F344857

General Info

Members Datasets Scaffolds Average Seq Length
232 152 224 167

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100178928|Ga0068855_1001789281
Length 193
Sequence LYQFFVAYSALIRCNTRILNCQLNYRYPHMKKLILIAFIAAFTLSARAQEQPKIYNPDADAKAEIKTAVKQAAQQHKNVLLQIGGNWCILCLRFNDLVTKDADLNKYLNDNYVVLHVNYSKENENKAVLADLGYPQRFGFPVFVVLDDKGARLHTQNSGYLEEGKGHSKEKVMGFLKDWSPAAVDPKSYEKAK

Samples

Sample ID Description Type Environment
1 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
6 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
94 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
95 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
96 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
105 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
143 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
144 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
149 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
152 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 0
Isolates 3.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.48
Nodule 0
Rhizoplane 0.43
Rhizosphere 82.33
Stem 0
Stem Tuber 0
Unclassified 7.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1031447 3300001904 Bacteria 820
2 JGI24744J21845_10019887 3300002077 Bacteria 1327
3 JGI25162J39368_1000086 3300002737 Bacteria 107401
4 JGI25162J39368_1001835 3300002737 Bacteria 9910
5 JGI25164J39214_1001641 3300002772 Bacteria 4637
6 JGI25406J46586_10235595 3300003203 Unclassified 536
7 JGI25165J46597_1001084 3300003214 Bacteria 17396
8 rootL2_10264954 3300003322 Bacteria 1486
9 rootH1_10006508 3300003323 Bacteria 33986
10 rootH1_10078320 3300003323 Bacteria 10694
11 rootH1_10111148 3300003323 Bacteria 14771
12 Ga0065714_10002433 3300005288 Bacteria 17794
13 Ga0065714_10017210 3300005288 Bacteria 2111
14 Ga0065714_10081308 3300005288 Bacteria 2379
15 Ga0065704_10247870 3300005289 Bacteria 990
16 Ga0065715_10634566 3300005293 Bacteria 617
17 Ga0070658_10327348 3300005327 Unclassified 1309
18 Ga0070676_10189916 3300005328 Bacteria 1341
19 Ga0070666_10182516 3300005335 Bacteria 1472
20 Ga0070680_101076158 3300005336 Unclassified 695
21 Ga0070682_100000018 3300005337 Bacteria 229427
22 Ga0070682_100800926 3300005337 Bacteria 765
23 Ga0070675_101207315 3300005354 Bacteria 696
24 Ga0070674_100041233 3300005356 Bacteria 3127
25 Ga0070674_100244200 3300005356 Bacteria 1407
26 Ga0070688_100878036 3300005365 Bacteria 706
27 Ga0070679_100197332 3300005530 Bacteria 1979
28 Ga0070679_100649875 3300005530 Bacteria 997
29 Ga0070684_100854920 3300005535 Unclassified 852
30 Ga0068853_100106967 3300005539 Bacteria 2480
31 Ga0068853_100557127 3300005539 Bacteria 1086
32 Ga0070672_100192526 3300005543 Bacteria 1703
33 Ga0070672_100272372 3300005543 Bacteria 1430
34 Ga0070686_100145725 3300005544 Unclassified 1653
35 Ga0070686_100218735 3300005544 Bacteria 1375
36 Ga0070665_100001998 3300005548 Bacteria 22944
37 Ga0070665_101023016 3300005548 Bacteria 838
38 Ga0068855_100178928 3300005563 Bacteria 2398
39 Ga0068855_100431674 3300005563 Bacteria 1440
40 Ga0068857_100348917 3300005577 Bacteria 1370
41 Ga0068857_101475371 3300005577 Bacteria 662
42 Ga0068854_100174634 3300005578 Unclassified 1674
43 Ga0068856_100026889 3300005614 Bacteria 5612
44 Ga0068856_100029497 3300005614 Bacteria 5359
45 Ga0068859_100002309 3300005617 Bacteria 19382
46 Ga0068851_10116628 3300005834 Bacteria 1431
47 Ga0068851_10378065 3300005834 Bacteria 829
48 Ga0068863_101640173 3300005841 Bacteria 652
49 Ga0068863_102067409 3300005841 Bacteria 580
50 Ga0081539_10085533 3300005985 Bacteria 1644
51 Ga0075366_10000228 3300006195 Bacteria 24971
52 Ga0097621_100097709 3300006237 Bacteria 2466
