F344988

General Info

Members Datasets Scaffolds Average Seq Length
232 156 232 132

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_13084433|Ga0111539_130844331
Length 159
Sequence VSQPSLFGPPDDGEDVVAEVTVYADGGARNNPGPAAIGAVVKDSSQDPPATLVTVSEYIGETTNNVAEYRALIAGLEQARRFRPQRLRVRADSMLVVKQLRGEWKVKHAGLRPLHERARALLREFDDVDIAHVRRELNTEADALVNEALDAQAASRAAE

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
78 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 4.31
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001270 3300001977 Bacteria 4024
2 JGI25407J50210_10055444 3300003373 Bacteria 1000
3 JGI25404J52841_10004168 3300003659 Bacteria 2910
4 Ga0070658_10122145 3300005327 Bacteria 2165
5 Ga0070683_100773696 3300005329 Bacteria 920
6 Ga0070680_100000974 3300005336 Bacteria 20302
7 Ga0070680_100116944 3300005336 Bacteria 2223
8 Ga0070680_100970130 3300005336 Bacteria 734
9 Ga0070682_100626174 3300005337 Bacteria 853
10 Ga0070660_100052744 3300005339 Bacteria 3136
11 Ga0070660_100432611 3300005339 Bacteria 1090
12 Ga0070660_101059566 3300005339 Unclassified 686
13 Ga0070661_100589236 3300005344 Unclassified 898
14 Ga0070659_100024819 3300005366 Bacteria 4598
15 Ga0070700_100200852 3300005441 Bacteria 1400
16 Ga0070700_101208270 3300005441 Bacteria 632
17 Ga0070681_10008987 3300005458 Bacteria 9824
18 Ga0070681_10089888 3300005458 Bacteria 3022
19 Ga0070681_10333684 3300005458 Bacteria 1426
20 Ga0070679_100220773 3300005530 Bacteria 1856
21 Ga0070679_100525841 3300005530 Bacteria 1127
22 Ga0070684_100004662 3300005535 Bacteria 10466
23 Ga0070684_100029925 3300005535 Bacteria 4622
24 Ga0070684_100058775 3300005535 Bacteria 3361
25 Ga0070684_100166157 3300005535 Bacteria 2003
26 Ga0070686_100623079 3300005544 Unclassified 852
27 Ga0070704_101599532 3300005549 Bacteria 601
28 Ga0070664_100105815 3300005564 Bacteria 2451
29 Ga0068857_100051515 3300005577 Bacteria 3653
30 Ga0068856_100027207 3300005614 Bacteria 5579
31 Ga0068856_100049110 3300005614 Bacteria 4159
32 Ga0070702_100956135 3300005615 Bacteria 675
33 Ga0068852_100006564 3300005616 Bacteria 8418
34 Ga0068861_101143795 3300005719 Bacteria 750
35 Ga0081455_10010164 3300005937 Bacteria 9583
36 Ga0081538_10000438 3300005981 Bacteria 46840
37 Ga0081538_10003722 3300005981 Bacteria 14309
38 Ga0081538_10011541 3300005981 Bacteria 7148
39 Ga0081538_10034433 3300005981 Bacteria 3348
40 Ga0081538_10109854 3300005981 Bacteria 1357
41 Ga0075432_10135488 3300006058 Bacteria 936
42 Ga0075428_100625665 3300006844 Bacteria 1149
43 Ga0075431_100125878 3300006847 Bacteria 2644
44 Ga0075433_10043707 3300006852 Bacteria 3890
45 Ga0075429_100320071 3300006880 Bacteria 1358
46 Ga0075435_100379490 3300007076 Bacteria 1214
47 Ga0105240_10050131 3300009093 Bacteria 5266
48 Ga0111539_10027154 3300009094 Bacteria 6991
49 Ga0111539_13084433 3300009094 Bacteria 538
50 Ga0105245_10311913 3300009098 Bacteria 1547
51 Ga0105245_10763140 3300009098 Bacteria 1003
52 Ga0105243_10494512 3300009148 Bacteria 1157
53 Ga0105237_10116170 3300009545 Bacteria 2669
54 Ga0105238_10093371 3300009551 Bacteria 2997
55 Ga0105238_11012517 3300009551 Bacteria 852
56 Ga0105239_11643816 3300010375 Bacteria 743
57 Ga0157344_1009712 3300012476 Bacteria 681
58 Ga0157370_10006797 3300013104 Bacteria 12543
59 Ga0157369_10006146 3300013105 Bacteria 13935
60 Ga0157372_10015575 3300013307 Bacteria 8151
61 Ga0157375_10005884 3300013308 Bacteria 10682
62 Ga0206354_11291395 3300020081 Bacteria 7404
63 Ga0206353_11023674 3300020082 Bacteria 3121
64 Ga0213874_10050402 3300021377 Bacteria 1275
65 Ga0213876_10051450 3300021384 Bacteria 2177
66 Ga0207645_10275281 3300025907 Bacteria 1117
67 Ga0207707_10012803 3300025912 Bacteria 7296
