F345374

General Info

Members Datasets Scaffolds Average Seq Length
232 172 464 132

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0002120|Ga0495638_0002120_12099_12560
Length 153
Sequence LNHFALANVSWSSDTTNEEVHMPAFPALTHVAITVRDLAVSAPWYRTLIGGDPVIDEDTDAGYRHVVFALDGDTLLGLHQHTQPAPDERFSEYRVGLDHVAFACASREDLEKWVGRLDELGIEHGGIVDAAYGSGLSFRDPDGCALEFFAPPA

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
93 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
94 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
95 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
170 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
171 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
172 2928142448 Prescottella equi DPS 2018 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.97
Metatranscriptomes 4.74
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.21
Nodule 0
Rhizoplane 4.74
Rhizosphere 75.86
Stem 0
Stem Tuber 0
Unclassified 7.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0002120 3300046460 Bacteria 16730
2 Ga0006778J45830_1021700 3300003162 Bacteria 539
3 Ga0006759J45824_1090532 3300003163 Bacteria 533
4 Ga0006777J48905_1075965 3300003308 Bacteria 506
5 Ga0007429J51699_1015039 3300003579 Bacteria 816
6 Ga0055540_1003264 3300003792 Bacteria 7935
7 Ga0070658_10093899 3300005327 Bacteria 2475
8 Ga0070670_100386155 3300005331 Bacteria 1234
9 Ga0070680_100000303 3300005336 Bacteria 32891
10 Ga0070660_100597752 3300005339 Bacteria 922
11 Ga0070689_101321389 3300005340 Bacteria 650
12 Ga0070668_100013619 3300005347 Bacteria 6073
13 Ga0070673_100352110 3300005364 Bacteria 1307
14 Ga0070673_101571842 3300005364 Bacteria 621
15 Ga0070659_101033357 3300005366 Bacteria 722
16 Ga0070713_100198663 3300005436 Bacteria 1810
17 Ga0070708_100000196 3300005445 Bacteria 44168
18 Ga0070681_10003161 3300005458 Bacteria 15318
19 Ga0070706_100003348 3300005467 Bacteria 15809
20 Ga0070706_100009330 3300005467 Bacteria 9142
21 Ga0070706_100054063 3300005467 Bacteria 3707
22 Ga0070706_100233912 3300005467 Bacteria 1715
23 Ga0070707_100001308 3300005468 Bacteria 24490
24 Ga0070707_100006787 3300005468 Bacteria 10596
25 Ga0070707_100110102 3300005468 Bacteria 2671
26 Ga0070707_100269753 3300005468 Bacteria 1655
27 Ga0070707_101180918 3300005468 Bacteria 731
28 Ga0070698_100003815 3300005471 Bacteria 16551
29 Ga0070698_100010866 3300005471 Bacteria 9686
30 Ga0070698_100068528 3300005471 Bacteria 3565
31 Ga0070699_100183846 3300005518 Bacteria 1855
32 Ga0070699_101229024 3300005518 Bacteria 687
33 Ga0070679_100219360 3300005530 Bacteria 1863
34 Ga0070697_100166192 3300005536 Bacteria 1866
35 Ga0070717_10118266 3300006028 Bacteria 2268
36 Ga0070717_10171755 3300006028 Bacteria 1886
37 Ga0075365_10341262 3300006038 Bacteria 1056
38 Ga0075363_100035582 3300006048 Bacteria 2607
39 Ga0075364_10011660 3300006051 Bacteria 5345
40 Ga0075362_10152923 3300006177 Bacteria 1108
41 Ga0075362_10167976 3300006177 Bacteria 1059
42 Ga0075369_10060161 3300006186 Bacteria 1656
43 Ga0075370_10015135 3300006353 Bacteria 4123
44 Ga0075370_10564653 3300006353 Bacteria 689