53 Ga0068871_101973846 3300006358 Bacteria 555
54 Ga0097620_100002309 3300006931 Bacteria 19382
55 Ga0105240_10000138 3300009093 Bacteria 149330
56 Ga0105240_10173149 3300009093 Unclassified 2554
57 Ga0105240_10214430 3300009093 Bacteria 2247
58 Ga0105240_10229847 3300009093 Unclassified 2156
59 Ga0105240_10525178 3300009093 Bacteria 1313
60 Ga0105245_10795010 3300009098 Unclassified 984
61 Ga0105245_10993927 3300009098 Bacteria 883
62 Ga0105241_10696921 3300009174 Bacteria 927
63 Ga0105241_10946998 3300009174 Bacteria 802
64 Ga0105237_10000621 3300009545 Bacteria 49573
65 Ga0105237_10139891 3300009545 Bacteria 2415
66 Ga0105237_10189913 3300009545 Bacteria 2054
67 Ga0105237_10555953 3300009545 Bacteria 1154
68 Ga0105238_10302291 3300009551 Bacteria 1584
69 Ga0105238_11108881 3300009551 Bacteria 814
70 Ga0105239_10000674 3300010375 Bacteria 48668
71 Ga0105239_10001541 3300010375 Bacteria 30447
72 Ga0105239_10004652 3300010375 Bacteria 16316
73 Ga0105239_10029272 3300010375 Bacteria 6056
74 Ga0105239_10062632 3300010375 Bacteria 4082
75 Ga0105239_10101570 3300010375 Bacteria 3182
76 Ga0105239_10119221 3300010375 Bacteria 2929
77 Ga0105239_10172511 3300010375 Bacteria 2419
78 Ga0157371_10000753 3300013102 Bacteria 37487
79 Ga0157371_10001536 3300013102 Bacteria 23766
80 Ga0157370_10043653 3300013104 Bacteria 4313
81 Ga0157370_10844281 3300013104 Bacteria 832
82 Ga0157369_10177452 3300013105 Unclassified 2242
83 Ga0157374_10061183 3300013296 Bacteria 3526
84 Ga0157378_11511385 3300013297 Bacteria 716
85 Ga0163162_10748308 3300013306 Bacteria 1097
86 Ga0157372_10118360 3300013307 Bacteria 3039
87 Ga0157372_10160215 3300013307 Bacteria 2600
88 Ga0157372_10177220 3300013307 Bacteria 2467
89 Ga0157375_10389326 3300013308 Bacteria 1561
90 Ga0157375_10459559 3300013308 Bacteria 1439
91 Ga0157375_11118605 3300013308 Bacteria 922
92 Ga0157380_10002522 3300014326 Bacteria 12353
93 Ga0182008_10000025 3300014497 Bacteria 191222
94 Ga0157379_11184452 3300014968 Unclassified 734
95 Ga0157376_10515447 3300014969 Bacteria 1178
96 Ga0209563_105443 3300025230 Unclassified 2308
97 Ga0207427_100072 3300025231 Bacteria 158364
98 Ga0209437_100026 3300025233 Bacteria 542698
99 Ga0209437_100144 3300025233 Bacteria 164794
100 Ga0209026_1001447 3300025250 Bacteria 10487
101 Ga0209148_1026836 3300025254 Bacteria 890
102 Ga0209233_1000111 3300025261 Bacteria 260262
103 Ga0209455_1002664 3300025272 Bacteria 6725
104 Ga0207680_10247682 3300025903 Bacteria 1230
105 Ga0207647_10016688 3300025904 Bacteria 5005
106 Ga0207645_10129325 3300025907 Bacteria 1643
107 Ga0207654_10178935 3300025911 Archaea 1382
108 Ga0207695_10000064 3300025913 Bacteria 346010
109 Ga0207695_10004186 3300025913 Bacteria 19828
110 Ga0207695_10109882 3300025913 Bacteria 2738
111 Ga0207695_11260134 3300025913 Bacteria 620
112 Ga0207671_10000588 3300025914 Bacteria 48606
113 Ga0207671_10005374 3300025914 Bacteria 11834
114 Ga0207671_10029708 3300025914 Bacteria 4079
115 Ga0207671_10053495 3300025914 Bacteria 2992
116 Ga0207671_10166796 3300025914 Bacteria 1708
117 Ga0207652_10511651 3300025921 Unclassified 1080
118 Ga0207681_10152429 3300025923 Bacteria 1734
119 Ga0207659_11048286 3300025926 Bacteria 702
120 Ga0207687_11522355 3300025927 Unclassified 574
121 Ga0207669_10059848 3300025937 Bacteria 2332
122 Ga0207669_10239312 3300025937 Bacteria 1344
123 Ga0207661_10884498 3300025944 Bacteria 823
124 Ga0207640_10007829 3300025981 Bacteria 5899
125 Ga0207640_10928199 3300025981 Bacteria 762
126 Ga0207639_10070282 3300026041 Bacteria 2734
127 Ga0207639_10228204 3300026041 Bacteria 1612
128 Ga0207639_10798358 3300026041 Bacteria 879
129 Ga0207678_10113844 3300026067 Bacteria 2308