68 Ga0207707_10140097 3300025912 Bacteria 2115
69 Ga0207695_10037223 3300025913 Bacteria 5251
70 Ga0207660_10004983 3300025917 Bacteria 8658
71 Ga0207660_10585326 3300025917 Bacteria 908
72 Ga0207657_10068201 3300025919 Bacteria 3022
73 Ga0207657_10392249 3300025919 Bacteria 1092
74 Ga0207649_10498612 3300025920 Unclassified 926
75 Ga0207649_10907962 3300025920 Bacteria 691
76 Ga0207652_10006267 3300025921 Bacteria 9599
77 Ga0207652_10211615 3300025921 Bacteria 1746
78 Ga0207687_10570269 3300025927 Bacteria 951
79 Ga0207690_10308101 3300025932 Unclassified 1241
80 Ga0207690_11031292 3300025932 Bacteria 685
81 Ga0207709_10333493 3300025935 Bacteria 1139
82 Ga0207661_10008045 3300025944 Bacteria 7514
83 Ga0207661_10616874 3300025944 Bacteria 996
84 Ga0207661_12179397 3300025944 Bacteria 500
85 Ga0207679_10469840 3300025945 Bacteria 1118
86 Ga0207667_10111567 3300025949 Bacteria 2821
87 Ga0207651_11155110 3300025960 Bacteria 695
88 Ga0207640_10683330 3300025981 Unclassified 878
89 Ga0207658_11121335 3300025986 Bacteria 719
90 Ga0207674_10146876 3300026116 Bacteria 2316
91 Ga0207698_10008285 3300026142 Bacteria 6564
92 Ga0207428_10071498 3300027907 Bacteria 2725
93 Ga0268265_11142207 3300028380 Bacteria 775
94 Ga0307408_100095366 3300031548 Unclassified 2255
95 Ga0307408_100697146 3300031548 Unclassified 912
96 Ga0307405_10156959 3300031731 Bacteria 1607
97 Ga0307413_10060448 3300031824 Bacteria 2333
98 Ga0307413_10651057 3300031824 Bacteria 869
99 Ga0307410_10068380 3300031852 Bacteria 2453
100 Ga0307406_10007438 3300031901 Bacteria 6071
101 Ga0307406_11217988 3300031901 Bacteria 654
102 Ga0307406_11356085 3300031901 Bacteria 622
103 Ga0307407_10061870 3300031903 Bacteria 2190
104 Ga0307409_100092294 3300031995 Bacteria 2484
105 Ga0307409_100162284 3300031995 Bacteria 1956
106 Ga0307409_100610611 3300031995 Unclassified 1079
107 Ga0307409_102004249 3300031995 Bacteria 608
108 Ga0307416_100108265 3300032002 Bacteria 2441
109 Ga0307416_100906380 3300032002 Bacteria 982
110 Ga0307416_101817905 3300032002 Unclassified 713
111 Ga0307414_10273965 3300032004 Bacteria 1415
112 Ga0307414_10325377 3300032004 Bacteria 1310
113 Ga0307415_100065028 3300032126 Bacteria 2540
114 Ga0307415_100102020 3300032126 Bacteria 2107
115 Ga0307415_100134969 3300032126 Bacteria 1875
116 Ga0307415_100975650 3300032126 Bacteria 786
117 Ga0373958_0023034 3300034819 Bacteria 1169
118 Ga0373929_0075824 3300035085 Bacteria 812
119 Ga0395898_1447994 3300037466 Bacteria 614
120 Ga0395905_0244429 3300037471 Bacteria 1677
121 Ga0395901_0316581 3300038443 Bacteria 1615
122 Ga0395901_2011999 3300038443 Bacteria 524
123 Ga0400489_50394 3300039093 Bacteria 4710
124 Ga0436362_0514246 3300039453 Bacteria 983
125 Ga0439442_010504 3300042002 Bacteria 1878
126 Ga0466969_0007443 3300044656 Bacteria 5816
127 Ga0466966_0039114 3300044684 Bacteria 3055
128 Ga0466966_0546813 3300044684 Bacteria 697
129 Ga0466963_0810412 3300044694 Bacteria 660
130 Ga0466964_0462410 3300044706 Bacteria 675
131 Ga0453684_0102710 3300044712 Bacteria 3495
132 Ga0466957_1001060 3300044842 Bacteria 600
133 Ga0466960_0255803 3300044901 Bacteria 974
134 Ga0466960_0813563 3300044901 Bacteria 566
135 Ga0466959_0033077 3300045049 Bacteria 3826
136 Ga0466967_0047784 3300045976 Bacteria 3733
137 Ga0466967_0424862 3300045976 Bacteria 1296
138 Ga0466967_0611056 3300045976 Bacteria 1076
139 Ga0466967_1496008 3300045976 Bacteria 672
140 Ga0466967_1898533 3300045976 Bacteria 592
141 Ga0495641_0049824 3300046461 Bacteria 1916
142 Ga0495584_0339340 3300046491 Unclassified 763
143 Ga0495616_0111150 3300046513 Bacteria 1273
144 Ga0495618_0070377 3300046514 Bacteria 2225
145 Ga0495628_0476643 3300046516 Bacteria 903