45 Ga0075428_100000178 3300006844 Bacteria 59510
46 Ga0075428_101658965 3300006844 Bacteria 668
47 Ga0075430_100036551 3300006846 Bacteria 4164
48 Ga0075431_100151383 3300006847 Bacteria 2389
49 Ga0075431_100817808 3300006847 Bacteria 904
50 Ga0075433_10072023 3300006852 Bacteria 3038
51 Ga0075434_100033300 3300006871 Bacteria 5085
52 Ga0075429_100133410 3300006880 Bacteria 2172
53 Ga0075435_100004385 3300007076 Bacteria 9686
54 Ga0075435_101348240 3300007076 Bacteria 625
55 Ga0105240_11984621 3300009093 Unclassified 605
56 Ga0111539_10388380 3300009094 Bacteria 1625
57 Ga0114129_10577472 3300009147 Bacteria 1459
58 Ga0114129_12226984 3300009147 Bacteria 659
59 Ga0105248_10120406 3300009177 Bacteria 2961
60 Ga0105249_10000057 3300009553 Bacteria 159358
61 Ga0105249_10286498 3300009553 Bacteria 1647
62 Ga0157369_10096640 3300013105 Bacteria 3151
63 Ga0163162_10379549 3300013306 Bacteria 1547
64 Ga0163162_13181554 3300013306 Bacteria 527
65 Ga0157372_10974635 3300013307 Unclassified 982
66 Ga0163163_10952307 3300014325 Bacteria 922
67 Ga0157379_10067463 3300014968 Bacteria 3197
68 Ga0157376_11269366 3300014969 Bacteria 766
69 Ga0157376_12131284 3300014969 Bacteria 599
70 Ga0197907_10483056 3300020069 Bacteria 818
71 Ga0206349_1087532 3300020075 Bacteria 568
72 Ga0206355_1624904 3300020076 Bacteria 554
73 Ga0206350_10837335 3300020080 Bacteria 594
74 Ga0206354_11289520 3300020081 Bacteria 9198
75 Ga0154015_1269925 3300020610 Bacteria 1340
76 Ga0213874_10028769 3300021377 Unclassified 1590
77 Ga0213874_10321717 3300021377 Bacteria 587
78 Ga0213875_10031028 3300021388 Bacteria 2530
79 Ga0213875_10496149 3300021388 Unclassified 586
80 Ga0213871_10063161 3300021441 Bacteria 1035
81 Ga0224712_10141113 3300022467 Bacteria 1060
82 Ga0228598_1056202 3300024227 Bacteria 782
83 Ga0209051_1000620 3300025303 Bacteria 40785
84 Ga0209051_1017019 3300025303 Bacteria 3264
85 Ga0207705_10001750 3300025909 Bacteria 17159
86 Ga0207705_10200123 3300025909 Bacteria 1513
87 Ga0207684_10001900 3300025910 Bacteria 21709
88 Ga0207684_10063379 3300025910 Bacteria 3139
89 Ga0207684_10102616 3300025910 Bacteria 2446
90 Ga0207684_10285518 3300025910 Bacteria 1423
91 Ga0207707_10000518 3300025912 Bacteria 39471
92 Ga0207695_11463757 3300025913 Bacteria 563
93 Ga0207660_10005241 3300025917 Bacteria 8422
94 Ga0207652_10001576 3300025921 Bacteria 20064
95 Ga0207646_10000315 3300025922 Bacteria 65468
96 Ga0207646_10106616 3300025922 Bacteria 2514
97 Ga0207646_10199831 3300025922 Bacteria 1806
98 Ga0207646_10826895 3300025922 Bacteria 824
99 Ga0207650_10844215 3300025925 Bacteria 777
100 Ga0207687_11563886 3300025927 Bacteria 566
101 Ga0207670_10703647 3300025936 Bacteria 836
102 Ga0207711_10076701 3300025941 Bacteria 2911
103 Ga0207711_10482859 3300025941 Bacteria 1154
104 Ga0207667_10517047 3300025949 Bacteria 1209
105 Ga0207651_10592713 3300025960 Bacteria 968
106 Ga0207651_11351335 3300025960 Bacteria 641
107 Ga0207712_10225490 3300025961 Bacteria 1501
108 Ga0207668_10000447 3300025972 Bacteria 26094
109 Ga0207708_11859754 3300026075 Bacteria 528
110 Ga0209813_10156659 3300027866 Bacteria 819
