F345192

General Info

Members Datasets Scaffolds Average Seq Length
232 174 222 797

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10000565|Ga0265328_100005656
Length 833
Sequence MTNTWMDIKNANVILVMGGNAAEAHPVGFKWVIEAKAHNKAKLIVVDPRFNRTASVADYYAPIRSGTDIAFLNGVIRYLLEKGQIQQDYVQAYTNAPFIVREDFDFNDGLFSGYDEKEHKYDKSSWAYELDDKGFAKVDPTLKNPRCVINLLKHHVERYTPEMVSNITGTPQKQFLEICEMLASTAAPDRTLTSLYALGWTQHSVGAQNIRALAMLQLLLGNIGMPGGGVNALRGHSNIQGLSDLGLMSDLLPGYMTMHKDDDVDRATYLDKRTPKLLRPGQMNYFVNYPKFHTSLMKAWYGPAATKENDFAYDWMPKLDKVYDGLRVFDMMHEGKFTGYFCQGFNPLASFPNKNKLSESLSKLRFLVVMDPLATETSEFWKSYGESNDVDPSKIQTEVFRLPTTLFAEEEGALVNSSRWLQWHWKGAEAPGECRTDIAIMSDLFLKLRGMYAKDGGAFPDPILNLYWPYHDAGEPTPEELAKEYNGRALADIMDPKDATKVLIKAGQQLSSFAQLADDGSTSCGTWIFNQMARRETADPSGLGIAPGWAXXXPLNRRILYNRASCDVAGKPWDAKRKLISWDGAKWGGYDVPDFKADVPPGDPMSPFIMTNEGVGRLFALDKMAEGPFPEHYEPFENPLGTNLLHPKVISNPAARVFPKDREHFGTNEAFPYVGTTYRLTEHFHFWTKHSKINASLQPEQFVEIGEELAKAKGIENGERVVVSSKRGYIKAVAVVTKRIKALDVGGKRIHQIGVPIHWGFTGAAKQGYLANTLTPFVGDANTQTPEFKSFLVNLEKDDGSKPKLVEPAPEKQAKADDIDLSRRGWLFGRRDT