146 Ga0495630_0754917 3300046517 Bacteria 743
147 Ga0495640_0030116 3300046533 Bacteria 3889
148 Ga0495609_0225173 3300046538 Bacteria 778
149 Ga0495621_0000298 3300046539 Bacteria 11941
150 Ga0495645_0068702 3300046543 Bacteria 2558
151 Ga0495667_0036050 3300046559 Bacteria 3304
152 Ga0495656_0575127 3300046615 Archaea 602
153 Ga0495613_0059598 3300046689 Bacteria 2798
154 Ga0495600_0925550 3300046809 Bacteria 513
155 Ga0495680_0426162 3300047322 Bacteria 912
156 Ga0495675_0334828 3300047444 Bacteria 893
157 Ga0495602_0491483 3300048088 Bacteria 859
158 Ga0496100_0000105 3300048903 Bacteria 48698
159 Ga0496101_0858483 3300048904 Bacteria 715
160 Ga0496102_0363842 3300048905 Bacteria 1362
161 Ga0496102_1345893 3300048905 Bacteria 633
162 Ga0496104_1607780 3300048907 Unclassified 552
163 Ga0496105_0863182 3300048908 Unclassified 684
164 Ga0496109_0647413 3300048912 Bacteria 994
165 Ga0496109_1448137 3300048912 Bacteria 622
166 Ga0496113_0597884 3300048916 Bacteria 883
167 Ga0496114_0639986 3300048917 Bacteria 936
168 Ga0501031_0538715 3300049568 Bacteria 752
169 Ga0501033_0461935 3300049570 Bacteria 881
170 Ga0501034_0051471 3300049571 Bacteria 4152
171 Ga0501034_0142703 3300049571 Bacteria 2373
172 Ga0501034_0168624 3300049571 Bacteria 2157
173 Ga0501034_0463786 3300049571 Bacteria 1183
174 Ga0501034_1100950 3300049571 Bacteria 675
175 Ga0501037_0134832 3300049573 Bacteria 1769
176 Ga0501038_0292467 3300049574 Bacteria 1280
177 Ga0501039_0311792 3300049575 Bacteria 1237
178 Ga0501041_0029925 3300049577 Bacteria 3286
179 Ga0501041_0700771 3300049577 Bacteria 648
180 Ga0501042_0111087 3300049578 Bacteria 1974
181 Ga0501042_0154876 3300049578 Bacteria 1653
182 Ga0501042_0304781 3300049578 Bacteria 1151
183 Ga0501043_0319589 3300049579 Bacteria 1184
184 Ga0501043_0463965 3300049579 Bacteria 950
185 Ga0501043_0577023 3300049579 Bacteria 833
186 Ga0501046_0414304 3300049580 Bacteria 972
187 Ga0501046_0605922 3300049580 Bacteria 777
188 Ga0501047_0060761 3300049581 Bacteria 3646
189 Ga0501048_0282317 3300049582 Unclassified 1181
190 Ga0501048_0501680 3300049582 Bacteria 870
191 Ga0501070_0630019 3300049586 Bacteria 853
192 Ga0501071_0212356 3300049587 Bacteria 1455
193 Ga0501071_0386733 3300049587 Unclassified 1067
194 Ga0501072_0179032 3300049588 Bacteria 1691
195 Ga0501074_0786910 3300049590 Bacteria 670
196 Ga0501075_0041433 3300049591 Bacteria 3451
197 Ga0501075_0063444 3300049591 Bacteria 2785
198 Ga0501076_0010201 3300049592 Bacteria 6963
199 Ga0501076_0316447 3300049592 Bacteria 1280
200 Ga0501076_1526041 3300049592 Bacteria 548
201 Ga0501077_0249805 3300049593 Unclassified 1128
202 Ga0501079_0782562 3300049741 Bacteria 751
203 Ga0501081_0025668 3300049743 Bacteria 3967
204 Ga0501081_0371103 3300049743 Bacteria 1056
205 Ga0501035_0087858 3300049822 Bacteria 2740
206 Ga0501035_1029748 3300049822 Bacteria 646
207 Ga0501045_0012321 3300049824 Bacteria 6020
208 Ga0501045_0102613 3300049824 Bacteria 2117
209 nmdc:mga05p37_10489_c1 3300050507 Bacteria 10994
210 nmdc:mga05p37_2065677_c1 3300050507 Archaea 536
211 nmdc:mga0qj67_1848_c1 3300050509 Bacteria 14996
212 nmdc:mga0qj67_268827_c1 3300050509 Bacteria 1382
213 nmdc:mga0qj67_80694_c1 3300050509 Bacteria 2607
214 nmdc:mga06r32_493993_c1 3300050510 Bacteria 1201
215 nmdc:mga06r32_910091_c1 3300050510 Bacteria 836
216 nmdc:mga08y16_11391_c1 3300050511 Bacteria 9345
217 nmdc:mga0rr50_710316_c1 3300050513 Bacteria 858
218 nmdc:mga0a205_419012_c1 3300050515 Bacteria 1201
219 Ga0495601_0407152 3300053077 Bacteria 881
220 Ga0495655_0242721 3300053083 Unclassified 603
221 Ga0495595_0181751 3300053084 Bacteria 1043
222 Ga0495619_0060592 3300053085 Bacteria 2516