111 Ga0307408_100119490 3300031548 Bacteria 2039
112 Ga0307406_11912375 3300031901 Bacteria 529
113 Ga0307415_101002091 3300032126 Bacteria 776
114 Ga0373943_0132761 3300035170 Bacteria 1334
115 Ga0373935_1219881 3300035692 Bacteria 561
116 Ga0373933_1154036 3300035724 Bacteria 511
117 Ga0373947_0666077 3300035725 Unclassified 710
118 Ga0373937_0021762 3300036401 Bacteria 5756
119 Ga0373925_0078229 3300037068 Bacteria 2511
120 Ga0395898_1340877 3300037466 Bacteria 644
121 Ga0436364_0161835 3300037853 Unclassified 2116
122 Ga0436364_0249455 3300037853 Unclassified 861
123 Ga0436364_0476274 3300037853 Bacteria 4077
124 Ga0436364_0597198 3300037853 Bacteria 541
125 Ga0436364_1227949 3300037853 Bacteria 2322
126 Ga0436361_1006667 3300039447 Bacteria 1224
127 Ga0436363_0805777 3300039450 Bacteria 1101
128 Ga0436363_1632484 3300039450 Bacteria 565
129 Ga0436363_1683302 3300039450 Unclassified 1816
130 Ga0436363_1719089 3300039450 Bacteria 1125
131 Ga0436362_0659429 3300039453 Bacteria 1466
132 Ga0436362_1201762 3300039453 Unclassified 821
133 Ga0451787_687421 3300041441 Bacteria 744
134 Ga0451789_0804212 3300041443 Bacteria 1324
135 Ga0451793_1914026 3300041452 Bacteria 1467
136 Ga0451795_1236334 3300041456 Bacteria 1585
137 Ga0451802_0673955 3300041460 Bacteria 1159
138 Ga0451855_0334087 3300041511 Bacteria 1465
139 Ga0451853_3703846 3300041512 Bacteria 1049
140 Ga0466966_0165394 3300044684 Bacteria 1346
141 Ga0466966_0675057 3300044684 Unclassified 622
142 Ga0466961_0077791 3300044693 Bacteria 2101
143 Ga0466963_0002306 3300044694 Bacteria 10616
144 Ga0466963_0058773 3300044694 Bacteria 2565
145 Ga0466963_0214861 3300044694 Bacteria 1346
146 Ga0466963_0622548 3300044694 Bacteria 762
147 Ga0466964_0033930 3300044706 Bacteria 2035
148 Ga0466964_0918389 3300044706 Bacteria 502
149 Ga0466968_0583915 3300044735 Unclassified 563
150 Ga0466970_0363807 3300044765 Bacteria 822
151 Ga0466957_0001723 3300044842 Bacteria 11511
152 Ga0466957_0150370 3300044842 Bacteria 1505
153 Ga0466960_0060281 3300044901 Bacteria 1859
154 Ga0466958_0126837 3300045836 Bacteria 1600
155 Ga0466958_0533661 3300045836 Unclassified 762
156 Ga0466967_0038363 3300045976 Bacteria 4108
157 Ga0466967_0082819 3300045976 Bacteria 2900
158 Ga0466967_0519711 3300045976 Bacteria 1170
159 Ga0495651_0100510 3300046462 Bacteria 2154
160 Ga0495653_0789618 3300046463 Bacteria 571
161 Ga0495650_0157649 3300046471 Bacteria 811
162 Ga0495608_0154098 3300046511 Bacteria 1463
163 Ga0495628_0062300 3300046516 Bacteria 2924
164 Ga0495630_0028643 3300046517 Bacteria 4138
165 Ga0495640_0661747 3300046533 Bacteria 628
166 Ga0495587_0142038 3300046536 Bacteria 1370
167 Ga0495667_0044801 3300046559 Bacteria 2929
168 Ga0495625_0589514 3300046660 Unclassified 668
169 Ga0495635_0476518 3300046663 Bacteria 823
170 Ga0495623_0029681 3300046679 Bacteria 3519
171 Ga0495647_0160053 3300046681 Bacteria 970
172 Ga0495613_0035421 3300046689 Bacteria 3704
173 Ga0495624_0544933 3300046690 Unclassified 693
174 Ga0495581_0580389 3300047315 Bacteria 650
175 Ga0495581_0813999 3300047315 Bacteria 535
176 Ga0495604_0209310 3300047317 Bacteria 1348
