga0207669_102572083 131
59 3300025940 Ga0207691_10028829 Ga0207691_100288294 131
60 3300025942 Ga0207689_10006256 Ga0207689_100062568 131
61 3300025972 Ga0207668_11950134 Ga0207668_119501341 131
62 3300026023 Ga0207677_10961463 Ga0207677_109614632 131
63 3300026088 Ga0207641_10619263 Ga0207641_106192632 131
64 3300026089 Ga0207648_10019684 Ga0207648_100196842 131
65 3300026095 Ga0207676_11582239 Ga0207676_115822391 131
66 3300026118 Ga0207675_100186394 Ga0207675_1001863942 131
67 3300026121 Ga0207683_10257464 Ga0207683_102574642 131
68 3300028380 Ga0268265_10221507 Ga0268265_102215072 131
69 3300005981 Ga0081538_10022800 Ga0081538_100228003 132
70 3300009147 Ga0114129_11338808 Ga0114129_113388082 132
71 3300048917 Ga0496114_1176221 Ga0496114_1176221_213_611 132
72 3300005331 Ga0070670_100321144 Ga0070670_1003211443 133
73 3300025925 Ga0207650_10139989 Ga0207650_101399893 133
74 3300048929 Ga0496126_0480655 Ga0496126_0480655_122_580 134
75 3300005364 Ga0070673_101569122 Ga0070673_1015691221 137
76 3300005530 Ga0070679_101691247 Ga0070679_1016912471 137
77 3300013104 Ga0157370_10070274 Ga0157370_100702742 137
78 3300014968 Ga0157379_10899178 Ga0157379_108991782 137
79 3300014969 Ga0157376_10806974 Ga0157376_108069742 137
80 3300025960 Ga0207651_10270813 Ga0207651_102708132 137
81 3300037068 Ga0373925_0201288 Ga0373925_0201288_329_763 137
82 3300048918 Ga0496115_0040150 Ga0496115_0040150_1241_1714 137
83 3300006237 Ga0097621_101427458 Ga0097621_1014274582 138
84 3300010375 Ga0105239_10822290 Ga0105239_108222901 140
85 3300009094 Ga0111539_12175251 Ga0111539_121752512 141
86 3300031249 Ga0265339_10001918 Ga0265339_1000191812 141
87 3300031344 Ga0265316_10034259 Ga0265316_100342593 141
88 3300031595 Ga0265313_10004038 Ga0265313_100040388 141
89 3300048904 Ga0496101_0561570 Ga0496101_0561570_368_835 141
90 3300048909 Ga0496106_0291119 Ga0496106_0291119_286_753 141
91 3300048917 Ga0496114_0321392 Ga0496114_0321392_342_809 141
92 3300005347 Ga0070668_101047189 Ga0070668_1010471891 142
93 3300005354 Ga0070675_100938292 Ga0070675_1009382922 142
94 3300005367 Ga0070667_100306818 Ga0070667_1003068182 142
95 3300005444 Ga0070694_100068453 Ga0070694_1000684532 142
96 3300005616 Ga0068852_100442905 Ga0068852_1004429052 142
97 3300005842 Ga0068858_100082934 Ga0068858_1000829345 142
98 3300005843 Ga0068860_100207425 Ga0068860_1002074252 142
99 3300009101 Ga0105247_10011395 Ga0105247_100113957 142
100 3300009176 Ga0105242_10333346 Ga0105242_103333461 142
101 3300009545 Ga0105237_10575378 Ga0105237_105753781 142
102 3300009553 Ga0105249_10497140 Ga0105249_104971402 142
103 3300010375 Ga0105239_10105814 Ga0105239_101058141 142
104 3300014968 Ga0157379_10185925 Ga0157379_101859253 142
105 3300025885 Ga0207653_10085280 Ga0207653_100852801 142
106 3300025900 Ga0207710_10019226 Ga0207710_100192265 142
107 3300025926 Ga0207659_10859044 Ga0207659_108590442 142
108 3300025933 Ga0207706_10256948 Ga0207706_102569483 142
109 3300025972 Ga0207668_10788858 Ga0207668_107888581 142
110 3300025986 Ga0207658_10329991 Ga0207658_103299912 142