130 Ga0207702_10024540 3300026078 Bacteria 5003
131 Ga0207702_10326252 3300026078 Unclassified 1463
132 Ga0207641_11550164 3300026088 Bacteria 664
133 Ga0207676_11134235 3300026095 Bacteria 774
134 Ga0207674_10752301 3300026116 Unclassified 941
135 Ga0207698_10313591 3300026142 Bacteria 1466
136 Ga0207698_10315219 3300026142 Bacteria 1462
137 Ga0268266_10001978 3300028379 Bacteria 22975
138 Ga0268266_11312540 3300028379 Bacteria 699
139 Ga0307515_10001558 3300028794 Bacteria 51155
140 Ga0307515_10082599 3300028794 Bacteria 4152
141 Ga0316177_1201839 3300030731 Bacteria 11164
142 Ga0316183_1100732 3300030742 Bacteria 40906
143 Ga0316181_1231306 3300030744 Bacteria 13138
144 Ga0316182_1256317 3300030745 Bacteria 1556
145 Ga0265327_10000060 3300031251 Bacteria 234933
146 Ga0265327_10000239 3300031251 Bacteria 109804
147 Ga0265327_10048390 3300031251 Bacteria 2237
148 Ga0307509_10193829 3300031507 Bacteria 1879
149 Ga0307509_10776924 3300031507 Unclassified 623
150 Ga0316579_10340023 3300031691 Unclassified 726
151 Ga0316576_10137457 3300031727 Bacteria 1839
152 Ga0316578_10027794 3300031728 Bacteria 3199
153 Ga0307413_11093517 3300031824 Bacteria 688
154 Ga0307413_11376380 3300031824 Bacteria 620
155 Ga0307414_10001858 3300032004 Bacteria 10921
156 Ga0316585_10052542 3300032137 Bacteria 1309
157 Ga0316580_10117148 3300032139 Bacteria 816
158 Ga0307507_10001430 3300033179 Bacteria 53551
159 Ga0373955_0643835 3300035172 Bacteria 650
160 Ga0316574_0537196 3300035398 Bacteria 727
161 Ga0316574_0720079 3300035398 Unclassified 611
162 Ga0373935_0208050 3300035692 Bacteria 1355
163 Ga0316582_0034771 3300036647 Bacteria 3106
164 Ga0395905_0000051 3300037471 Bacteria 223416
165 Ga0395905_1051906 3300037471 Bacteria 717
166 Ga0400483_221147 3300039062 Bacteria 45784
167 Ga0436365_1268336 3300039437 Bacteria 2410
168 Ga0436365_1270722 3300039437 Bacteria 6207
169 Ga0436365_1387367 3300039437 Bacteria 554
170 Ga0451807_2000955 3300041486 Bacteria 893
171 Ga0439431_0004105 3300041997 Bacteria 3203
172 Ga0439445_0004861 3300042004 Bacteria 3051
173 Ga0466972_0000025 3300044658 Bacteria 186601
174 Ga0466972_0022334 3300044658 Bacteria 3152
175 Ga0453684_0007464 3300044712 Bacteria 20079
176 Ga0453684_0569033 3300044712 Bacteria 1246
177 Ga0466970_0000671 3300044765 Bacteria 16793
178 Ga0466970_0155647 3300044765 Bacteria 1263
179 Ga0466959_0017453 3300045049 Bacteria 5262
180 Ga0451576_0245201 3300045051 Bacteria 1872
181 Ga0451576_1177369 3300045051 Unclassified 801
182 Ga0495629_0450602 3300046459 Bacteria 871
183 Ga0495585_0000092 3300046492 Bacteria 94819
184 Ga0495606_0027855 3300046507 Bacteria 3997
185 Ga0495616_0088477 3300046513 Bacteria 1470
186 Ga0495631_0029221 3300046518 Bacteria 2509
187 Ga0495648_0002222 3300046524 Bacteria 18146
188 Ga0495648_0302626 3300046524 Bacteria 748
189 Ga0495663_0053930 3300046525 Bacteria 1251
190 Ga0495598_0043354 3300046537 Bacteria 1325
191 Ga0495609_0004224 3300046538 Bacteria 7941
192 Ga0495633_0000004 3300046558 Bacteria 370781
193 Ga0495668_0000058 3300046616 Bacteria 195501
194 Ga0495668_0000172 3300046616 Bacteria 96882
195 Ga0495668_0000789 3300046616 Bacteria 36732
196 Ga0495625_0001505 3300046660 Bacteria 28001
197 Ga0495625_0001746 3300046660 Bacteria 25142
198 Ga0495625_0073268 3300046660 Bacteria 2401
199 Ga0495625_0084858 3300046660 Bacteria 2199
200 Ga0495658_0056427 3300046683 Bacteria 2240
201 Ga0495671_0406940 3300046692 Bacteria 651
202 Ga0495672_0036369 3300047320 Bacteria 3024
203 Ga0495672_0290873 3300047320 Unclassified 777
204 Ga0495686_0000414 3300047472 Bacteria 67712
205 Ga0495614_0048051 3300048089 Bacteria 1830
206 Ga0495626_0301183 3300048091 Bacteria 633
