F345168

General Info

Members Datasets Scaffolds Average Seq Length
232 120 464 121

Family's Representative Sequence

Representative Sequence 3300027671|Ga0209588_1005609|Ga0209588_10056091
Length 144
Sequence VSSADLLDSLRSGCVYYLKVMQPSGYRRTAPDRLDATFAALADPTRRAILARLATGEASVMELAAPFDMSQPAVSKHLKVLERAGLVSRGRDAQRRPRRLEPRPLAEVTGWLEAYRKLWEGNFQRLDAVLEELKAAKKHGRSKR

Samples

Sample ID Description Type Environment
1 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
94 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
115 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
119 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
120 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0.86
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209588_1005609 3300027671 Bacteria 3605
2 Ga0065707_10285015 3300005295 Bacteria 1038
3 Ga0070683_102120352 3300005329 Bacteria 540
4 Ga0070670_100132115 3300005331 Bacteria 2156
5 Ga0070677_10280867 3300005333 Bacteria 839
6 Ga0070680_100005950 3300005336 Bacteria 9255
7 Ga0070689_101207635 3300005340 Bacteria 679
8 Ga0070668_100015248 3300005347 Bacteria 5741
9 Ga0070669_100123571 3300005353 Bacteria 1978
10 Ga0070674_100219636 3300005356 Bacteria 1478
11 Ga0070673_100302028 3300005364 Bacteria 1409
12 Ga0070673_100410048 3300005364 Bacteria 1213
13 Ga0070667_100423679 3300005367 Bacteria 1214
14 Ga0070703_10000505 3300005406 Bacteria 15108
15 Ga0070703_10003181 3300005406 Bacteria 4690
16 Ga0070709_10340629 3300005434 Bacteria 1105
17 Ga0070713_101437083 3300005436 Bacteria 669
18 Ga0070701_10761709 3300005438 Bacteria 657
19 Ga0070711_100049288 3300005439 Bacteria 2884
20 Ga0070705_100074707 3300005440 Bacteria 2061
21 Ga0070705_100632010 3300005440 Bacteria 832
22 Ga0070694_100014997 3300005444 Bacteria 4857
23 Ga0070694_100300629 3300005444 Bacteria 1229
24 Ga0070694_101232765 3300005444 Bacteria 627
25 Ga0070708_100025207 3300005445 Bacteria 5081
26 Ga0070708_100026406 3300005445 Bacteria 4971
27 Ga0070708_100040344 3300005445 Bacteria 4088
28 Ga0070708_100045828 3300005445 Bacteria 3855
29 Ga0070708_100600604 3300005445 Bacteria 1037
30 Ga0070681_10725320 3300005458 Bacteria 910
31 Ga0068867_100046944 3300005459 Bacteria 3174
32 Ga0070706_100000923 3300005467 Bacteria 32144
33 Ga0070706_100017204 3300005467 Bacteria 6676
34 Ga0070706_100045515 3300005467 Bacteria 4053
35 Ga0070706_100082977 3300005467 Bacteria 2969
36 Ga0070706_100413951 3300005467 Bacteria 1255
37 Ga0070707_100534464 3300005468 Bacteria 1134
38 Ga0070698_100015477 3300005471 Bacteria 8057
39 Ga0070698_100046196 3300005471 Bacteria 4453
40 Ga0070698_100190562 3300005471 Bacteria 1988
41 Ga0070698_100432844 3300005471 Bacteria 1250
42 Ga0070698_101405698 3300005471 Bacteria 649
43 Ga0070699_100003878 3300005518 Bacteria 13220
44 Ga0070699_100005588 3300005518 Bacteria 11031
45 Ga0070699_100016485 3300005518 Bacteria 6345
46 Ga0070699_100274503 3300005518 Bacteria 1509
47 Ga0070699_100617991 3300005518 Bacteria 988
48 Ga0070699_101603946 3300005518 Bacteria 596
49 Ga0070697_100025045 3300005536 Bacteria 4756
50 Ga0070697_100138362 3300005536 Bacteria 2046