177 Ga0495674_0182172 3300047319 Bacteria 1749
178 Ga0495674_0908721 3300047319 Bacteria 679
179 Ga0495676_1110976 3300047321 Unclassified 502
180 Ga0495680_0020247 3300047322 Bacteria 5601
181 Ga0495680_1084392 3300047322 Bacteria 507
182 Ga0495675_0024476 3300047444 Bacteria 3849
183 Ga0495686_0000637 3300047472 Bacteria 48296
184 Ga0495614_0263426 3300048089 Bacteria 791
185 Ga0495626_0042821 3300048091 Bacteria 2126
186 Ga0496104_0292391 3300048907 Bacteria 1542
187 Ga0496104_0758987 3300048907 Bacteria 877
188 Ga0496108_0819260 3300048911 Bacteria 802
189 Ga0496109_0291008 3300048912 Bacteria 1540
190 Ga0496111_0329594 3300048914 Bacteria 1130
191 Ga0496112_0970468 3300048915 Bacteria 770
192 Ga0496121_0226927 3300048924 Bacteria 1311
193 Ga0501032_0001919 3300049569 Bacteria 16383
194 Ga0501034_0058227 3300049571 Bacteria 3883
195 Ga0501037_0000657 3300049573 Bacteria 26558
196 Ga0501038_0000998 3300049574 Bacteria 25472
197 Ga0501039_0001502 3300049575 Bacteria 17170
198 Ga0501043_0000878 3300049579 Bacteria 26679
199 Ga0501047_1210767 3300049581 Bacteria 569
200 Ga0501067_0190830 3300049583 Bacteria 1141
201 Ga0501070_0003321 3300049586 Bacteria 13972
202 Ga0501070_1081925 3300049586 Bacteria 619
203 Ga0501080_0964214 3300049742 Bacteria 741
204 Ga0501044_0323998 3300049823 Bacteria 1465
205 nmdc:mga03n38_65934_c1 3300050490 Bacteria 1662
206 nmdc:mga00v17_46963_c1 3300050491 Bacteria 2614
207 nmdc:mga0yw44_103160_c1 3300050492 Bacteria 1819
208 nmdc:mga04h51_38299_c1 3300050495 Bacteria 1552
209 nmdc:mga07m45_264394_c1 3300050496 Bacteria 1001
210 nmdc:mga07m45_50103_c1 3300050496 Bacteria 2060
211 nmdc:mga05p37_253509_c1 3300050507 Bacteria 2110
212 nmdc:mga0qj67_369823_c1 3300050509 Bacteria 1158
213 nmdc:mga06r32_1223558_c1 3300050510 Bacteria 697
214 nmdc:mga06r32_230050_c1 3300050510 Bacteria 1842
215 nmdc:mga08y16_286537_c1 3300050511 Bacteria 1698
216 nmdc:mga0n895_116652_c1 3300050512 Bacteria 2689
217 nmdc:mga0rr50_243993_c1 3300050513 Bacteria 1490
218 nmdc:mga0a205_88138_c1 3300050515 Bacteria 2999
219 nmdc:mga0sz30_377741_c1 3300050516 Bacteria 634
220 nmdc:mga0sz30_68539_c1 3300050516 Bacteria 1243
221 Ga0500610_0059613 3300053079 Unclassified 1991
222 Ga0495595_0013171 3300053084 Bacteria 3489
223 Ga0495619_0008138 3300053085 Bacteria 6635
224 Ga0495619_0733097 3300053085 Bacteria 671
225 Ga0500556_0006215 3300053104 Bacteria 3385
226 Ga0500562_003113 3300053108 Bacteria 4141
227 Ga0500616_0001120 3300053153 Bacteria 27623
228 Ga0500616_0041149 3300053153 Bacteria 2481
229 Ga0500627_0197282 3300053158 Unclassified 903
230 2739206268 2738543005 Bacteria 5278128
231 2902842216 2902837492 Bacteria 6697721
232 2928147251 2928142448 Bacteria 5288925
233 Ga0495638_0002120
234 Ga0006778J45830_1021700
235 Ga0006759J45824_1090532
236 Ga0006777J48905_1075965
237 Ga0007429J51699_1015039
238 Ga0055540_1003264
239 Ga0070658_10093899
240 Ga0070670_100386155
241 Ga0070680_100000303
242 Ga0070660_100597752
243 Ga0070689_101321389
244 Ga0070668_100013619
245 Ga0070673_100352110
246 Ga0070673_101571842
247 Ga0070659_101033357