207 Ga0495682_0029374 3300049460 Bacteria 2036
208 Ga0501034_0029711 3300049571 Bacteria 5556
209 Ga0501261_012628 3300049690 Bacteria 1139
210 Ga0501219_000101 3300049703 Bacteria 14901
211 Ga0501269_002102 3300049766 Bacteria 2492
212 Ga0501269_009814 3300049766 Bacteria 1160
213 Ga0501035_0882065 3300049822 Unclassified 710
214 Ga0501284_00014 3300050005 Bacteria 114419
215 nmdc:mga0k408_167_c1 3300050493 Bacteria 34645
216 nmdc:mga0k408_407388_c1 3300050493 Bacteria 809
217 Ga0500618_000021 3300053125 Bacteria 160813
218 Ga0500642_0029309 3300053130 Bacteria 2279
219 Ga0500642_0281164 3300053130 Unclassified 756
220 Ga0500616_0001074 3300053153 Bacteria 28568
221 Ga0500622_0000623 3300053156 Bacteria 31909
222 Ga0500622_0022352 3300053156 Bacteria 3353
223 Ga0500622_0171992 3300053156 Unclassified 1008
224 Ga0500627_0005928 3300053158 Bacteria 4106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046537 Ga0495598_0043354 Ga0495598_0043354_712_1200 139
2 3300013308 Ga0157375_10389326 Ga0157375_103893262 144
3 3300025254 Ga0209148_1026836 Ga0209148_10268361 144
4 3300005293 Ga0065715_10634566 Ga0065715_106345661 146
5 3300025923 Ga0207681_10152429 Ga0207681_101524292 147
6 3300025914 Ga0207671_10053495 Ga0207671_100534951 149
7 3300025981 Ga0207640_10007829 Ga0207640_100078293 149
8 3300037471 Ga0395905_0000051 Ga0395905_0000051_153438_153947 149
9 3300053156 Ga0500622_0000623 Ga0500622_0000623_21659_22162 149
10 3300044712 Ga0453684_0007464 Ga0453684_0007464_10648_11106 152
11 3300045051 Ga0451576_0245201 Ga0451576_0245201_608_1066 152
12 3300005614 Ga0068856_100026889 Ga0068856_1000268893 154
13 3300005614 Ga0068856_100029497 Ga0068856_1000294973 154
14 3300026078 Ga0207702_10326252 Ga0207702_103262522 154
15 3300039437 Ga0436365_1270722 Ga0436365_1270722_2189_2653 154
16 3300005289 Ga0065704_10247870 Ga0065704_102478702 155
17 3300013102 Ga0157371_10001536 Ga0157371_100015365 155
18 3300013104 Ga0157370_10043653 Ga0157370_100436531 155
19 3300049703 Ga0501219_000101 Ga0501219_000101_537_1010 155
20 3300050005 Ga0501284_00014 Ga0501284_00014_55551_56024 155
21 3300005337 Ga0070682_100800926 Ga0070682_1008009262 156
22 3300003203 JGI25406J46586_10235595 JGI25406J46586_102355951 158
23 3300005985 Ga0081539_10085533 Ga0081539_100855333 158
24 3300031824 Ga0307413_11093517 Ga0307413_110935171 158
25 iso_pu_bacteria 2842903701 2842905075 158
26 3300049822 Ga0501035_0882065 Ga0501035_0882065_139_630 159
27 iso_pu_bacteria 2929154850 2929159039 159
28 3300005328 Ga0070676_10189916 Ga0070676_101899161 160
29 3300005543 Ga0070672_100192526 Ga0070672_1001925261 160
30 3300005577 Ga0068857_101475371 Ga0068857_1014753711 160
31 3300005841 Ga0068863_101640173 Ga0068863_1016401731 160
32 3300014497 Ga0182008_10000025 Ga0182008_10000025172 160
33 3300025907 Ga0207645_10129325 Ga0207645_101293253 160
34 3300026088 Ga0207641_11550164 Ga0207641_115501641 160
35 3300046616 Ga0495668_0000172 Ga0495668_0000172_77120_77614 160
36 iso_pu_bacteria 2775506987 2776615962 160
37 iso_pu_bacteria 2818991444 2819586463 160
38 iso_pu_bacteria 2852623160 2852625485 160
39 iso_pu_bacteria 2884933994 2884934489 160
40 iso_pu_bacteria 2911138879 2911140422 160
41 iso_pu_bacteria 2919437846 2919441531 160
42 3300003322 rootL2_10264954 rootL2_102649542 161
43 3300005288 Ga0065714_10002433 Ga0065714_100024338 161
44 3300005335 Ga0070666_10182516 Ga0070666_101825162 161
45 3300005365 Ga0070688_100878036 Ga0070688_1008780361 161
46 3300005617 Ga0068859_100002309 Ga0068859_10000230916 161
47 3300006237 Ga0097621_100097709 Ga0097621_1000977093 161
48 3300006931 Ga0097620_100002309 Ga0097620_10000230916 161
49 3300013104 Ga0157370_10844281 Ga0157370_108442811 161