51 Ga0070697_100223309 3300005536 Bacteria 1606
52 Ga0070697_101775752 3300005536 Bacteria 552
53 Ga0070672_100102711 3300005543 Bacteria 2321
54 Ga0070695_100002926 3300005545 Bacteria 9941
55 Ga0070695_100048025 3300005545 Bacteria 2728
56 Ga0070695_100862923 3300005545 Bacteria 729
57 Ga0070696_100019053 3300005546 Bacteria 4646
58 Ga0070696_100169633 3300005546 Bacteria 1612
59 Ga0070704_100005274 3300005549 Bacteria 7528
60 Ga0070704_100015232 3300005549 Bacteria 4825
61 Ga0070704_100030678 3300005549 Bacteria 3605
62 Ga0070704_100145872 3300005549 Bacteria 1854
63 Ga0070702_100039889 3300005615 Bacteria 2623
64 Ga0068852_100716814 3300005616 Bacteria 1011
65 Ga0068864_100137684 3300005618 Bacteria 2200
66 Ga0068864_102701470 3300005618 Bacteria 502
67 Ga0068861_101245619 3300005719 Bacteria 721
68 Ga0068863_100070936 3300005841 Bacteria 3295
69 Ga0068860_100052547 3300005843 Bacteria 3876
70 Ga0068860_102763344 3300005843 Bacteria 509
71 Ga0068862_102282680 3300005844 Bacteria 553
72 Ga0097621_100961168 3300006237 Bacteria 798
73 Ga0075428_100169447 3300006844 Bacteria 2368
74 Ga0075428_100230095 3300006844 Bacteria 2000
75 Ga0075431_100060873 3300006847 Bacteria 3896
76 Ga0075431_100236618 3300006847 Bacteria 1859
77 Ga0075431_101924896 3300006847 Bacteria 547
78 Ga0075433_10001535 3300006852 Bacteria 17060
79 Ga0075433_10076364 3300006852 Bacteria 2950
80 Ga0075433_10102531 3300006852 Bacteria 2534
81 Ga0075433_10233103 3300006852 Bacteria 1635
82 Ga0075433_10907362 3300006852 Bacteria 768
83 Ga0075433_11045589 3300006852 Bacteria 711
84 Ga0075434_100001056 3300006871 Bacteria 22490
85 Ga0075434_100002461 3300006871 Bacteria 16301
86 Ga0075434_100003764 3300006871 Bacteria 13551
87 Ga0075434_100022070 3300006871 Bacteria 6198
88 Ga0075434_100036672 3300006871 Bacteria 4850
89 Ga0075434_101215627 3300006871 Bacteria 765
90 Ga0075429_100000576 3300006880 Bacteria 28222
91 Ga0075429_100353352 3300006880 Bacteria 1287
92 Ga0068865_100043719 3300006881 Bacteria 3063
93 Ga0075436_100012119 3300006914 Bacteria 5908
94 Ga0075436_100035947 3300006914 Bacteria 3417
95 Ga0075436_100083769 3300006914 Bacteria 2213
96 Ga0075436_100141374 3300006914 Bacteria 1692
97 Ga0075436_100182358 3300006914 Bacteria 1484
98 Ga0075435_100012748 3300007076 Bacteria 6229
99 Ga0075435_100020420 3300007076 Bacteria 5076
100 Ga0075435_100056123 3300007076 Bacteria 3183
101 Ga0075435_100104922 3300007076 Bacteria 2345
102 Ga0075435_100619414 3300007076 Bacteria 939
103 Ga0099794_10000672 3300007265 Bacteria 11440
104 Ga0099794_10011528 3300007265 Bacteria 3786
105 Ga0099794_10043633 3300007265 Bacteria 2141
106 Ga0099794_10169362 3300007265 Bacteria 1113
107 Ga0111539_10783447 3300009094 Bacteria 1110
108 Ga0114129_10002398 3300009147 Bacteria 26039
109 Ga0114129_10009524 3300009147 Bacteria 13855
110 Ga0114129_10046528 3300009147 Bacteria 6097
111 Ga0114129_10215663 3300009147 Bacteria 2592
112 Ga0114129_10663617 3300009147 Bacteria 1344
113 Ga0114129_10736394 3300009147 Bacteria 1263
114 Ga0114129_10960332 3300009147 Bacteria 1079
115 Ga0114129_11130433 3300009147 Bacteria 979
116 Ga0105243_12112624 3300009148 Bacteria 599