223 Ga0495619_0468991 3300053085 Bacteria 867
224 Ga0500556_0000473 3300053104 Bacteria 28229
225 Ga0500616_0007064 3300053153 Bacteria 7204
226 Ga0501084_0157384 3300054114 Bacteria 1916
227 Ga0501084_0194764 3300054114 Bacteria 1710
228 Ga0501084_0998474 3300054114 Unclassified 703
229 Ga0501082_0025762 3300060353 Bacteria 5068
230 Ga0530510_0151229 3300061734 Bacteria 1714
231 Ga0530510_0163908 3300061734 Bacteria 1645
232 Ga0530510_1449607 3300061734 Bacteria 527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10273965 Ga0307414_102739652 108
2 3300037471 Ga0395905_0244429 Ga0395905_0244429_790_1134 109
3 3300038443 Ga0395901_0316581 Ga0395901_0316581_439_783 109
4 3300049571 Ga0501034_1100950 Ga0501034_1100950_23_358 109
5 3300054114 Ga0501084_0157384 Ga0501084_0157384_1540_1878 109
6 3300005981 Ga0081538_10109854 Ga0081538_101098542 112
7 3300046615 Ga0495656_0575127 Ga0495656_0575127_95_442 112
8 3300049577 Ga0501041_0700771 Ga0501041_0700771_173_520 112
9 3300049578 Ga0501042_0111087 Ga0501042_0111087_457_804 112
10 3300049582 Ga0501048_0282317 Ga0501048_0282317_606_953 112
11 3300049587 Ga0501071_0386733 Ga0501071_0386733_516_863 112
12 3300049592 Ga0501076_0316447 Ga0501076_0316447_598_945 112
13 3300049593 Ga0501077_0249805 Ga0501077_0249805_267_614 112
14 3300049743 Ga0501081_0025668 Ga0501081_0025668_3573_3920 112
15 3300050509 nmdc:mga0qj67_268827_c1 nmdc:mga0qj67_268827_c1_266_613 112
16 3300050510 nmdc:mga06r32_493993_c1 nmdc:mga06r32_493993_c1_617_964 112
17 3300054114 Ga0501084_0998474 Ga0501084_0998474_76_423 112
18 3300005327 Ga0070658_10122145 Ga0070658_101221454 118
19 3300005366 Ga0070659_100024819 Ga0070659_1000248193 118
20 3300031548 Ga0307408_100697146 Ga0307408_1006971461 119
21 3300031995 Ga0307409_100092294 Ga0307409_1000922943 119
22 3300032126 Ga0307415_100065028 Ga0307415_1000650283 119
23 3300006844 Ga0075428_100625665 Ga0075428_1006256652 120
24 3300049581 Ga0501047_0060761 Ga0501047_0060761_2144_2506 120
25 3300005336 Ga0070680_100000974 Ga0070680_1000009745 125
26 3300005336 Ga0070680_100970130 Ga0070680_1009701302 125
27 3300005337 Ga0070682_100626174 Ga0070682_1006261742 125
28 3300005339 Ga0070660_100052744 Ga0070660_1000527442 125
29 3300005339 Ga0070660_100432611 Ga0070660_1004326112 125
30 3300005339 Ga0070660_101059566 Ga0070660_1010595661 125
31 3300005344 Ga0070661_100589236 Ga0070661_1005892362 125
32 3300005441 Ga0070700_101208270 Ga0070700_1012082702 125
33 3300005458 Ga0070681_10008987 Ga0070681_100089872 125
34 3300005458 Ga0070681_10089888 Ga0070681_100898884 125
35 3300005530 Ga0070679_100220773 Ga0070679_1002207732 125
36 3300005535 Ga0070684_100004662 Ga0070684_1000046626 125
37 3300005535 Ga0070684_100166157 Ga0070684_1001661574 125
38 3300005549 Ga0070704_101599532 Ga0070704_1015995321 125
39 3300005564 Ga0070664_100105815 Ga0070664_1001058154 125
40 3300005577 Ga0068857_100051515 Ga0068857_1000515152 125
41 3300005614 Ga0068856_100027207 Ga0068856_1000272073 125
42 3300005616 Ga0068852_100006564 Ga0068852_1000065646 125
43 3300005719 Ga0068861_101143795 Ga0068861_1011437952 125
44 3300006058 Ga0075432_10135488 Ga0075432_101354881 125
45 3300006852 Ga0075433_10043707 Ga0075433_100437074 125
46 3300006880 Ga0075429_100320071 Ga0075429_1003200713 125
47 3300009093 Ga0105240_10050131 Ga0105240_100501313 125
48 3300009098 Ga0105245_10763140 Ga0105245_107631402 125
49 3300009545 Ga0105237_10116170 Ga0105237_101161704 125
50 3300009551 Ga0105238_10093371 Ga0105238_100933714 125
51 3300009551 Ga0105238_11012517 Ga0105238_110125172 125
52 3300013104 Ga0157370_10006797 Ga0157370_100067975 125
53 3300013105 Ga0157369_10006146 Ga0157369_100061466 125