50 3300013308 Ga0157375_10459559 Ga0157375_104595592 161
51 3300014969 Ga0157376_10515447 Ga0157376_105154472 161
52 3300025903 Ga0207680_10247682 Ga0207680_102476822 161
53 3300026041 Ga0207639_10228204 Ga0207639_102282042 161
54 3300026095 Ga0207676_11134235 Ga0207676_111342351 161
55 3300031251 Ga0265327_10000239 Ga0265327_1000023935 161
56 3300039062 Ga0400483_221147 Ga0400483_221147_12234_12731 161
57 3300002077 JGI24744J21845_10019887 JGI24744J21845_100198872 162
58 3300002737 JGI25162J39368_1000086 JGI25162J39368_100008643 162
59 3300003323 rootH1_10111148 rootH1_101111484 162
60 3300005288 Ga0065714_10017210 Ga0065714_100172103 162
61 3300005288 Ga0065714_10081308 Ga0065714_100813082 162
62 3300005354 Ga0070675_101207315 Ga0070675_1012073152 162
63 3300005539 Ga0068853_100106967 Ga0068853_1001069674 162
64 3300005563 Ga0068855_100178928 Ga0068855_1001789281 162
65 3300005578 Ga0068854_100174634 Ga0068854_1001746342 162
66 3300006195 Ga0075366_10000228 Ga0075366_1000022826 162
67 3300006358 Ga0068871_101973846 Ga0068871_1019738461 162
68 3300009545 Ga0105237_10555953 Ga0105237_105559531 162
69 3300010375 Ga0105239_10001541 Ga0105239_100015412 162
70 3300010375 Ga0105239_10029272 Ga0105239_100292722 162
71 3300013306 Ga0163162_10748308 Ga0163162_107483081 162
72 3300013307 Ga0157372_10118360 Ga0157372_101183604 162
73 3300025233 Ga0209437_100144 Ga0209437_10014466 162
74 3300025914 Ga0207671_10166796 Ga0207671_101667961 162
75 3300025926 Ga0207659_11048286 Ga0207659_110482861 162
76 3300026041 Ga0207639_10070282 Ga0207639_100702824 162
77 3300028794 Ga0307515_10001558 Ga0307515_1000155823 162
78 3300028794 Ga0307515_10082599 Ga0307515_100825994 162
79 3300030731 Ga0316177_1201839 Ga0316177_12018392 162
80 3300030742 Ga0316183_1100732 Ga0316183_110073227 162
81 3300030744 Ga0316181_1231306 Ga0316181_123130611 162
82 3300030745 Ga0316182_1256317 Ga0316182_12563172 162
83 3300033179 Ga0307507_10001430 Ga0307507_1000143041 162
84 3300035398 Ga0316574_0537196 Ga0316574_0537196_124_615 162
85 3300035692 Ga0373935_0208050 Ga0373935_0208050_95_583 162
86 3300044658 Ga0466972_0000025 Ga0466972_0000025_40359_40919 162
87 3300044765 Ga0466970_0000671 Ga0466970_0000671_3337_3897 162
88 3300046459 Ga0495629_0450602 Ga0495629_0450602_158_652 162
89 3300046492 Ga0495585_0000092 Ga0495585_0000092_79449_79943 162
90 3300046507 Ga0495606_0027855 Ga0495606_0027855_2536_3030 162
91 3300046513 Ga0495616_0088477 Ga0495616_0088477_386_880 162
92 3300046518 Ga0495631_0029221 Ga0495631_0029221_965_1459 162
93 3300046524 Ga0495648_0002222 Ga0495648_0002222_16236_16730 162
94 3300046524 Ga0495648_0302626 Ga0495648_0302626_48_542 162
95 3300046525 Ga0495663_0053930 Ga0495663_0053930_253_747 162
96 3300046538 Ga0495609_0004224 Ga0495609_0004224_5369_5863 162
97 3300046558 Ga0495633_0000004 Ga0495633_0000004_74458_74952 162
98 3300046616 Ga0495668_0000058 Ga0495668_0000058_143026_143520 162
99 3300046660 Ga0495625_0001505 Ga0495625_0001505_18251_18745 162
100 3300046660 Ga0495625_0001746 Ga0495625_0001746_809_1303 162
101 3300046660 Ga0495625_0084858 Ga0495625_0084858_635_1129 162
102 3300046683 Ga0495658_0056427 Ga0495658_0056427_1389_1883 162
103 3300046692 Ga0495671_0406940 Ga0495671_0406940_110_604 162
104 3300047320 Ga0495672_0036369 Ga0495672_0036369_30_521 162
105 3300048089 Ga0495614_0048051 Ga0495614_0048051_649_1143 162
106 3300048091 Ga0495626_0301183 Ga0495626_0301183_16_510 162
107 3300049460 Ga0495682_0029374 Ga0495682_0029374_1521_2015 162
108 3300049571 Ga0501034_0029711 Ga0501034_0029711_2424_2918 162
109 3300050493 nmdc:mga0k408_167_c1 nmdc:mga0k408_167_c1_1591_2085 162
110 3300053125 Ga0500618_000021 Ga0500618_000021_22511_23005 162