111 3300026035 Ga0207703_10092108 Ga0207703_100921082 142
112 3300028381 Ga0268264_10259427 Ga0268264_102594271 142
113 3300048910 Ga0496107_0138096 Ga0496107_0138096_938_1393 142
114 3300048913 Ga0496110_0410754 Ga0496110_0410754_353_808 142
115 3300048914 Ga0496111_0285414 Ga0496111_0285414_658_1113 142
116 3300049577 Ga0501041_0447228 Ga0501041_0447228_143_607 142
117 3300049578 Ga0501042_0089743 Ga0501042_0089743_242_706 142
118 3300049582 Ga0501048_0966939 Ga0501048_0966939_128_592 142
119 3300049584 Ga0501068_0377889 Ga0501068_0377889_104_568 142
120 3300049588 Ga0501072_0146886 Ga0501072_0146886_451_915 142
121 3300049589 Ga0501073_0484491 Ga0501073_0484491_298_762 142
122 3300049591 Ga0501075_0151993 Ga0501075_0151993_186_650 142
123 3300049592 Ga0501076_0158164 Ga0501076_0158164_261_725 142
124 3300049593 Ga0501077_0031872 Ga0501077_0031872_1962_2426 142
125 3300049741 Ga0501079_0093216 Ga0501079_0093216_1215_1679 142
126 3300049743 Ga0501081_0011890 Ga0501081_0011890_938_1402 142
127 3300049824 Ga0501045_0126448 Ga0501045_0126448_91_555 142
128 3300054114 Ga0501084_0098468 Ga0501084_0098468_895_1359 142
129 3300060353 Ga0501082_0037258 Ga0501082_0037258_435_899 142
130 3300005367 Ga0070667_101687857 Ga0070667_1016878571 143
131 3300006058 Ga0075432_10000378 Ga0075432_1000037813 143
132 3300006194 Ga0075427_10000361 Ga0075427_100003617 143
133 3300006844 Ga0075428_100135876 Ga0075428_1001358761 143
134 3300006846 Ga0075430_100001491 Ga0075430_10000149113 143
135 3300006847 Ga0075431_100015985 Ga0075431_1000159855 143
136 3300006852 Ga0075433_10014064 Ga0075433_100140643 143
137 3300006871 Ga0075434_100004436 Ga0075434_1000044368 143
138 3300006880 Ga0075429_100000388 Ga0075429_10000038831 143
139 3300007076 Ga0075435_100003865 Ga0075435_10000386518 143
140 3300009094 Ga0111539_10028489 Ga0111539_100284893 143
141 3300009147 Ga0114129_10006438 Ga0114129_1000643815 143
142 3300014326 Ga0157380_11930860 Ga0157380_119308601 143
143 3300027907 Ga0207428_10000272 Ga0207428_1000027214 143
144 3300035121 Ga0373960_0109492 Ga0373960_0109492_200_658 143
145 3300035691 Ga0373931_0036448 Ga0373931_0036448_1194_1652 143
146 3300037853 Ga0436364_0172671 Ga0436364_0172671_228_692 143
147 3300042461 Ga0439460_0225413 Ga0439460_0225413_161_628 143
148 3300046455 Ga0495603_0422876 Ga0495603_0422876_20_484 143
149 3300046523 Ga0495644_0187646 Ga0495644_0187646_18_485 143
150 3300046683 Ga0495658_0075501 Ga0495658_0075501_726_1205 143
151 3300046692 Ga0495671_0115924 Ga0495671_0115924_199_654 143
152 3300049705 Ga0501225_0120592 Ga0501225_0120592_102_662 143
153 3300050507 nmdc:mga05p37_29410_c1 nmdc:mga05p37_29410_c1_1937_2389 143
154 3300050508 nmdc:mga09592_45284_c1 nmdc:mga09592_45284_c1_26_478 143
155 3300050509 nmdc:mga0qj67_18241_c1 nmdc:mga0qj67_18241_c1_2865_3317 143
156 3300050510 nmdc:mga06r32_19867_c1 nmdc:mga06r32_19867_c1_2704_3156 143
157 3300050511 nmdc:mga08y16_8082_c1 nmdc:mga08y16_8082_c1_2865_3317 143
158 3300050512 nmdc:mga0n895_266_c1 nmdc:mga0n895_266_c1_25704_26156 143
159 3300050513 nmdc:mga0rr50_2712_c1 nmdc:mga0rr50_2712_c1_5466_5918 143