117 Ga0105243_12889025 3300009148 Bacteria 521
118 Ga0105248_10020428 3300009177 Bacteria 7338
119 Ga0105248_10022830 3300009177 Bacteria 6946
120 Ga0105248_11318188 3300009177 Bacteria 817
121 Ga0157375_10255067 3300013308 Bacteria 1915
122 Ga0157375_10681156 3300013308 Bacteria 1183
123 Ga0163163_10043673 3300014325 Bacteria 4395
124 Ga0163163_10045519 3300014325 Bacteria 4307
125 Ga0157380_10073419 3300014326 Bacteria 2773
126 Ga0157379_10250232 3300014968 Bacteria 1609
127 Ga0157379_10768821 3300014968 Bacteria 908
128 Ga0157376_12256203 3300014969 Bacteria 583
129 Ga0228598_1019768 3300024227 Bacteria 1327
130 Ga0207653_10003421 3300025885 Bacteria 5006
131 Ga0207653_10008143 3300025885 Bacteria 3267
132 Ga0207682_10272521 3300025893 Bacteria 790
133 Ga0207645_10050274 3300025907 Bacteria 2661
134 Ga0207684_10007324 3300025910 Bacteria 9953
135 Ga0207684_10022152 3300025910 Bacteria 5426
136 Ga0207684_10033400 3300025910 Bacteria 4375
137 Ga0207684_10071989 3300025910 Bacteria 2937
138 Ga0207684_10129118 3300025910 Bacteria 2169
139 Ga0207684_10183374 3300025910 Bacteria 1805
140 Ga0207684_10279151 3300025910 Bacteria 1441
141 Ga0207663_10016384 3300025916 Bacteria 4109
142 Ga0207660_10043844 3300025917 Bacteria 3145
143 Ga0207660_10105082 3300025917 Bacteria 2115
144 Ga0207646_10012041 3300025922 Bacteria 8331
145 Ga0207646_10177094 3300025922 Bacteria 1926
146 Ga0207646_10277900 3300025922 Bacteria 1513
147 Ga0207659_10579861 3300025926 Bacteria 955
148 Ga0207669_10201482 3300025937 Bacteria 1445
149 Ga0207704_10138518 3300025938 Bacteria 1698
150 Ga0207691_10007102 3300025940 Bacteria 10810
151 Ga0207691_10222041 3300025940 Bacteria 1638
152 Ga0207711_10084960 3300025941 Bacteria 2772
153 Ga0207651_10030507 3300025960 Bacteria 3434
154 Ga0207651_10236620 3300025960 Bacteria 1486
155 Ga0207668_10148717 3300025972 Bacteria 1810
156 Ga0207703_10747282 3300026035 Bacteria 932
157 Ga0207641_10782713 3300026088 Bacteria 943
158 Ga0207648_10200039 3300026089 Bacteria 1772
159 Ga0207676_12582754 3300026095 Bacteria 504
160 Ga0207675_100180547 3300026118 Bacteria 2021
161 Ga0207675_100707707 3300026118 Unclassified 1016
162 Ga0207675_101092330 3300026118 Bacteria 817
163 Ga0209588_1000165 3300027671 Bacteria 18478
164 Ga0209588_1012511 3300027671 Bacteria 2577
165 Ga0268264_10094439 3300028381 Bacteria 2585
166 Ga0307512_10116876 3300030522 Bacteria 1731
167 Ga0307405_10948189 3300031731 Bacteria 731
168 Ga0307413_10407667 3300031824 Bacteria 1067
169 Ga0307410_10105847 3300031852 Bacteria 2026
170 Ga0307406_10090962 3300031901 Bacteria 2055
171 Ga0307407_10681127 3300031903 Bacteria 773
172 Ga0307412_10077030 3300031911 Bacteria 2293
173 Ga0307409_100100874 3300031995 Bacteria 2394
174 Ga0307409_101279909 3300031995 Bacteria 758
175 Ga0307416_100041672 3300032002 Bacteria 3578
176 Ga0307416_102187608 3300032002 Bacteria 654
177 Ga0307415_101006242 3300032126 Bacteria 775
178 Ga0373926_0020391 3300035083 Bacteria 2290
179 Ga0373935_0052762 3300035692 Bacteria 2586
180 Ga0373927_0004162 3300035695 Bacteria 10167
181 Ga0373927_0046230 3300035695 Bacteria 2817