54 3300013307 Ga0157372_10015575 Ga0157372_100155752 125
55 3300025919 Ga0207657_10392249 Ga0207657_103922493 125
56 3300025920 Ga0207649_10907962 Ga0207649_109079621 125
57 3300025927 Ga0207687_10570269 Ga0207687_105702692 125
58 3300025960 Ga0207651_11155110 Ga0207651_111551102 125
59 3300025986 Ga0207658_11121335 Ga0207658_111213352 125
60 3300027907 Ga0207428_10071498 Ga0207428_100714984 125
61 3300037466 Ga0395898_1447994 Ga0395898_1447994_13_399 125
62 3300045976 Ga0466967_0047784 Ga0466967_0047784_528_944 125
63 3300048905 Ga0496102_0363842 Ga0496102_0363842_119_508 125
64 3300049568 Ga0501031_0538715 Ga0501031_0538715_214_600 125
65 3300049570 Ga0501033_0461935 Ga0501033_0461935_319_705 125
66 3300049573 Ga0501037_0134832 Ga0501037_0134832_1151_1537 125
67 3300049575 Ga0501039_0311792 Ga0501039_0311792_447_836 125
68 3300049578 Ga0501042_0154876 Ga0501042_0154876_463_849 125
69 3300049579 Ga0501043_0577023 Ga0501043_0577023_275_661 125
70 3300049580 Ga0501046_0414304 Ga0501046_0414304_170_556 125
71 3300049582 Ga0501048_0501680 Ga0501048_0501680_437_823 125
72 3300049588 Ga0501072_0179032 Ga0501072_0179032_326_712 125
73 3300049590 Ga0501074_0786910 Ga0501074_0786910_91_477 125
74 3300049591 Ga0501075_0063444 Ga0501075_0063444_1855_2241 125
75 3300049592 Ga0501076_1526041 Ga0501076_1526041_74_460 125
76 3300049741 Ga0501079_0782562 Ga0501079_0782562_269_655 125
77 3300049743 Ga0501081_0371103 Ga0501081_0371103_71_457 125
78 3300049824 Ga0501045_0012321 Ga0501045_0012321_678_1064 125
79 3300050509 nmdc:mga0qj67_1848_c1 nmdc:mga0qj67_1848_c1_11174_11563 125
80 3300054114 Ga0501084_0194764 Ga0501084_0194764_654_1040 125
81 3300061734 Ga0530510_1449607 Ga0530510_1449607_73_459 125
82 3300020081 Ga0206354_11291395 Ga0206354_112913952 126
83 3300025912 Ga0207707_10012803 Ga0207707_100128038 126
84 3300025913 Ga0207695_10037223 Ga0207695_100372233 126
85 3300025917 Ga0207660_10004983 Ga0207660_100049836 126
86 3300025919 Ga0207657_10068201 Ga0207657_100682014 126
87 3300025920 Ga0207649_10498612 Ga0207649_104986121 126
88 3300025921 Ga0207652_10006267 Ga0207652_100062672 126
89 3300025932 Ga0207690_10308101 Ga0207690_103081012 126
90 3300025944 Ga0207661_10008045 Ga0207661_100080452 126
91 3300025945 Ga0207679_10469840 Ga0207679_104698402 126
92 3300025949 Ga0207667_10111567 Ga0207667_101115673 126
93 3300025981 Ga0207640_10683330 Ga0207640_106833302 126
94 3300026116 Ga0207674_10146876 Ga0207674_101468765 126
95 3300026142 Ga0207698_10008285 Ga0207698_100082853 126
96 3300005535 Ga0070684_100058775 Ga0070684_1000587752 127
97 3300007076 Ga0075435_100379490 Ga0075435_1003794902 127
98 3300053085 Ga0495619_0468991 Ga0495619_0468991_256_654 127
99 3300049571 Ga0501034_0168624 Ga0501034_0168624_1440_1832 128
100 3300005329 Ga0070683_100773696 Ga0070683_1007736962 129
101 3300005535 Ga0070684_100029925 Ga0070684_1000299255 129
102 3300005615 Ga0070702_100956135 Ga0070702_1009561352 129
103 3300005981 Ga0081538_10011541 Ga0081538_100115418 129
104 3300025935 Ga0207709_10333493 Ga0207709_103334933 129
105 3300025944 Ga0207661_10616874 Ga0207661_106168742 129
106 3300028380 Ga0268265_11142207 Ga0268265_111422072 129
107 3300044706 Ga0466964_0462410 Ga0466964_0462410_131_529 129
108 3300045976 Ga0466967_1496008 Ga0466967_1496008_257_661 129
109 3300049571 Ga0501034_0142703 Ga0501034_0142703_318_716 130
110 3300049579 Ga0501043_0319589 Ga0501043_0319589_36_434 130
111 3300049822 Ga0501035_1029748 Ga0501035_1029748_192_590 130
112 3300003373 JGI25407J50210_10055444 JGI25407J50210_100554442 131
113 3300005544 Ga0070686_100623079 Ga0070686_1006230791 131
114 3300005614 Ga0068856_100049110 Ga0068856_1000491104 131
115 3300005937 Ga0081455_10010164 Ga0081455_100101642 131