111 3300053156 Ga0500622_0022352 Ga0500622_0022352_1812_2315 162
112 3300005327 Ga0070658_10327348 Ga0070658_103273482 163
113 3300005336 Ga0070680_101076158 Ga0070680_1010761581 163
114 3300005337 Ga0070682_100000018 Ga0070682_10000001848 163
115 3300005356 Ga0070674_100041233 Ga0070674_1000412332 163
116 3300005530 Ga0070679_100197332 Ga0070679_1001973322 163
117 3300005535 Ga0070684_100854920 Ga0070684_1008549202 163
118 3300005539 Ga0068853_100557127 Ga0068853_1005571272 163
119 3300005543 Ga0070672_100272372 Ga0070672_1002723723 163
120 3300005544 Ga0070686_100218735 Ga0070686_1002187352 163
121 3300005577 Ga0068857_100348917 Ga0068857_1003489172 163
122 3300005834 Ga0068851_10116628 Ga0068851_101166282 163
123 3300005834 Ga0068851_10378065 Ga0068851_103780652 163
124 3300005841 Ga0068863_102067409 Ga0068863_1020674091 163
125 3300009098 Ga0105245_10795010 Ga0105245_107950102 163
126 3300013105 Ga0157369_10177452 Ga0157369_101774522 163
127 3300013296 Ga0157374_10061183 Ga0157374_100611833 163
128 3300013307 Ga0157372_10160215 Ga0157372_101602152 163
129 3300013307 Ga0157372_10177220 Ga0157372_101772202 163
130 3300013308 Ga0157375_11118605 Ga0157375_111186052 163
131 3300014326 Ga0157380_10002522 Ga0157380_100025223 163
132 3300014968 Ga0157379_11184452 Ga0157379_111844522 163
133 3300025921 Ga0207652_10511651 Ga0207652_105116512 163
134 3300025927 Ga0207687_11522355 Ga0207687_115223551 163
135 3300025937 Ga0207669_10059848 Ga0207669_100598482 163
136 3300025944 Ga0207661_10884498 Ga0207661_108844982 163
137 3300025981 Ga0207640_10928199 Ga0207640_109281991 163
138 3300026067 Ga0207678_10113844 Ga0207678_101138442 163
139 3300026116 Ga0207674_10752301 Ga0207674_107523012 163
140 3300026142 Ga0207698_10313591 Ga0207698_103135913 163
141 3300026142 Ga0207698_10315219 Ga0207698_103152193 163
142 3300031251 Ga0265327_10048390 Ga0265327_100483902 163
143 3300031824 Ga0307413_11376380 Ga0307413_113763801 163
144 3300035172 Ga0373955_0643835 Ga0373955_0643835_33_566 163
145 3300037471 Ga0395905_1051906 Ga0395905_1051906_106_612 163
146 3300039437 Ga0436365_1268336 Ga0436365_1268336_410_901 163
147 3300039437 Ga0436365_1387367 Ga0436365_1387367_45_536 163
148 3300041486 Ga0451807_2000955 Ga0451807_2000955_95_586 163
149 3300044658 Ga0466972_0022334 Ga0466972_0022334_498_998 163
150 3300044765 Ga0466970_0155647 Ga0466970_0155647_120_632 163
151 3300045049 Ga0466959_0017453 Ga0466959_0017453_1764_2264 163
152 3300045051 Ga0451576_1177369 Ga0451576_1177369_77_580 163
153 3300047320 Ga0495672_0290873 Ga0495672_0290873_20_511 163
154 3300053156 Ga0500622_0171992 Ga0500622_0171992_104_610 163
155 3300002737 JGI25162J39368_1001835 JGI25162J39368_10018356 164
156 3300002772 JGI25164J39214_1001641 JGI25164J39214_10016412 164
157 3300003214 JGI25165J46597_1001084 JGI25165J46597_10010849 164
158 3300003323 rootH1_10006508 rootH1_1000650819 164
159 3300003323 rootH1_10078320 rootH1_100783209 164
160 3300005356 Ga0070674_100244200 Ga0070674_1002442002 164
161 3300005530 Ga0070679_100649875 Ga0070679_1006498751 164
162 3300005544 Ga0070686_100145725 Ga0070686_1001457252 164
163 3300005548 Ga0070665_101023016 Ga0070665_1010230161 164
164 3300005563 Ga0068855_100431674 Ga0068855_1004316742 164
165 3300009093 Ga0105240_10000138 Ga0105240_1000013810 164
166 3300009093 Ga0105240_10173149 Ga0105240_101731492 164
167 3300009093 Ga0105240_10214430 Ga0105240_102144303 164
168 3300009093 Ga0105240_10229847 Ga0105240_102298474 164
169 3300009098 Ga0105245_10993927 Ga0105245_109939271 164
170 3300009174 Ga0105241_10696921 Ga0105241_106969211 164
171 3300009174 Ga0105241_10946998 Ga0105241_109469981 164