182 Ga0373925_0164475 3300037068 Bacteria 1749
183 Ga0451807_0436897 3300041486 Bacteria 1029
184 Ga0439457_165842 3300042014 Bacteria 535
185 Ga0453683_0060488 3300044673 Bacteria 2368
186 Ga0453683_0314404 3300044673 Bacteria 1003
187 Ga0495580_0411042 3300046472 Bacteria 911
188 Ga0495621_0348107 3300046539 Bacteria 621
189 Ga0495622_0399846 3300046557 Bacteria 592
190 Ga0495633_0388584 3300046558 Bacteria 631
191 Ga0495670_0799082 3300046691 Bacteria 515
192 Ga0496114_0040340 3300048917 Bacteria 3865
193 Ga0501038_0732458 3300049574 Bacteria 739
194 Ga0501067_0039509 3300049583 Bacteria 2620
195 Ga0501073_0791202 3300049589 Bacteria 654
196 Ga0501075_0687101 3300049591 Bacteria 780
197 Ga0501076_0542043 3300049592 Bacteria 959
198 Ga0501081_0074762 3300049743 Bacteria 2364
199 Ga0501081_1416485 3300049743 Bacteria 527
200 Ga0501081_1483039 3300049743 Bacteria 515
201 nmdc:mga00v17_972129_c1 3300050491 Bacteria 535
202 nmdc:mga05p37_1502534_c1 3300050507 Bacteria 670
203 nmdc:mga05p37_19815_c1 3300050507 Bacteria 8139
204 nmdc:mga05p37_3503_c1 3300050507 Bacteria 18353
205 nmdc:mga05p37_7633_c1 3300050507 Bacteria 12764
206 nmdc:mga05p37_97665_c1 3300050507 Bacteria 3618
207 nmdc:mga09592_1106212_c1 3300050508 Bacteria 658
208 nmdc:mga09592_172438_c1 3300050508 Bacteria 1870
209 nmdc:mga09592_4463_c1 3300050508 Bacteria 11318
210 nmdc:mga0qj67_236233_c1 3300050509 Bacteria 1483
211 nmdc:mga0qj67_608893_c1 3300050509 Bacteria 873
212 nmdc:mga06r32_1117885_c1 3300050510 Bacteria 736
213 nmdc:mga0n895_1333_c1 3300050512 Bacteria 18286
214 nmdc:mga0n895_32169_c1 3300050512 Bacteria 5033
215 nmdc:mga0n895_58408_c1 3300050512 Bacteria 3804
216 nmdc:mga0n895_9066_c1 3300050512 Bacteria 8677
217 nmdc:mga0rr50_114269_c1 3300050513 Bacteria 2141
218 nmdc:mga0rr50_1613_c1 3300050513 Bacteria 12414
219 nmdc:mga0rr50_624596_c1 3300050513 Bacteria 919
220 nmdc:mga08x19_4683_c1 3300050514 Bacteria 8112
221 nmdc:mga08x19_47374_c1 3300050514 Bacteria 2751
222 nmdc:mga08x19_72752_c1 3300050514 Bacteria 2243
223 nmdc:mga0a205_1203504_c1 3300050515 Bacteria 605
224 nmdc:mga0a205_140244_c1 3300050515 Bacteria 2318
225 nmdc:mga0a205_1443_c1 3300050515 Bacteria 20243
226 nmdc:mga0a205_19442_c1 3300050515 Bacteria 6403
227 nmdc:mga0a205_204966_c1 3300050515 Bacteria 1862
228 nmdc:mga0a205_84167_c1 3300050515 Bacteria 3072
229 Ga0501084_0130392 3300054114 Bacteria 2117
230 Ga0590074_104145 3300059423 Bacteria 556
231 Ga0590077_038487 3300059426 Bacteria 1058
232 2687236487 2684623219 Bacteria 8442773
233 Ga0209588_1005609
234 Ga0065707_10285015
235 Ga0070683_102120352
236 Ga0070670_100132115
237 Ga0070677_10280867
238 Ga0070680_100005950
239 Ga0070689_101207635
240 Ga0070668_100015248
241 Ga0070669_100123571
242 Ga0070674_100219636
243 Ga0070673_100302028
244 Ga0070673_100410048
245 Ga0070667_100423679
246 Ga0070703_10000505
247 Ga0070703_10003181
248 Ga0070709_10340629
249 Ga0070713_101437083
250 Ga0070701_10761709
251 Ga0070711_100049288
252 Ga0070705_100074707
253 Ga0070705_100632010
254 Ga0070694_100014997
255 Ga0070694_100300629
256 Ga0070694_101232765
257 Ga0070708_100025207
258 Ga0070708_100026406