160 3300050515 nmdc:mga0a205_7621_c1 nmdc:mga0a205_7621_c1_154_606 143
161 3300005545 Ga0070695_100926384 Ga0070695_1009263841 144
162 3300005618 Ga0068864_100636280 Ga0068864_1006362802 144
163 3300009101 Ga0105247_10241887 Ga0105247_102418872 144
164 3300009148 Ga0105243_11739875 Ga0105243_117398751 144
165 3300013306 Ga0163162_10401607 Ga0163162_104016071 144
166 3300026095 Ga0207676_10838250 Ga0207676_108382502 144
167 3300041413 Ga0439465_0004533 Ga0439465_0004533_585_1040 144
168 3300048904 Ga0496101_0873911 Ga0496101_0873911_203_676 144
169 3300049569 Ga0501032_0299217 Ga0501032_0299217_186_650 144
170 3300049570 Ga0501033_0245263 Ga0501033_0245263_521_985 144
171 3300049571 Ga0501034_0332668 Ga0501034_0332668_528_992 144
172 3300049574 Ga0501038_0261080 Ga0501038_0261080_693_1157 144
173 3300049580 Ga0501046_0398177 Ga0501046_0398177_263_727 144
174 3300049581 Ga0501047_0092730 Ga0501047_0092730_424_888 144
175 3300049586 Ga0501070_0220383 Ga0501070_0220383_895_1359 144
176 3300049589 Ga0501073_1245170 Ga0501073_1245170_14_478 144
177 3300049822 Ga0501035_0175459 Ga0501035_0175459_1236_1700 144
178 3300049823 Ga0501044_0151609 Ga0501044_0151609_339_803 144
179 3300050491 nmdc:mga00v17_425916_c1 nmdc:mga00v17_425916_c1_37_495 144
180 3300050510 nmdc:mga06r32_910691_c1 nmdc:mga06r32_910691_c1_81_554 144
181 3300026121 Ga0207683_10692392 Ga0207683_106923921 146
182 3300046537 Ga0495598_0093103 Ga0495598_0093103_458_925 146
183 3300060353 Ga0501082_1623533 Ga0501082_1623533_41_502 146
184 3300005459 Ga0068867_101072276 Ga0068867_1010722761 147
185 3300049572 Ga0501036_1699322 Ga0501036_1699322_25_492 148
186 3300005295 Ga0065707_10292788 Ga0065707_102927882 149
187 3300005354 Ga0070675_100617593 Ga0070675_1006175931 149
188 3300046491 Ga0495584_0063241 Ga0495584_0063241_1060_1551 149
189 3300054114 Ga0501084_1355099 Ga0501084_1355099_98_586 149
190 3300061734 Ga0530510_0134187 Ga0530510_0134187_267_755 149
191 3300000041 ARcpr5oldR_c000956 ARcpr5oldR_0009564 150
192 3300000042 ARSoilYngRDRAFT_c00391 ARSoilYngRDRAFT_003912 150
193 3300000043 ARcpr5yngRDRAFT_c000253 ARcpr5yngRDRAFT_0002533 150
194 3300000044 ARSoilOldRDRAFT_c000347 ARSoilOldRDRAFT_0003473 150
195 3300000652 ARCol0yngRDRAFT_1000887 ARCol0yngRDRAFT_10008872 150
196 3300005277 Ga0065716_1002884 Ga0065716_10028842 150
197 3300005339 Ga0070660_100063084 Ga0070660_1000630842 150
198 3300005347 Ga0070668_100912764 Ga0070668_1009127642 150
199 3300005353 Ga0070669_100536070 Ga0070669_1005360702 150
200 3300005456 Ga0070678_100638233 Ga0070678_1006382331 150
201 3300005545 Ga0070695_100049848 Ga0070695_1000498481 150
202 3300005844 Ga0068862_101029598 Ga0068862_1010295981 150
203 3300006178 Ga0075367_10052696 Ga0075367_100526963 150
204 3300006844 Ga0075428_100143079 Ga0075428_1001430795 150
205 3300009094 Ga0111539_10023272 Ga0111539_100232722 150
206 3300009553 Ga0105249_10850505 Ga0105249_108505052 150
207 3300010375 Ga0105239_10923087 Ga0105239_109230872 150
208 3300013306 Ga0163162_10442951 Ga0163162_104429512 150
209 3300037068 Ga0373925_0404541 Ga0373925_0404541_202_711 150