248 Ga0070713_100198663
249 Ga0070708_100000196
250 Ga0070681_10003161
251 Ga0070706_100003348
252 Ga0070706_100009330
253 Ga0070706_100054063
254 Ga0070706_100233912
255 Ga0070707_100001308
256 Ga0070707_100006787
257 Ga0070707_100110102
258 Ga0070707_100269753
259 Ga0070707_101180918
260 Ga0070698_100003815
261 Ga0070698_100010866
262 Ga0070698_100068528
263 Ga0070699_100183846
264 Ga0070699_101229024
265 Ga0070679_100219360
266 Ga0070697_100166192
267 Ga0070717_10118266
268 Ga0070717_10171755
269 Ga0075365_10341262
270 Ga0075363_100035582
271 Ga0075364_10011660
272 Ga0075362_10152923
273 Ga0075362_10167976
274 Ga0075369_10060161
275 Ga0075370_10015135
276 Ga0075370_10564653
277 Ga0075428_100000178
278 Ga0075428_101658965
279 Ga0075430_100036551
280 Ga0075431_100151383
281 Ga0075431_100817808
282 Ga0075433_10072023
283 Ga0075434_100033300
284 Ga0075429_100133410
285 Ga0075435_100004385
286 Ga0075435_101348240
287 Ga0105240_11984621
288 Ga0111539_10388380
289 Ga0114129_10577472
290 Ga0114129_12226984
291 Ga0105248_10120406
292 Ga0105249_10000057
293 Ga0105249_10286498
294 Ga0157369_10096640
295 Ga0163162_10379549
296 Ga0163162_13181554
297 Ga0157372_10974635
298 Ga0163163_10952307
299 Ga0157379_10067463
300 Ga0157376_11269366
301 Ga0157376_12131284
302 Ga0197907_10483056
303 Ga0206349_1087532
304 Ga0206355_1624904
305 Ga0206350_10837335
306 Ga0206354_11289520
307 Ga0154015_1269925
308 Ga0213874_10028769
309 Ga0213874_10321717
310 Ga0213875_10031028
311 Ga0213875_10496149
312 Ga0213871_10063161
313 Ga0224712_10141113
314 Ga0228598_1056202
315 Ga0209051_1000620
316 Ga0209051_1017019
317 Ga0207705_10001750
318 Ga0207705_10200123
319 Ga0207684_10001900
320 Ga0207684_10063379
321 Ga0207684_10102616
322 Ga0207684_10285518
323 Ga0207707_10000518
324 Ga0207695_11463757
325 Ga0207660_10005241
326 Ga0207652_10001576
327 Ga0207646_10000315
328 Ga0207646_10106616
329 Ga0207646_10199831
330 Ga0207646_10826895
331 Ga0207650_10844215
332 Ga0207687_11563886
333 Ga0207670_10703647
334 Ga0207711_10076701
335 Ga0207711_10482859
336 Ga0207667_10517047
337 Ga0207651_10592713
338 Ga0207651_11351335
339 Ga0207712_10225490
340 Ga0207668_10000447
341 Ga0207708_11859754
342 Ga0209813_10156659
343 Ga0307408_100119490
344 Ga0307406_11912375
345 Ga0307415_101002091
346 Ga0373943_0132761
347 Ga0373935_1219881
348 Ga0373933_1154036
349 Ga0373947_0666077
350 Ga0373937_0021762
351 Ga0373925_0078229
352 Ga0395898_1340877
353 Ga0436364_0161835
354 Ga0436364_0249455
355 Ga0436364_0476274
356 Ga0436364_0597198
357 Ga0436364_1227949
358 Ga0436361_1006667
359 Ga0436363_0805777
360 Ga0436363_1632484
361 Ga0436363_1683302
362 Ga0436363_1719089
363 Ga0436362_0659429
364 Ga0436362_1201762
365 Ga0451787_687421
366 Ga0451789_0804212
367 Ga0451793_1914026
368 Ga0451795_1236334
369 Ga0451802_0673955
370 Ga0451855_0334087
371 Ga0451853_3703846
372 Ga0466966_0165394
373 Ga0466966_0675057
374 Ga0466961_0077791
375 Ga0466963_0002306
376 Ga0466963_0058773
377 Ga0466963_0214861
378 Ga0466963_0622548
379 Ga0466964_0033930
380 Ga0466964_0918389
381 Ga0466968_0583915
382 Ga0466970_0363807
383 Ga0466957_0001723