259 Ga0070708_100040344
260 Ga0070708_100045828
261 Ga0070708_100600604
262 Ga0070681_10725320
263 Ga0068867_100046944
264 Ga0070706_100000923
265 Ga0070706_100017204
266 Ga0070706_100045515
267 Ga0070706_100082977
268 Ga0070706_100413951
269 Ga0070707_100534464
270 Ga0070698_100015477
271 Ga0070698_100046196
272 Ga0070698_100190562
273 Ga0070698_100432844
274 Ga0070698_101405698
275 Ga0070699_100003878
276 Ga0070699_100005588
277 Ga0070699_100016485
278 Ga0070699_100274503
279 Ga0070699_100617991
280 Ga0070699_101603946
281 Ga0070697_100025045
282 Ga0070697_100138362
283 Ga0070697_100223309
284 Ga0070697_101775752
285 Ga0070672_100102711
286 Ga0070695_100002926
287 Ga0070695_100048025
288 Ga0070695_100862923
289 Ga0070696_100019053
290 Ga0070696_100169633
291 Ga0070704_100005274
292 Ga0070704_100015232
293 Ga0070704_100030678
294 Ga0070704_100145872
295 Ga0070702_100039889
296 Ga0068852_100716814
297 Ga0068864_100137684
298 Ga0068864_102701470
299 Ga0068861_101245619
300 Ga0068863_100070936
301 Ga0068860_100052547
302 Ga0068860_102763344
303 Ga0068862_102282680
304 Ga0097621_100961168
305 Ga0075428_100169447
306 Ga0075428_100230095
307 Ga0075431_100060873
308 Ga0075431_100236618
309 Ga0075431_101924896
310 Ga0075433_10001535
311 Ga0075433_10076364
312 Ga0075433_10102531
313 Ga0075433_10233103
314 Ga0075433_10907362
315 Ga0075433_11045589
316 Ga0075434_100001056
317 Ga0075434_100002461
318 Ga0075434_100003764
319 Ga0075434_100022070
320 Ga0075434_100036672
321 Ga0075434_101215627
322 Ga0075429_100000576
323 Ga0075429_100353352
324 Ga0068865_100043719
325 Ga0075436_100012119
326 Ga0075436_100035947
327 Ga0075436_100083769
328 Ga0075436_100141374
329 Ga0075436_100182358
330 Ga0075435_100012748
331 Ga0075435_100020420
332 Ga0075435_100056123
333 Ga0075435_100104922
334 Ga0075435_100619414
335 Ga0099794_10000672
336 Ga0099794_10011528
337 Ga0099794_10043633
338 Ga0099794_10169362
339 Ga0111539_10783447
340 Ga0114129_10002398
341 Ga0114129_10009524
342 Ga0114129_10046528
343 Ga0114129_10215663
344 Ga0114129_10663617
345 Ga0114129_10736394
346 Ga0114129_10960332
347 Ga0114129_11130433
348 Ga0105243_12112624
349 Ga0105243_12889025
350 Ga0105248_10020428
351 Ga0105248_10022830
352 Ga0105248_11318188
353 Ga0157375_10255067
354 Ga0157375_10681156
355 Ga0163163_10043673
356 Ga0163163_10045519
357 Ga0157380_10073419
358 Ga0157379_10250232
359 Ga0157379_10768821
360 Ga0157376_12256203
361 Ga0228598_1019768
362 Ga0207653_10003421
363 Ga0207653_10008143
364 Ga0207682_10272521
365 Ga0207645_10050274
366 Ga0207684_10007324
367 Ga0207684_10022152
368 Ga0207684_10033400
369 Ga0207684_10071989
370 Ga0207684_10129118
371 Ga0207684_10183374
372 Ga0207684_10279151
373 Ga0207663_10016384
374 Ga0207660_10043844
375 Ga0207660_10105082
376 Ga0207646_10012041
377 Ga0207646_10177094
378 Ga0207646_10277900
379 Ga0207659_10579861
380 Ga0207669_10201482
381 Ga0207704_10138518
382 Ga0207691_10007102
383 Ga0207691_10222041
384 Ga0207711_10084960
385 Ga0207651_10030507
386 Ga0207651_10236620
387 Ga0207668_10148717
388 Ga0207703_10747282
389 Ga0207641_10782713
390 Ga0207648_10200039
391 Ga0207676_12582754