210 3300041411 Ga0439466_0105174 Ga0439466_0105174_62_538 150
211 3300048908 Ga0496105_0384138 Ga0496105_0384138_489_962 150
212 3300049568 Ga0501031_0615234 Ga0501031_0615234_96_581 150
213 3300049575 Ga0501039_1008016 Ga0501039_1008016_82_555 150
214 3300049580 Ga0501046_0018494 Ga0501046_0018494_3240_3731 150
215 3300049581 Ga0501047_0014125 Ga0501047_0014125_2764_3240 150
216 3300049582 Ga0501048_0292342 Ga0501048_0292342_459_950 150
217 3300049588 Ga0501072_0276178 Ga0501072_0276178_144_617 150
218 3300049741 Ga0501079_0090998 Ga0501079_0090998_1003_1494 150
219 3300049742 Ga0501080_0084874 Ga0501080_0084874_2442_2918 150
220 3300049743 Ga0501081_0031236 Ga0501081_0031236_673_1164 150
221 3300049744 Ga0501083_0661412 Ga0501083_0661412_115_606 150
222 3300049823 Ga0501044_0000462 Ga0501044_0000462_32268_32744 150
223 3300049824 Ga0501045_0256318 Ga0501045_0256318_370_861 150
224 3300050494 nmdc:mga06z11_119325_c1 nmdc:mga06z11_119325_c1_186_659 150
225 3300050507 nmdc:mga05p37_214865_c1 nmdc:mga05p37_214865_c1_360_866 150
226 3300050510 nmdc:mga06r32_891432_c1 nmdc:mga06r32_891432_c1_191_682 150
227 3300053078 Ga0495612_0177012 Ga0495612_0177012_17_487 150
228 3300053085 Ga0495619_0295535 Ga0495619_0295535_512_1078 150
229 3300053153 Ga0500616_0009374 Ga0500616_0009374_1187_1678 150
230 3300054114 Ga0501084_0110435 Ga0501084_0110435_1611_2084 150
231 3300060353 Ga0501082_0116208 Ga0501082_0116208_1707_2183 150
232 3300060353 Ga0501082_0135117 Ga0501082_0135117_448_939 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

66

169

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.5673 109 141
2cve-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein tt1547 from thermus thermophilus hb8 0.5637 111 140
4e04-assembly1.cif.gz_A rpbphp2 chromophore-binding domain crystallized by homologue-directed mutagenesis. 0.4892 85 143
3hcy-assembly1.cif.gz_B the crystal structure of the domain of putative two-component sensor histidine kinase protein from sinorhizobium meliloti 1021 0.471 81 150
3fm5-assembly3.cif.gz_B x-ray crystal structure of transcriptional regulator (marr family) from rhodococcus sp. rha1 0.4662 99 148
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7206 19 136 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6996 19 136 3.90.1150.200
af_Q2FVX9_1_163_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.6001 111 138 3.30.70.640
5ti8B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.5907 109 142 3.90.1150.10
af_A0A0R0H6P7_106_542_3.30.450.70 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.5704 104 145 3.30.450.70
ID Description Score Start End GO Terms
AF-A0A528WJB4-F1-model_v4 DUF1801 domain-containing protein 0.9478 84 143
AF-A0A370D3G0-F1-model_v4 deleted 0.8924 17 139
AF-A0A1E4DJ85-F1-model_v4 deleted 0.8906 17 142
AF-A0A528WJB4-F1-model_v4 DUF1801 domain-containing protein 0.8902 84 143
AF-A0A7V9TMV2-F1-model_v4 DUF1801 domain-containing protein 0.8895 17 141

Feature Viewer

pLDDT pTM Quality
79.33 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map