116 3300005981 Ga0081538_10000438 Ga0081538_1000043816 131
117 3300005981 Ga0081538_10003722 Ga0081538_100037229 131
118 3300005981 Ga0081538_10034433 Ga0081538_100344331 131
119 3300006847 Ga0075431_100125878 Ga0075431_1001258784 131
120 3300009094 Ga0111539_10027154 Ga0111539_100271544 131
121 3300009098 Ga0105245_10311913 Ga0105245_103119134 131
122 3300009148 Ga0105243_10494512 Ga0105243_104945122 131
123 3300012476 Ga0157344_1009712 Ga0157344_10097122 131
124 3300021377 Ga0213874_10050402 Ga0213874_100504022 131
125 3300025907 Ga0207645_10275281 Ga0207645_102752812 131
126 3300025932 Ga0207690_11031292 Ga0207690_110312922 131
127 3300025944 Ga0207661_12179397 Ga0207661_121793971 131
128 3300031548 Ga0307408_100095366 Ga0307408_1000953664 131
129 3300031731 Ga0307405_10156959 Ga0307405_101569591 131
130 3300031824 Ga0307413_10060448 Ga0307413_100604483 131
131 3300031824 Ga0307413_10651057 Ga0307413_106510572 131
132 3300031852 Ga0307410_10068380 Ga0307410_100683804 131
133 3300031901 Ga0307406_10007438 Ga0307406_100074384 131
134 3300031901 Ga0307406_11217988 Ga0307406_112179881 131
135 3300031901 Ga0307406_11356085 Ga0307406_113560851 131
136 3300031903 Ga0307407_10061870 Ga0307407_100618701 131
137 3300031995 Ga0307409_100162284 Ga0307409_1001622844 131
138 3300031995 Ga0307409_100610611 Ga0307409_1006106112 131
139 3300031995 Ga0307409_102004249 Ga0307409_1020042492 131
140 3300032002 Ga0307416_100108265 Ga0307416_1001082653 131
141 3300032002 Ga0307416_100906380 Ga0307416_1009063803 131
142 3300032002 Ga0307416_101817905 Ga0307416_1018179052 131
143 3300032004 Ga0307414_10325377 Ga0307414_103253773 131
144 3300032126 Ga0307415_100102020 Ga0307415_1001020204 131
145 3300032126 Ga0307415_100134969 Ga0307415_1001349691 131
146 3300032126 Ga0307415_100975650 Ga0307415_1009756502 131
147 3300034819 Ga0373958_0023034 Ga0373958_0023034_166_570 131
148 3300035085 Ga0373929_0075824 Ga0373929_0075824_55_459 131
149 3300038443 Ga0395901_2011999 Ga0395901_2011999_73_477 131
150 3300039453 Ga0436362_0514246 Ga0436362_0514246_525_953 131
151 3300042002 Ga0439442_010504 Ga0439442_010504_825_1379 131
152 3300044656 Ga0466969_0007443 Ga0466969_0007443_4940_5350 131
153 3300044684 Ga0466966_0039114 Ga0466966_0039114_950_1360 131
154 3300044684 Ga0466966_0546813 Ga0466966_0546813_162_563 131
155 3300044694 Ga0466963_0810412 Ga0466963_0810412_41_466 131
156 3300044842 Ga0466957_1001060 Ga0466957_1001060_187_588 131
157 3300044901 Ga0466960_0255803 Ga0466960_0255803_381_788 131
158 3300045049 Ga0466959_0033077 Ga0466959_0033077_3395_3805 131
159 3300045976 Ga0466967_0424862 Ga0466967_0424862_45_443 131
160 3300045976 Ga0466967_1898533 Ga0466967_1898533_110_511 131
161 3300046491 Ga0495584_0339340 Ga0495584_0339340_250_654 131
162 3300046513 Ga0495616_0111150 Ga0495616_0111150_572_976 131
163 3300046538 Ga0495609_0225173 Ga0495609_0225173_337_741 131
164 3300046689 Ga0495613_0059598 Ga0495613_0059598_475_885 131
165 3300048905 Ga0496102_1345893 Ga0496102_1345893_55_450 131
166 3300048912 Ga0496109_0647413 Ga0496109_0647413_360_755 131
167 3300048912 Ga0496109_1448137 Ga0496109_1448137_12_413 131
168 3300049571 Ga0501034_0051471 Ga0501034_0051471_1575_1976 131
169 3300049571 Ga0501034_0463786 Ga0501034_0463786_349_750 131
170 3300049574 Ga0501038_0292467 Ga0501038_0292467_213_617 131
171 3300049577 Ga0501041_0029925 Ga0501041_0029925_2195_2599 131
172 3300049578 Ga0501042_0304781 Ga0501042_0304781_314_718 131
173 3300049579 Ga0501043_0463965 Ga0501043_0463965_333_737 131
174 3300049580 Ga0501046_0605922 Ga0501046_0605922_125_529 131
175 3300049586 Ga0501070_0630019 Ga0501070_0630019_131_532 131