392 Ga0207675_100180547
393 Ga0207675_100707707
394 Ga0207675_101092330
395 Ga0209588_1000165
396 Ga0209588_1012511
397 Ga0268264_10094439
398 Ga0307512_10116876
399 Ga0307405_10948189
400 Ga0307413_10407667
401 Ga0307410_10105847
402 Ga0307406_10090962
403 Ga0307407_10681127
404 Ga0307412_10077030
405 Ga0307409_100100874
406 Ga0307409_101279909
407 Ga0307416_100041672
408 Ga0307416_102187608
409 Ga0307415_101006242
410 Ga0373926_0020391
411 Ga0373935_0052762
412 Ga0373927_0004162
413 Ga0373927_0046230
414 Ga0373925_0164475
415 Ga0451807_0436897
416 Ga0439457_165842
417 Ga0453683_0060488
418 Ga0453683_0314404
419 Ga0495580_0411042
420 Ga0495621_0348107
421 Ga0495622_0399846
422 Ga0495633_0388584
423 Ga0495670_0799082
424 Ga0496114_0040340
425 Ga0501038_0732458
426 Ga0501067_0039509
427 Ga0501073_0791202
428 Ga0501075_0687101
429 Ga0501076_0542043
430 Ga0501081_0074762
431 Ga0501081_1416485
432 Ga0501081_1483039
433 nmdc:mga00v17_972129_c1
434 nmdc:mga05p37_1502534_c1
435 nmdc:mga05p37_19815_c1
436 nmdc:mga05p37_3503_c1
437 nmdc:mga05p37_7633_c1
438 nmdc:mga05p37_97665_c1
439 nmdc:mga09592_1106212_c1
440 nmdc:mga09592_172438_c1
441 nmdc:mga09592_4463_c1
442 nmdc:mga0qj67_236233_c1
443 nmdc:mga0qj67_608893_c1
444 nmdc:mga06r32_1117885_c1
445 nmdc:mga0n895_1333_c1
446 nmdc:mga0n895_32169_c1
447 nmdc:mga0n895_58408_c1
448 nmdc:mga0n895_9066_c1
449 nmdc:mga0rr50_114269_c1
450 nmdc:mga0rr50_1613_c1
451 nmdc:mga0rr50_624596_c1
452 nmdc:mga08x19_4683_c1
453 nmdc:mga08x19_47374_c1
454 nmdc:mga08x19_72752_c1
455 nmdc:mga0a205_1203504_c1
456 nmdc:mga0a205_140244_c1
457 nmdc:mga0a205_1443_c1
458 nmdc:mga0a205_19442_c1
459 nmdc:mga0a205_204966_c1
460 nmdc:mga0a205_84167_c1
461 Ga0501084_0130392
462 Ga0590074_104145
463 Ga0590077_038487
464 2687236487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

43

89

0.98

PF12840

HTH_20

Helix-turn-helix domain

41

89

0.98

PF12802

MarR_2

MarR family

43

96

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9395 12 95
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9259 13 100
2oqg-assembly1.cif.gz_B arsr-like transcriptional regulator from rhodococcus sp. rha1 0.924 12 112
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9215 11 100
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9204 12 98
ID Description Score Start End Superfamily
af_A0A1D6HDX3_114_200_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9578 23 70 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9377 25 80 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9377 23 68 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9345 13 92 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9323 25 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A350UIW9-F1-model_v4 Transcriptional regulator 0.982 9 95 GO:0003700
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.975 12 93 GO:0003700
AF-A0A4R4QW63-F1-model_v4 ArsR family transcriptional regulator 0.9714 9 102 GO:0003700
AF-A0A4R1MZP4-F1-model_v4 ArsR family transcriptional regulator 0.9711 12 93 GO:0003700
AF-A0A2T7N934-F1-model_v4 Transcriptional regulator 0.9705 13 97 GO:0003700

Map