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2721755523 Delftia sp. HK171 Isolate Unclassified
3 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
4 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
5 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
6 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
7 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
8 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
9 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
10 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
95 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
166 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
172 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
173 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
174 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.69
Metatranscriptomes 0
Isolates 4.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.84
Nodule 0.86
Rhizoplane 4.74
Rhizosphere 62.5
Stem 0
Stem Tuber 0
Unclassified 9.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000655 3300002067 Bacteria 12239
2 JGI25162J39368_1000032 3300002737 Bacteria 195871
3 JGI25165J46597_1000067 3300003214 Bacteria 196411
4 Ga0055538_1000033 3300003751 Bacteria 195914
5 Ga0055539_1000045 3300003752 Bacteria 195316
6 Ga0055533_1000054 3300003756 Bacteria 195914
7 Ga0055533_1000808 3300003756 Bacteria 9751
8 Ga0055525_1000065 3300003759 Bacteria 195779
9 Ga0055537_1003813 3300003773 Bacteria 4515
10 Ga0055524_1000509 3300003775 Bacteria 30057
11 Ga0055536_1000159 3300003781 Bacteria 58702
12 Ga0055541_1000031 3300003841 Bacteria 195914
13 Ga0070670_100000745 3300005331 Bacteria 25289
14 Ga0070667_100000012 3300005367 Bacteria 258575
15 Ga0070713_100012485 3300005436 Bacteria 6233
16 Ga0070663_100000630 3300005455 Bacteria 18912
17 Ga0070698_100005136 3300005471 Bacteria 14329
18 Ga0068853_100003185 3300005539 Bacteria 12532
19 Ga0068853_100014297 3300005539 Bacteria 6495
20 Ga0070665_100000095 3300005548 Bacteria 170459
21 Ga0070665_100031439 3300005548 Bacteria 5344
22 Ga0068859_100009189 3300005617 Bacteria 9981
23 Ga0068862_100035484 3300005844 Bacteria 4224
24 Ga0070717_10015173 3300006028 Bacteria 5943
25 Ga0075368_10000471 3300006042 Bacteria 11930
26 Ga0075364_10013043 3300006051 Bacteria 5100
27 Ga0070712_100015938 3300006175 Bacteria 4848
28 Ga0097620_100009189 3300006931 Bacteria 9981
29 Ga0079104_1000011 3300006946 Bacteria 359962
30 Ga0105251_10001383 3300009011 Bacteria 20991
31 Ga0105240_10103908 3300009093 Bacteria 3451
32 Ga0105243_10000661 3300009148 Bacteria 34076
33 Ga0105248_10000468 3300009177 Bacteria 45955
34 Ga0105248_10019798 3300009177 Bacteria 7454
35 Ga0105248_10059877 3300009177 Bacteria 4277
36 Ga0105237_10006809 3300009545 Bacteria 12602
37 Ga0105238_10111166 3300009551 Bacteria 2721
38 Ga0105249_10000469 3300009553 Bacteria 37523
39 Ga0105239_10060928 3300010375 Bacteria 4142
40 Ga0163162_10001890 3300013306 Bacteria 19727
41 Ga0183368_1002 3300015687 Bacteria 1865598
42 Ga0213872_10000564 3300021361 Bacteria 28670
43 Ga0213872_10004254 3300021361 Bacteria 7674
44 Ga0213876_10013098 3300021384 Bacteria 4406
45 Ga0209784_100048 3300025224 Bacteria 198885
46 Ga0209566_100060 3300025225 Bacteria 198885
47 Ga0209674_100014 3300025226 Bacteria 704989
48 Ga0209674_100082 3300025226 Bacteria 198885
49 Ga0209563_100082 3300025230 Bacteria 198750
50 Ga0207427_100378 3300025231 Bacteria 26906
51 Ga0209437_100125 3300025233 Bacteria 198146
52 Ga0209258_101822 3300025242 Bacteria 6520
53 Ga0209677_100046 3300025253 Bacteria 198287
54 Ga0209233_1000138 3300025261 Bacteria 198287
55 Ga0209565_1000094 3300025263 Bacteria 134853
56 Ga0209565_1002363 3300025263 Bacteria 6872
57 Ga0209675_1000079 3300025291 Bacteria 155554
58 Ga0209675_1003760 3300025291 Bacteria 7026
59 Ga0209676_1000576 3300025292 Bacteria 55231
60 Ga0209564_1000166 3300025295 Bacteria 160208
61 Ga0209564_1000308 3300025295 Bacteria 96489
62 Ga0209758_1005845 3300025297 Bacteria 9189
63 Ga0209256_1000905 3300025299 Bacteria 36349
64 Ga0209256_1002412 3300025299 Bacteria 15325
65 Ga0209051_1001060 3300025303 Bacteria 25669
66 Ga0209051_1005358 3300025303 Bacteria 7532
67 Ga0209051_1009332 3300025303 Bacteria 5068
68 Ga0207713_1002356 3300025735 Bacteria 13840
69 Ga0207647_10007898 3300025904 Bacteria 7651