172 3300009545 Ga0105237_10000621 Ga0105237_1000062136 164
173 3300009545 Ga0105237_10139891 Ga0105237_101398913 164
174 3300009551 Ga0105238_10302291 Ga0105238_103022911 164
175 3300010375 Ga0105239_10000674 Ga0105239_100006746 164
176 3300010375 Ga0105239_10004652 Ga0105239_100046527 164
177 3300010375 Ga0105239_10062632 Ga0105239_100626322 164
178 3300010375 Ga0105239_10101570 Ga0105239_101015702 164
179 3300013102 Ga0157371_10000753 Ga0157371_100007537 164
180 3300013297 Ga0157378_11511385 Ga0157378_115113851 164
181 3300025230 Ga0209563_105443 Ga0209563_1054433 164
182 3300025231 Ga0207427_100072 Ga0207427_10007243 164
183 3300025233 Ga0209437_100026 Ga0209437_100026299 164
184 3300025250 Ga0209026_1001447 Ga0209026_10014476 164
185 3300025261 Ga0209233_1000111 Ga0209233_1000111193 164
186 3300025272 Ga0209455_1002664 Ga0209455_10026647 164
187 3300025911 Ga0207654_10178935 Ga0207654_101789351 164
188 3300025913 Ga0207695_10000064 Ga0207695_10000064211 164
189 3300025913 Ga0207695_10109882 Ga0207695_101098822 164
190 3300025913 Ga0207695_11260134 Ga0207695_112601341 164
191 3300025914 Ga0207671_10005374 Ga0207671_100053743 164
192 3300025914 Ga0207671_10029708 Ga0207671_100297084 164
193 3300025937 Ga0207669_10239312 Ga0207669_102393121 164
194 3300026041 Ga0207639_10798358 Ga0207639_107983582 164
195 3300026078 Ga0207702_10024540 Ga0207702_100245402 164
196 3300028379 Ga0268266_11312540 Ga0268266_113125401 164
197 3300031507 Ga0307509_10193829 Ga0307509_101938292 164
198 3300031507 Ga0307509_10776924 Ga0307509_107769241 164
199 3300031691 Ga0316579_10340023 Ga0316579_103400231 164
200 3300031727 Ga0316576_10137457 Ga0316576_101374573 164
201 3300031728 Ga0316578_10027794 Ga0316578_100277943 164
202 3300032137 Ga0316585_10052542 Ga0316585_100525422 164
203 3300032139 Ga0316580_10117148 Ga0316580_101171482 164
204 3300035398 Ga0316574_0720079 Ga0316574_0720079_92_598 164
205 3300036647 Ga0316582_0034771 Ga0316582_0034771_1552_2058 164
206 3300041997 Ga0439431_0004105 Ga0439431_0004105_1792_2286 164
207 3300042004 Ga0439445_0004861 Ga0439445_0004861_979_1473 164
208 3300046616 Ga0495668_0000789 Ga0495668_0000789_36108_36602 164
209 3300046660 Ga0495625_0073268 Ga0495625_0073268_1769_2293 164
210 3300047472 Ga0495686_0000414 Ga0495686_0000414_20204_20698 164
211 3300049690 Ga0501261_012628 Ga0501261_012628_23_517 164
212 3300049766 Ga0501269_002102 Ga0501269_002102_1581_2075 164
213 3300049766 Ga0501269_009814 Ga0501269_009814_370_867 164
214 3300050493 nmdc:mga0k408_407388_c1 nmdc:mga0k408_407388_c1_134_667 164
215 3300053130 Ga0500642_0029309 Ga0500642_0029309_500_994 164
216 3300053130 Ga0500642_0281164 Ga0500642_0281164_140_706 164
217 3300053153 Ga0500616_0001074 Ga0500616_0001074_18877_19371 164
218 3300053158 Ga0500627_0005928 Ga0500627_0005928_1198_1692 164
219 3300009545 Ga0105237_10189913 Ga0105237_101899133 165
220 3300025914 Ga0207671_10000588 Ga0207671_1000058828 165
221 3300031251 Ga0265327_10000060 Ga0265327_10000060115 165
222 3300032004 Ga0307414_10001858 Ga0307414_100018586 165
223 3300044712 Ga0453684_0569033 Ga0453684_0569033_381_893 165
224 3300001904 JGI24736J21556_1031447 JGI24736J21556_10314471 167
225 3300005548 Ga0070665_100001998 Ga0070665_1000019984 167
226 3300009093 Ga0105240_10525178 Ga0105240_105251783 167
227 3300009551 Ga0105238_11108881 Ga0105238_111088812 167
228 3300010375 Ga0105239_10119221 Ga0105239_101192212 167
229 3300010375 Ga0105239_10172511 Ga0105239_101725114 167
230 3300025904 Ga0207647_10016688 Ga0207647_100166886 167
231 3300025913 Ga0207695_10004186 Ga0207695_100041868 167
232 3300028379 Ga0268266_10001978 Ga0268266_100019784 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13098