176 3300049587 Ga0501071_0212356 Ga0501071_0212356_519_923 131
177 3300049591 Ga0501075_0041433 Ga0501075_0041433_2823_3227 131
178 3300049592 Ga0501076_0010201 Ga0501076_0010201_1565_1969 131
179 3300049822 Ga0501035_0087858 Ga0501035_0087858_78_482 131
180 3300049824 Ga0501045_0102613 Ga0501045_0102613_229_633 131
181 3300050507 nmdc:mga05p37_10489_c1 nmdc:mga05p37_10489_c1_2032_2436 131
182 3300050507 nmdc:mga05p37_2065677_c1 nmdc:mga05p37_2065677_c1_83_487 131
183 3300050509 nmdc:mga0qj67_80694_c1 nmdc:mga0qj67_80694_c1_462_866 131
184 3300050510 nmdc:mga06r32_910091_c1 nmdc:mga06r32_910091_c1_251_655 131
185 3300050511 nmdc:mga08y16_11391_c1 nmdc:mga08y16_11391_c1_6686_7090 131
186 3300050515 nmdc:mga0a205_419012_c1 nmdc:mga0a205_419012_c1_31_435 131
187 3300053083 Ga0495655_0242721 Ga0495655_0242721_82_486 131
188 3300053104 Ga0500556_0000473 Ga0500556_0000473_4549_4944 131
189 3300053153 Ga0500616_0007064 Ga0500616_0007064_589_984 131
190 3300060353 Ga0501082_0025762 Ga0501082_0025762_3031_3435 131
191 3300061734 Ga0530510_0151229 Ga0530510_0151229_463_867 131
192 3300001977 JGI24746J21847_1001270 JGI24746J21847_10012703 132
193 3300003659 JGI25404J52841_10004168 JGI25404J52841_100041683 132
194 3300005336 Ga0070680_100116944 Ga0070680_1001169443 132
195 3300005441 Ga0070700_100200852 Ga0070700_1002008523 132
196 3300005458 Ga0070681_10333684 Ga0070681_103336843 132
197 3300005530 Ga0070679_100525841 Ga0070679_1005258412 132
198 3300009094 Ga0111539_13084433 Ga0111539_130844331 132
199 3300010375 Ga0105239_11643816 Ga0105239_116438162 132
200 3300013308 Ga0157375_10005884 Ga0157375_100058849 132
201 3300020082 Ga0206353_11023674 Ga0206353_110236742 132
202 3300021384 Ga0213876_10051450 Ga0213876_100514502 132
203 3300025912 Ga0207707_10140097 Ga0207707_101400974 132
204 3300025917 Ga0207660_10585326 Ga0207660_105853263 132
205 3300025921 Ga0207652_10211615 Ga0207652_102116152 132
206 3300039093 Ga0400489_50394 Ga0400489_50394_4152_4553 132
207 3300044712 Ga0453684_0102710 Ga0453684_0102710_1899_2309 132
208 3300044901 Ga0466960_0813563 Ga0466960_0813563_89_499 132
209 3300045976 Ga0466967_0611056 Ga0466967_0611056_231_650 132
210 3300046461 Ga0495641_0049824 Ga0495641_0049824_431_829 132
211 3300046514 Ga0495618_0070377 Ga0495618_0070377_928_1347 132
212 3300046516 Ga0495628_0476643 Ga0495628_0476643_312_731 132
213 3300046517 Ga0495630_0754917 Ga0495630_0754917_28_447 132
214 3300046533 Ga0495640_0030116 Ga0495640_0030116_512_931 132
215 3300046539 Ga0495621_0000298 Ga0495621_0000298_3806_4222 132
216 3300046543 Ga0495645_0068702 Ga0495645_0068702_261_689 132
217 3300046559 Ga0495667_0036050 Ga0495667_0036050_1583_2002 132
218 3300046809 Ga0495600_0925550 Ga0495600_0925550_11_430 132
219 3300047322 Ga0495680_0426162 Ga0495680_0426162_214_633 132
220 3300047444 Ga0495675_0334828 Ga0495675_0334828_343_771 132
221 3300048088 Ga0495602_0491483 Ga0495602_0491483_280_708 132
222 3300048903 Ga0496100_0000105 Ga0496100_0000105_24440_24883 132
223 3300048904 Ga0496101_0858483 Ga0496101_0858483_123_530 132
224 3300048907 Ga0496104_1607780 Ga0496104_1607780_28_435 132
225 3300048908 Ga0496105_0863182 Ga0496105_0863182_157_564 132
226 3300048916 Ga0496113_0597884 Ga0496113_0597884_388_804 132
227 3300048917 Ga0496114_0639986 Ga0496114_0639986_384_791 132
228 3300050513 nmdc:mga0rr50_710316_c1 nmdc:mga0rr50_710316_c1_82_516 132
229 3300053077 Ga0495601_0407152 Ga0495601_0407152_12_440 132
230 3300053084 Ga0495595_0181751 Ga0495595_0181751_130_549 132
231 3300053085 Ga0495619_0060592 Ga0495619_0060592_138_557 132
232 3300061734 Ga0530510_0163908 Ga0530510_0163908_228_635 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13456