70 Ga0207695_10039794 3300025913 Bacteria 5049
71 Ga0207671_10007763 3300025914 Bacteria 9240
72 Ga0207700_10062143 3300025928 Bacteria 2836
73 Ga0207709_10000074 3300025935 Bacteria 174947
74 Ga0207711_10000406 3300025941 Bacteria 45644
75 Ga0207711_10038926 3300025941 Bacteria 4043
76 Ga0207712_10001383 3300025961 Bacteria 16608
77 Ga0207658_10000027 3300025986 Bacteria 174626
78 Ga0207678_10000258 3300026067 Bacteria 48084
79 Ga0209281_1000005 3300027111 Bacteria 1242284
80 Ga0209813_10000541 3300027866 Bacteria 8923
81 Ga0268266_10000001 3300028379 Bacteria 4040580
82 Ga0268266_10051223 3300028379 Bacteria 3544
83 Ga0268265_10000158 3300028380 Bacteria 83123
84 Ga0268265_10009023 3300028380 Bacteria 6746
85 Ga0265338_10002184 3300028800 Bacteria 30002
86 Ga0265338_10034916 3300028800 Bacteria 4847
87 Ga0265328_10000565 3300031239 Bacteria 17186
88 Ga0265339_10002468 3300031249 Bacteria 13229
89 Ga0265331_10000030 3300031250 Bacteria 215032
90 Ga0265327_10000072 3300031251 Bacteria 215055
91 Ga0265342_10000039 3300031712 Bacteria 140091
92 Ga0373925_0056790 3300037068 Bacteria 2933
93 Ga0395900_0014877 3300037418 Bacteria 7929
94 Ga0395905_0024623 3300037471 Bacteria 5678
95 Ga0436365_0760767 3300039437 Bacteria 27378
96 Ga0436361_0131723 3300039447 Bacteria 18618
97 Ga0436361_0507032 3300039447 Bacteria 49226
98 Ga0436361_0629455 3300039447 Bacteria 4021
99 Ga0436361_0908905 3300039447 Bacteria 4848
100 Ga0439465_0000670 3300041413 Bacteria 10457
101 Ga0453684_0000005 3300044712 Bacteria 1431632
102 Ga0453684_0003131 3300044712 Bacteria 38095
103 Ga0451576_0007575 3300045051 Bacteria 12935
104 Ga0495603_0000139 3300046455 Bacteria 36220
105 Ga0495590_0000634 3300046457 Bacteria 16318
106 Ga0495591_000713 3300046458 Bacteria 24121
107 Ga0495629_0000663 3300046459 Bacteria 27810
108 Ga0495629_0004597 3300046459 Bacteria 10331
109 Ga0495629_0010710 3300046459 Bacteria 6668
110 Ga0495638_0028124 3300046460 Bacteria 3632
111 Ga0495651_0008833 3300046462 Bacteria 7731
112 Ga0495653_0001022 3300046463 Bacteria 21574
113 Ga0495653_0012736 3300046463 Bacteria 6869
114 Ga0495653_0021981 3300046463 Bacteria 5162
115 Ga0495650_0002531 3300046471 Bacteria 14603
116 Ga0495580_0003791 3300046472 Bacteria 12807
117 Ga0495580_0008906 3300046472 Bacteria 7936
118 Ga0495664_0017430 3300046477 Bacteria 4105
119 Ga0495606_0006983 3300046507 Bacteria 10261
120 Ga0495608_0001033 3300046511 Bacteria 19551
121 Ga0495618_0002415 3300046514 Bacteria 12008
122 Ga0495628_0000457 3300046516 Bacteria 37378
123 Ga0495628_0005433 3300046516 Bacteria 11159
124 Ga0495628_0005694 3300046516 Bacteria 10912
125 Ga0495630_0025307 3300046517 Bacteria 4387
126 Ga0495648_0004824 3300046524 Bacteria 11380
127 Ga0495666_0000229 3300046526 Bacteria 23906
128 Ga0495666_0003981 3300046526 Bacteria 7472
129 Ga0495642_0016580 3300046528 Bacteria 2873
130 Ga0495652_0001464 3300046529 Bacteria 26081
131 Ga0495652_0001621 3300046529 Bacteria 24558
132 Ga0495652_0021615 3300046529 Bacteria 5718
133 Ga0495665_0000139 3300046531 Bacteria 35407
134 Ga0495665_0011764 3300046531 Bacteria 4741
135 Ga0495640_0007580 3300046533 Bacteria 8525
136 Ga0495640_0029472 3300046533 Bacteria 3941
137 Ga0495586_0000124 3300046535 Bacteria 47092
138 Ga0495586_0007881 3300046535 Bacteria 5678
139 Ga0495587_0007825 3300046536 Bacteria 6905
140 Ga0495587_0026526 3300046536 Bacteria 3533
141 Ga0495597_0007251 3300046542 Bacteria 5650
142 Ga0495645_0032253 3300046543 Bacteria 3820
143 Ga0495645_0036777 3300046543 Bacteria 3568
144 Ga0495667_0073139 3300046559 Bacteria 2233
145 Ga0495634_0006812 3300046642 Bacteria 8648
146 Ga0495661_0006341 3300046665 Bacteria 8319
147 Ga0495661_0012617 3300046665 Bacteria 5702
148 Ga0495599_0018796 3300046678 Bacteria 4308
149 Ga0495623_0005035 3300046679 Bacteria 8668
150 Ga0495623_0011565 3300046679 Bacteria 5714
151 Ga0495646_0013417 3300046680 Bacteria 5210
152 Ga0495613_0005900 3300046689 Bacteria 9169
153 Ga0495613_0007348 3300046689 Bacteria 8208
154 Ga0495613_0011637 3300046689 Bacteria 6540
155 Ga0495624_0003578 3300046690 Bacteria 11505
156 Ga0495589_0000759 3300046794 Bacteria 20588
157 Ga0495589_0007957 3300046794 Bacteria 5549
158 Ga0495600_0004452 3300046809 Bacteria 8384
159 Ga0495604_0018576 3300047317 Bacteria 5569