Thioredoxin_2

Thioredoxin-like domain

72

166

0.88

PF13899

Thioredoxin_7

Thioredoxin-like

60

148

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5o-assembly1.cif.gz_B structure of leishmania tarentolae ift-a (state 1) 0.894 116 133
3fk8-assembly1.cif.gz_A the crystal structure of disulphide isomerase from xylella fastidiosa temecula1 0.8825 28 154
3dsm-assembly1.cif.gz_A crystal structure of the surface layer protein bacuni_02894 from bacteroides uniformis, northeast structural genomics consortium target btr193d. 0.8601 116 133
8okv-assembly4.cif.gz_D lipoprotein bt2095 from bacteroides thetaiotamicron bound to cyanocobalamin cncbl 0.8454 116 133
3fk8-assembly1.cif.gz_A the crystal structure of disulphide isomerase from xylella fastidiosa temecula1 0.8451 28 154
ID Description Score Start End Superfamily
af_A0A1D8PDU1_1968_2222_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9697 116 133 2.130.10.10
af_A0A0R4IBA6_29_133_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8836 115 133 2.60.40.10
3fk8A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8811 28 154 3.40.30.10
af_A0A0G2K063_398_575_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8647 118 132 2.130.10.10
af_F4JHM9_558_947_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8624 118 133 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2U2PA95-F1-model_v4 Thioredoxin family protein 0.9766 28 167 GO:0015035
GO:0045454
AF-A0A4R7BUI7-F1-model_v4 deleted 0.9759 29 165
AF-A0A1H8HAC0-F1-model_v4 Thioredoxin-related protein 0.9733 29 165 GO:0015035
GO:0045454
AF-A0A7X8BE53-F1-model_v4 deleted 0.9718 27 161
AF-A0A2G4GJ05-F1-model_v4 Thioredoxin family protein 0.9717 30 165

Feature Viewer

pLDDT pTM Quality
89.14 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map