384 Ga0466957_0150370
385 Ga0466960_0060281
386 Ga0466958_0126837
387 Ga0466958_0533661
388 Ga0466967_0038363
389 Ga0466967_0082819
390 Ga0466967_0519711
391 Ga0495651_0100510
392 Ga0495653_0789618
393 Ga0495650_0157649
394 Ga0495608_0154098
395 Ga0495628_0062300
396 Ga0495630_0028643
397 Ga0495640_0661747
398 Ga0495587_0142038
399 Ga0495667_0044801
400 Ga0495625_0589514
401 Ga0495635_0476518
402 Ga0495623_0029681
403 Ga0495647_0160053
404 Ga0495613_0035421
405 Ga0495624_0544933
406 Ga0495581_0580389
407 Ga0495581_0813999
408 Ga0495604_0209310
409 Ga0495674_0182172
410 Ga0495674_0908721
411 Ga0495676_1110976
412 Ga0495680_0020247
413 Ga0495680_1084392
414 Ga0495675_0024476
415 Ga0495686_0000637
416 Ga0495614_0263426
417 Ga0495626_0042821
418 Ga0496104_0292391
419 Ga0496104_0758987
420 Ga0496108_0819260
421 Ga0496109_0291008
422 Ga0496111_0329594
423 Ga0496112_0970468
424 Ga0496121_0226927
425 Ga0501032_0001919
426 Ga0501034_0058227
427 Ga0501037_0000657
428 Ga0501038_0000998
429 Ga0501039_0001502
430 Ga0501043_0000878
431 Ga0501047_1210767
432 Ga0501067_0190830
433 Ga0501070_0003321
434 Ga0501070_1081925
435 Ga0501080_0964214
436 Ga0501044_0323998
437 nmdc:mga03n38_65934_c1
438 nmdc:mga00v17_46963_c1
439 nmdc:mga0yw44_103160_c1
440 nmdc:mga04h51_38299_c1
441 nmdc:mga07m45_264394_c1
442 nmdc:mga07m45_50103_c1
443 nmdc:mga05p37_253509_c1
444 nmdc:mga0qj67_369823_c1
445 nmdc:mga06r32_1223558_c1
446 nmdc:mga06r32_230050_c1
447 nmdc:mga08y16_286537_c1
448 nmdc:mga0n895_116652_c1
449 nmdc:mga0rr50_243993_c1
450 nmdc:mga0a205_88138_c1
451 nmdc:mga0sz30_377741_c1
452 nmdc:mga0sz30_68539_c1
453 Ga0500610_0059613
454 Ga0495595_0013171
455 Ga0495619_0008138
456 Ga0495619_0733097
457 Ga0500556_0006215
458 Ga0500562_003113
459 Ga0500616_0001120
460 Ga0500616_0041149
461 Ga0500627_0197282
462 2739206268
463 2902842216
464 2928147251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

148

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.8008 6 132
6xck-assembly3.cif.gz_A crystal structure of c-as lyase with mutation k105e 0.7862 9 129
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.781 1 132
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.7757 1 132
5c68-assembly1.cif.gz_A crystal structure of c-as lyase at 1.46 angstroms resolution 0.7692 9 129
ID Description Score Start End Superfamily
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8727 78 132 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8333 78 132 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8172 78 127 3.30.720.110
1zswA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8058 1 132 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8017 6 129 3.10.180.10
ID Description Score Start End GO Terms
AF-F7XDS5-F1-model_v4 VOC domain-containing protein 0.9489 80 129
AF-A0A7Z9IH33-F1-model_v4 VOC domain-containing protein 0.9442 80 129
AF-A0A1I4JAY9-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein 0.9401 80 129 GO:0051213
AF-A0A4V1UQS3-F1-model_v4 Ring-cleaving dioxygenase 0.9386 80 129 GO:0051213
AF-A0A4S4C5E1-F1-model_v4 Uncharacterized protein 0.9361 78 129

Map