160 Ga0495676_0049688 3300047321 Bacteria 3369
161 Ga0495680_0001071 3300047322 Bacteria 30324
162 Ga0495680_0005720 3300047322 Bacteria 11643
163 Ga0495683_0003408 3300047323 Bacteria 9278
164 Ga0495683_0003502 3300047323 Bacteria 9136
165 Ga0495687_000121 3300047443 Bacteria 120336
166 Ga0495675_0016523 3300047444 Bacteria 4668
167 Ga0495675_0030555 3300047444 Bacteria 3437
168 Ga0495675_0031401 3300047444 Bacteria 3391
169 Ga0495679_000269 3300047446 Bacteria 43503
170 Ga0495679_001522 3300047446 Bacteria 13086
171 Ga0495686_0000370 3300047472 Bacteria 73065
172 Ga0495686_0010395 3300047472 Bacteria 6623
173 Ga0495593_0001753 3300047673 Bacteria 12846
174 Ga0495593_0002072 3300047673 Bacteria 11973
175 Ga0495593_0016297 3300047673 Bacteria 4193
176 Ga0495602_0000446 3300048088 Bacteria 38693
177 Ga0495602_0000614 3300048088 Bacteria 33492
178 Ga0495602_0018110 3300048088 Bacteria 7046
179 Ga0495614_0000125 3300048089 Bacteria 26649
180 Ga0496102_0026611 3300048905 Bacteria 5162
181 Ga0496103_0011269 3300048906 Bacteria 5294
182 Ga0496105_0006555 3300048908 Bacteria 8955
183 Ga0496107_0005731 3300048910 Bacteria 8501
184 Ga0496110_0009100 3300048913 Bacteria 8015
185 Ga0496112_0017831 3300048915 Bacteria 6681
186 Ga0496113_0032387 3300048916 Bacteria 3800
187 Ga0496114_0003936 3300048917 Bacteria 11456
188 Ga0496114_0028227 3300048917 Bacteria 4603
189 Ga0496115_0000379 3300048918 Bacteria 36717
190 Ga0496115_0001104 3300048918 Bacteria 19472
191 Ga0496117_0004268 3300048920 Bacteria 15934
192 Ga0496118_0000198 3300048921 Bacteria 105857
193 Ga0496118_0021355 3300048921 Bacteria 5700
194 Ga0496121_0031420 3300048924 Bacteria 4851
195 Ga0496122_0001667 3300048925 Bacteria 34447
196 Ga0496122_0013402 3300048925 Bacteria 8028
197 Ga0496123_0000107 3300048926 Bacteria 166923
198 Ga0496124_0011488 3300048927 Bacteria 8848
199 Ga0496125_0034877 3300048928 Bacteria 4426
200 Ga0496126_0000032 3300048929 Bacteria 372456
201 Ga0496126_0002439 3300048929 Bacteria 25116
202 Ga0496126_0010474 3300048929 Bacteria 9714
203 Ga0501046_0012775 3300049580 Bacteria 7143
204 Ga0501048_0001473 3300049582 Bacteria 17844
205 Ga0501075_0007070 3300049591 Bacteria 7755
206 Ga0501044_0116194 3300049823 Bacteria 2681
207 nmdc:mga06z11_307_c1 3300050494 Bacteria 18616
208 nmdc:mga04h51_542_c1 3300050495 Bacteria 8991
209 Ga0500643_001109 3300053087 Bacteria 16124
210 Ga0500651_0001244 3300053093 Bacteria 12675
211 Ga0500566_0000080 3300053094 Bacteria 47299
212 Ga0500640_000072 3300053095 Bacteria 16616
213 Ga0500572_000408 3300053111 Bacteria 15091
214 Ga0500595_000078 3300053119 Bacteria 68089
215 Ga0500595_000240 3300053119 Bacteria 37131
216 Ga0500597_000135 3300053120 Bacteria 14916
217 Ga0500559_0005289 3300053136 Bacteria 5945
218 Ga0500568_0000299 3300053139 Bacteria 40229
219 Ga0500603_000064 3300053150 Bacteria 24659
220 Ga0500630_000172 3300053159 Bacteria 24102
221 Ga0500639_000017 3300053163 Bacteria 114464
222 Ga0500645_000486 3300053730 Bacteria 26878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046559 Ga0495667_0073139 Ga0495667_0073139_230_2206 658
2 3300046472 Ga0495580_0008906 Ga0495580_0008906_4838_6862 674
3 3300046477 Ga0495664_0017430 Ga0495664_0017430_625_2649 674
4 3300046516 Ga0495628_0005433 Ga0495628_0005433_3160_5184 674
5 3300046524 Ga0495648_0004824 Ga0495648_0004824_3139_5163 674
6 3300046526 Ga0495666_0003981 Ga0495666_0003981_482_2506 674
7 3300046529 Ga0495652_0021615 Ga0495652_0021615_168_2192 674
8 3300046531 Ga0495665_0011764 Ga0495665_0011764_2559_4583 674
9 3300046535 Ga0495586_0007881 Ga0495586_0007881_128_2152 674
10 3300046536 Ga0495587_0026526 Ga0495587_0026526_179_2203 674
11 3300046543 Ga0495645_0032253 Ga0495645_0032253_431_2455 674
12 3300046665 Ga0495661_0006341 Ga0495661_0006341_4823_6847 674
13 3300046680 Ga0495646_0013417 Ga0495646_0013417_688_2712 674
14 3300046689 Ga0495613_0005900 Ga0495613_0005900_2368_4392 674
15 3300047317 Ga0495604_0018576 Ga0495604_0018576_890_2914 674
16 3300047321 Ga0495676_0049688 Ga0495676_0049688_1182_3206 674
17 3300047446 Ga0495679_001522 Ga0495679_001522_2536_4560 674
18 3300048905 Ga0496102_0026611 Ga0496102_0026611_2885_5149 754
19 3300039447 Ga0436361_0908905 Ga0436361_0908905_223_2688 773
20 3300006946 Ga0079104_1000011 Ga0079104_100001192 779