RVT_3

Reverse transcriptase-like

23

148

0.91

PF00075

RNase_H

RNase H

17

150

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e19-assembly2.cif.gz_B crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 0.9918 3 131
3hst-assembly2.cif.gz_B n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9708 1 131
3hst-assembly4.cif.gz_D n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9689 3 131
4h8k-assembly1.cif.gz_B crystal structure of lc11-rnase h1 in complex with rna/dna hybrid 0.9565 4 131
3hst-assembly2.cif.gz_B n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9565 1 131
ID Description Score Start End Superfamily
4e19A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9844 1 131 3.30.420.10
af_A0A0R0FBC1_213_345_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9735 4 132 3.30.420.10
4e19A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9698 1 131 3.30.420.10
3hstD00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9689 3 131 3.30.420.10
af_A0A0P0X025_51_179_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9556 3 128 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A640Y9W2-F1-model_v4 Reverse transcriptase-like protein 1.002 3 131 GO:0003676
GO:0003964
GO:0004523
AF-A0A0G1CDZ1-F1-model_v4 Ribonuclease H 0.9988 3 131 GO:0003676
GO:0004523
AF-A0A3A4NTK6-F1-model_v4 Reverse transcriptase-like protein 0.9979 3 131 GO:0003676
GO:0003964
GO:0004523
AF-A0A0G1SED6-F1-model_v4 Bifunctional RNase H/acid phosphatase 0.9976 5 131 GO:0003676
GO:0004523
AF-A0A2H0YGB1-F1-model_v4 Ribonuclease H 0.9972 3 131 GO:0003676
GO:0004523

Feature Viewer

pLDDT pTM Quality
97.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map