21 3300009148 Ga0105243_10000661 Ga0105243_1000066110 779
22 3300025935 Ga0207709_10000074 Ga0207709_1000007415 779
23 3300027111 Ga0209281_1000005 Ga0209281_1000005846 779
24 iso_pu_bacteria 2904615490 2904618312 783
25 3300053119 Ga0500595_000078 Ga0500595_000078_21287_23665 786
26 3300053730 Ga0500645_000486 Ga0500645_000486_18465_20843 786
27 3300049591 Ga0501075_0007070 Ga0501075_0007070_1104_3539 790
28 3300002737 JGI25162J39368_1000032 JGI25162J39368_1000032128 791
29 3300003214 JGI25165J46597_1000067 JGI25165J46597_1000067128 791
30 3300003751 Ga0055538_1000033 Ga0055538_1000033128 791
31 3300003752 Ga0055539_1000045 Ga0055539_1000045127 791
32 3300003756 Ga0055533_1000054 Ga0055533_1000054128 791
33 3300003759 Ga0055525_1000065 Ga0055525_1000065128 791
34 3300003841 Ga0055541_1000031 Ga0055541_1000031128 791
35 3300009177 Ga0105248_10059877 Ga0105248_100598773 791
36 3300025224 Ga0209784_100048 Ga0209784_100048128 791
37 3300025225 Ga0209566_100060 Ga0209566_100060128 791
38 3300025226 Ga0209674_100082 Ga0209674_100082128 791
39 3300025230 Ga0209563_100082 Ga0209563_100082128 791
40 3300025231 Ga0207427_100378 Ga0207427_10037813 791
41 3300025233 Ga0209437_100125 Ga0209437_100125127 791
42 3300025253 Ga0209677_100046 Ga0209677_100046127 791
43 3300025261 Ga0209233_1000138 Ga0209233_1000138127 791
44 3300009551 Ga0105238_10111166 Ga0105238_101111662 793
45 3300046457 Ga0495590_0000634 Ga0495590_0000634_13927_16308 793
46 3300046471 Ga0495650_0002531 Ga0495650_0002531_8638_11019 793
47 3300046528 Ga0495642_0016580 Ga0495642_0016580_12_2393 793
48 3300046665 Ga0495661_0012617 Ga0495661_0012617_23_2404 793
49 3300047444 Ga0495675_0030555 Ga0495675_0030555_20_2401 793
50 3300048926 Ga0496123_0000107 Ga0496123_0000107_164521_166902 793
51 3300049582 Ga0501048_0001473 Ga0501048_0001473_808_3237 796
52 3300031239 Ga0265328_10000565 Ga0265328_100005656 798
53 3300031250 Ga0265331_10000030 Ga0265331_1000003081 798
54 3300031251 Ga0265327_10000072 Ga0265327_1000007282 798
55 iso_pu_bacteria 2643221547 2643754809 798
56 iso_pu_bacteria 2885383462 2885384302 799
57 iso_pu_bacteria 2953994433 2953995845 799
58 3300005617 Ga0068859_100009189 Ga0068859_1000091891 800
59 3300006931 Ga0097620_100009189 Ga0097620_1000091898 800
60 3300028380 Ga0268265_10000158 Ga0268265_1000015829 800
61 3300045051 Ga0451576_0007575 Ga0451576_0007575_5284_7713 800
62 iso_pu_bacteria 2968117919 2968120828 800
63 3300003773 Ga0055537_1003813 Ga0055537_10038132 802
64 3300003775 Ga0055524_1000509 Ga0055524_100050922 802
65 3300003781 Ga0055536_1000159 Ga0055536_100015927 802
66 3300025263 Ga0209565_1000094 Ga0209565_100009412 802
67 3300025291 Ga0209675_1000079 Ga0209675_100007988 802
68 3300025291 Ga0209675_1003760 Ga0209675_10037602 802
69 3300025292 Ga0209676_1000576 Ga0209676_100057628 802
70 3300025295 Ga0209564_1000308 Ga0209564_100030888 802
71 3300025297 Ga0209758_1005845 Ga0209758_10058458 802
72 3300025299 Ga0209256_1002412 Ga0209256_100241212 802
73 iso_pu_bacteria 2891633521 2891635125 802
74 3300003756 Ga0055533_1000808 Ga0055533_10008082 803
75 3300005436 Ga0070713_100012485 Ga0070713_1000124853 803
76 3300005471 Ga0070698_100005136 Ga0070698_1000051366 803
77 3300005548 Ga0070665_100031439 Ga0070665_1000314394 803
78 3300005844 Ga0068862_100035484 Ga0068862_1000354842 803
79 3300006028 Ga0070717_10015173 Ga0070717_100151734 803
80 3300006042 Ga0075368_10000471 Ga0075368_1000047110 803
81 3300006175 Ga0070712_100015938 Ga0070712_1000159383 803
82 3300015687 Ga0183368_1002 Ga0183368_10021214 803
83 3300021361 Ga0213872_10000564 Ga0213872_100005649 803
84 3300021361 Ga0213872_10004254 Ga0213872_100042544 803
85 3300025226 Ga0209674_100014 Ga0209674_100014244 803
86 3300025242 Ga0209258_101822 Ga0209258_1018224 803
87 3300025904 Ga0207647_10007898 Ga0207647_100078986 803
88 3300027866 Ga0209813_10000541 Ga0209813_100005414 803
89 3300028379 Ga0268266_10051223 Ga0268266_100512232 803
90 3300028380 Ga0268265_10009023 Ga0268265_100090235 803
91 3300028800 Ga0265338_10034916 Ga0265338_100349163 803
92 3300037068 Ga0373925_0056790 Ga0373925_0056790_50_2479 803
93 3300039447 Ga0436361_0131723 Ga0436361_0131723_13382_15853 803
94 3300039447 Ga0436361_0507032 Ga0436361_0507032_32382_34859 803
95 3300039447 Ga0436361_0629455 Ga0436361_0629455_1451_3922 803
96 3300041413 Ga0439465_0000670 Ga0439465_0000670_715_3147 803
97 3300048916 Ga0496113_0032387 Ga0496113_0032387_989_3421 803
98 3300048918 Ga0496115_0000379 Ga0496115_0000379_87_2519 803
99 3300048929 Ga0496126_0010474 Ga0496126_0010474_1130_3559 803
100 3300049580 Ga0501046_0012775 Ga0501046_0012775_2627_5056 803
101 3300049823 Ga0501044_0116194 Ga0501044_0116194_220_2649 803
102 3300050494 nmdc:mga06z11_307_c1 nmdc:mga06z11_307_c1_8517_10946 803
103 3300050495 nmdc:mga04h51_542_c1 nmdc:mga04h51_542_c1_502_2931 803
104 3300053094 Ga0500566_0000080 Ga0500566_0000080_11607_14036 803
105 3300053095 Ga0500640_000072 Ga0500640_000072_460_2889 803
106 3300053111 Ga0500572_000408 Ga0500572_000408_1690_4119 803
107 3300053119 Ga0500595_000240 Ga0500595_000240_29598_32030 803
108 3300053136 Ga0500559_0005289 Ga0500559_0005289_2926_5355 803
109 3300053150 Ga0500603_000064 Ga0500603_000064_14064_16493 803
110 3300053159 Ga0500630_000172 Ga0500630_000172_19115_21544 803
111 3300053163 Ga0500639_000017 Ga0500639_000017_95663_98092 803
112 3300025928 Ga0207700_10062143 Ga0207700_100621431 804
113 3300031249 Ga0265339_10002468 Ga0265339_100024682 804
114 3300031712 Ga0265342_10000039 Ga0265342_1000003942 804
115 3300037418 Ga0395900_0014877 Ga0395900_0014877_2814_5246 804
116 3300046533 Ga0495640_0029472 Ga0495640_0029472_452_2884 804
117 iso_pu_bacteria 2721755523 2722883979 804
118 iso_pu_bacteria 2839138175 2839140248 804
119 3300021384 Ga0213876_10013098 Ga0213876_100130982 805
120 3300039437 Ga0436365_0760767 Ga0436365_0760767_14847_17279 805
121 iso_pu_bacteria 2842718218 2842718444 805
122 iso_pu_bacteria 2974320154 2974320809 805
123 3300047673 Ga0495593_0001753 Ga0495593_0001753_10383_12806 807
124 3300025263 Ga0209565_1002363 Ga0209565_10023635 808
125 3300025299 Ga0209256_1000905 Ga0209256_10009056 808
126 3300025303 Ga0209051_1009332 Ga0209051_10093323 808
127 3300044712 Ga0453684_0000005 Ga0453684_0000005_658586_661012 808
128 3300002067 JGI24735J21928_10000655 JGI24735J21928_100006552 809
129 3300005331 Ga0070670_100000745 Ga0070670_1000007458 809
130 3300005367 Ga0070667_100000012 Ga0070667_100000012120 809
131 3300005455 Ga0070663_100000630 Ga0070663_1000006308 809
132 3300005539 Ga0068853_100003185 Ga0068853_10000318512 809
133 3300005539 Ga0068853_100014297 Ga0068853_1000142976 809
134 3300005548 Ga0070665_100000095 Ga0070665_10000009531 809
135 3300006051 Ga0075364_10013043 Ga0075364_100130432 809
136 3300009011 Ga0105251_10001383 Ga0105251_100013839 809
137 3300009093 Ga0105240_10103908 Ga0105240_101039082 809
138 3300009177 Ga0105248_10000468 Ga0105248_1000046841 809
139 3300009177 Ga0105248_10019798 Ga0105248_100197983 809
140 3300009545 Ga0105237_10006809 Ga0105237_100068096 809
141 3300009553 Ga0105249_10000469 Ga0105249_100004696 809
142 3300010375 Ga0105239_10060928 Ga0105239_100609283 809
143 3300013306 Ga0163162_10001890 Ga0163162_1000189017 809
144 3300025295 Ga0209564_1000166 Ga0209564_100016629 809
145 3300025303 Ga0209051_1001060 Ga0209051_100106016 809
146 3300025303 Ga0209051_1005358 Ga0209051_10053581 809
147 3300025735 Ga0207713_1002356 Ga0207713_10023567 809
148 3300025913 Ga0207695_10039794 Ga0207695_100397942 809
149 3300025914 Ga0207671_10007763 Ga0207671_100077634 809
150 3300025941 Ga0207711_10000406 Ga0207711_1000040629 809
151 3300025941 Ga0207711_10038926 Ga0207711_100389263 809
152 3300025961 Ga0207712_10001383 Ga0207712_100013838 809
153 3300025986 Ga0207658_10000027 Ga0207658_10000027132 809
154 3300026067 Ga0207678_10000258 Ga0207678_1000025817 809
155 3300028379 Ga0268266_10000001 Ga0268266_100000012151 809
156 3300028800 Ga0265338_10002184 Ga0265338_100021849 809
157 3300037471 Ga0395905_0024623 Ga0395905_0024623_703_3132 809
158 3300044712 Ga0453684_0003131 Ga0453684_0003131_26553_28982 809
159 3300046455 Ga0495603_0000139 Ga0495603_0000139_33715_36147 809
160 3300046458 Ga0495591_000713 Ga0495591_000713_9253_11682 809
161 3300046459 Ga0495629_0000663 Ga0495629_0000663_13693_16122 809
162 3300046459 Ga0495629_0004597 Ga0495629_0004597_1089_3554 809
163 3300046459 Ga0495629_0010710 Ga0495629_0010710_33_2462 809
164 3300046460 Ga0495638_0028124 Ga0495638_0028124_542_2971 809
165 3300046462 Ga0495651_0008833 Ga0495651_0008833_1096_3525 809
166 3300046463 Ga0495653_0001022 Ga0495653_0001022_2363_4795 809
167 3300046463 Ga0495653_0012736 Ga0495653_0012736_2926_5391 809
168 3300046463 Ga0495653_0021981 Ga0495653_0021981_2064_4496 809
169 3300046472 Ga0495580_0003791 Ga0495580_0003791_5020_7449 809
170 3300046507 Ga0495606_0006983 Ga0495606_0006983_467_2896 809
171 3300046511 Ga0495608_0001033 Ga0495608_0001033_3974_6403 809
172 3300046514 Ga0495618_0002415 Ga0495618_0002415_5373_7802 809
173 3300046516 Ga0495628_0000457 Ga0495628_0000457_4346_6778 809
174 3300046516 Ga0495628_0005694 Ga0495628_0005694_282_2711 809
175 3300046517 Ga0495630_0025307 Ga0495630_0025307_252_2684 809
176 3300046526 Ga0495666_0000229 Ga0495666_0000229_16640_19072 809
177 3300046529 Ga0495652_0001464 Ga0495652_0001464_74_2506 809
178 3300046529 Ga0495652_0001621 Ga0495652_0001621_4795_7224 809
179 3300046531 Ga0495665_0000139 Ga0495665_0000139_28683_31115 809
180 3300046533 Ga0495640_0007580 Ga0495640_0007580_1218_3647 809
181 3300046535 Ga0495586_0000124 Ga0495586_0000124_41802_44234 809
182 3300046536 Ga0495587_0007825 Ga0495587_0007825_3712_6141 809
183 3300046542 Ga0495597_0007251 Ga0495597_0007251_1688_4117 809
184 3300046543 Ga0495645_0036777 Ga0495645_0036777_1071_3500 809
185 3300046642 Ga0495634_0006812 Ga0495634_0006812_4239_6671 809
186 3300046678 Ga0495599_0018796 Ga0495599_0018796_1098_3530 809
187 3300046679 Ga0495623_0005035 Ga0495623_0005035_3810_6239 809
188 3300046679 Ga0495623_0011565 Ga0495623_0011565_2172_4601 809
189 3300046689 Ga0495613_0007348 Ga0495613_0007348_2864_5296 809
190 3300046689 Ga0495613_0011637 Ga0495613_0011637_33_2462 809
191 3300046690 Ga0495624_0003578 Ga0495624_0003578_8061_10490 809
192 3300046794 Ga0495589_0000759 Ga0495589_0000759_1232_3661 809
193 3300046794 Ga0495589_0007957 Ga0495589_0007957_65_2494 809
194 3300046809 Ga0495600_0004452 Ga0495600_0004452_5803_8232 809
195 3300047322 Ga0495680_0001071 Ga0495680_0001071_23716_26148 809
196 3300047322 Ga0495680_0005720 Ga0495680_0005720_4073_6502 809
197 3300047323 Ga0495683_0003408 Ga0495683_0003408_2748_5177 809
198 3300047323 Ga0495683_0003502 Ga0495683_0003502_3859_6288 809
199 3300047443 Ga0495687_000121 Ga0495687_000121_71766_74195 809
200 3300047444 Ga0495675_0016523 Ga0495675_0016523_1251_3680 809
201 3300047444 Ga0495675_0031401 Ga0495675_0031401_53_2518 809
202 3300047446 Ga0495679_000269 Ga0495679_000269_36741_39173 809
203 3300047472 Ga0495686_0000370 Ga0495686_0000370_54015_57080 809
204 3300047472 Ga0495686_0010395 Ga0495686_0010395_1710_4139 809
205 3300047673 Ga0495593_0002072 Ga0495593_0002072_5680_8109 809
206 3300047673 Ga0495593_0016297 Ga0495593_0016297_1095_3527 809
207 3300048088 Ga0495602_0000446 Ga0495602_0000446_4189_6621 809
208 3300048088 Ga0495602_0000614 Ga0495602_0000614_11579_14044 809
209 3300048088 Ga0495602_0018110 Ga0495602_0018110_477_2906 809
210 3300048089 Ga0495614_0000125 Ga0495614_0000125_4358_6790 809
211 3300048906 Ga0496103_0011269 Ga0496103_0011269_1886_4315 809
212 3300048908 Ga0496105_0006555 Ga0496105_0006555_6124_8553 809
213 3300048910 Ga0496107_0005731 Ga0496107_0005731_5300_7729 809
214 3300048913 Ga0496110_0009100 Ga0496110_0009100_3817_6246 809
215 3300048915 Ga0496112_0017831 Ga0496112_0017831_959_3388 809
216 3300048917 Ga0496114_0003936 Ga0496114_0003936_6989_9418 809
217 3300048917 Ga0496114_0028227 Ga0496114_0028227_963_3392 809
218 3300048918 Ga0496115_0001104 Ga0496115_0001104_9198_11627 809
219 3300048920 Ga0496117_0004268 Ga0496117_0004268_8308_10737 809
220 3300048921 Ga0496118_0000198 Ga0496118_0000198_80859_83288 809
221 3300048921 Ga0496118_0021355 Ga0496118_0021355_2777_5206 809
222 3300048924 Ga0496121_0031420 Ga0496121_0031420_2041_4470 809
223 3300048925 Ga0496122_0001667 Ga0496122_0001667_20284_22713 809
224 3300048925 Ga0496122_0013402 Ga0496122_0013402_3812_6241 809
225 3300048927 Ga0496124_0011488 Ga0496124_0011488_3917_6346 809
226 3300048928 Ga0496125_0034877 Ga0496125_0034877_1218_3647 809
227 3300048929 Ga0496126_0000032 Ga0496126_0000032_99793_102222 809
228 3300048929 Ga0496126_0002439 Ga0496126_0002439_22603_25032 809
229 3300053087 Ga0500643_001109 Ga0500643_001109_11236_13665 809
230 3300053093 Ga0500651_0001244 Ga0500651_0001244_7144_9573 809
231 3300053120 Ga0500597_000135 Ga0500597_000135_9180_11609 809
232 3300053139 Ga0500568_0000299 Ga0500568_0000299_12043_14472 809

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00384

Molybdopterin

Molybdopterin oxidoreductase

1

381

0.92

PF01568

Molydop_binding

Molydopterin dinucleotide binding domain

673

792

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kqf-assembly1.cif.gz_A formate dehydrogenase n from e. coli 0.9364 1 809
1kqf-assembly1.cif.gz_A formate dehydrogenase n from e. coli 0.9286 1 809
8cm4-assembly2.cif.gz_C w-formate dehydrogenase c872a from desulfovibrio vulgaris - exposed to oxygen 0.9046 1 809
6sdr-assembly1.cif.gz_A w-formate dehydrogenase from desulfovibrio vulgaris - oxidized form 0.8954 1 809
8cm7-assembly1.cif.gz_A w-formate dehydrogenase m405a from desulfovibrio vulgaris 0.8954 1 809
ID Description Score Start End Superfamily
1kqgA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9257 634 809 2.40.40.20
1kqgA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9055 634 809 2.40.40.20
1kqgA03 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.8734 1 253 3.40.228.10
1kqfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8556 320 470 3.40.50.740
2iv2X03 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.8439 1 233 3.40.228.10
ID Description Score Start End GO Terms
AF-A0A378N898-F1-model_v4 Formate dehydrogenase, nitrate-inducible, major subunit (EC 1.17.1.9) 0.9947 56 191 GO:0008863
GO:0009055
GO:0009061
GO:0030151
GO:0030313
GO:0051539
AF-A0A2J0QR99-F1-model_v4 deleted 0.9865 34 175
AF-A0A6M1HVN7-F1-model_v4 deleted 0.9748 13 176
AF-A0A2M7KED2-F1-model_v4 Formate dehydrogenase 0.9743 1 196 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0051539
AF-A0A0D8L381-F1-model_v4 Molybdopterin oxidoreductase domain-containing protein 0.9688 1 168 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0051539

Feature Viewer

pLDDT pTM Quality
80.16 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map