F344484

General Info

Members Datasets Scaffolds Average Seq Length
231 132 462 276

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0337933|Ga0501080_0337933_57_1016
Length 309
Sequence VLGAPIKFRLAKENATDSPPAGSFDLHEFPFLLCSAFMNLAFTKYHALGNDYIVINPKDLSAPLTTEQVKTICHRNFGVGSDGILLGPLPAENAKCALKIYNPDGSIAEKSGNGLRIFSRYLWDTKFVGNDEFAIQTDGGLVRSTVFAGGKMVRVEMGKVSFDSEKIPVTGAKREVINEKISVGGREFTFCAATIGNPHCVLPLPEISAGLAHEFGPLLEVHPNFPRKTNVQFLKVRDRANIQIEIWERGAGYTLASAHKLGLVDKNVSVHCPGGIIKIEIRDGFDILMTGSVTKVSEGVISPEIFSAD

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
24 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
25 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
26 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
27 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
41 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
42 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
63 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
64 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
65 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
66 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
67 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
68 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
69 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
70 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
77 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
78 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
79 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
129 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
130 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
131 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
132 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 3.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0337933 3300049742 Bacteria 1361
2 rootH2_10112967 3300003320 Bacteria 13975
3 Ga0068869_100000593 3300005334 Bacteria 20315
4 Ga0070689_100023870 3300005340 Bacteria 4584
5 Ga0070689_100066082 3300005340 Bacteria 2817
6 Ga0070709_10014236 3300005434 Bacteria 4496
7 Ga0070714_100013373 3300005435 Bacteria 6578
8 Ga0070711_100002009 3300005439 Bacteria 11454
9 Ga0070708_100578707 3300005445 Bacteria 1059
10 Ga0070681_10070041 3300005458 Bacteria 3473
11 Ga0070681_10204341 3300005458 Bacteria 1893
12 Ga0070707_100529637 3300005468 Bacteria 1140
13 Ga0070679_100067822 3300005530 Bacteria 3558
14 Ga0068855_100013070 3300005563 Bacteria 10013
15 Ga0068855_100059893 3300005563 Bacteria 4454
16 Ga0068855_100355196 3300005563 Bacteria 1614
17 Ga0068856_100000160 3300005614 Bacteria 69926
18 Ga0068856_100002151 3300005614 Bacteria 20406
19 Ga0068856_100011530 3300005614 Bacteria 8575
20 Ga0068856_100070898 3300005614 Bacteria 3448
21 Ga0068859_100106711 3300005617 Bacteria 2860
22 Ga0068862_100625262 3300005844 Bacteria 1036
23 Ga0075431_100548872 3300006847 Bacteria 1143
24 Ga0097620_100106706 3300006931 Bacteria 2860
25 Ga0097620_100606089 3300006931 Bacteria 1188
26 Ga0105240_10216342 3300009093 Bacteria 2235
27 Ga0105240_10402329 3300009093 Bacteria 1542
28 Ga0111539_10164742 3300009094 Bacteria 2592
29 Ga0105238_10008508 3300009551 Bacteria 10270
30 Ga0105238_10061991 3300009551 Bacteria 3741
31 Ga0105238_10177867 3300009551 Bacteria 2104
32 Ga0157372_10490383 3300013307 Unclassified 1433
33 Ga0157375_10393112 3300013308 Bacteria 1553
34 Ga0157380_10199696 3300014326 Bacteria 1773
35 Ga0213872_10014898 3300021361 Bacteria 3620
36 Ga0213872_10075339 3300021361 Bacteria 1519
37 Ga0213872_10078655 3300021361 Bacteria 1482
38 Ga0213872_10092390 3300021361 Bacteria 1354
39 Ga0213876_10005415 3300021384 Bacteria 7025
40 Ga0213871_10025018 3300021441 Bacteria 1517
41 Ga0207699_10077369 3300025906 Bacteria 2052
42 Ga0207707_10102189 3300025912 Bacteria 2506
43 Ga0207695_10035653 3300025913 Bacteria 5390
44 Ga0207663_10002022 3300025916 Bacteria 9639
45 Ga0207652_10044796 3300025921 Bacteria 3770
46 Ga0207694_10045527 3300025924 Bacteria 3389
47 Ga0207694_10183254 3300025924 Bacteria 1699
48 Ga0207670_10034900 3300025936 Bacteria 3256
49 Ga0207670_10112500 3300025936 Bacteria 1965
50 Ga0207665_10156739 3300025939 Bacteria 1635
51 Ga0207667_10107480 3300025949 Unclassified 2879
52 Ga0207667_10248385 3300025949 Unclassified 1820
53 Ga0207667_10335027 3300025949 Bacteria 1545
54 Ga0207708_10153637 3300026075 Bacteria 1814
55 Ga0207702_10000736 3300026078 Bacteria 34979
56 Ga0207702_10000885 3300026078 Bacteria 31187
57 Ga0207702_10009506 3300026078 Bacteria 8164
58 Ga0207641_10032685 3300026088 Bacteria 4321
59 Ga0207674_10199369 3300026116 Unclassified 1951
60 Ga0265337_1000255 3300028556 Bacteria 28809
61 Ga0265337_1010857 3300028556 Bacteria 3167
62 Ga0265337_1057162 3300028556 Bacteria 1086
63 Ga0265326_10029918 3300028558 Bacteria 1551
64 Ga0265319_1000016 3300028563 Bacteria 176245
65 Ga0265319_1000053 3300028563 Bacteria 94221
66 Ga0265319_1063284 3300028563 Bacteria 1197
67 Ga0265334_10023463 3300028573 Bacteria 2508
68 Ga0265318_10000963 3300028577 Bacteria 18482
69 Ga0265323_10021065 3300028653 Unclassified 2502
70 Ga0265336_10010998 3300028666 Bacteria 3084
71 Ga0265336_10051040 3300028666 Bacteria 1249
72 Ga0265338_10000220 3300028800 Bacteria 106037
73 Ga0265338_10001944 3300028800 Bacteria 32265
74 Ga0265338_10002229 3300028800 Bacteria 29539
75 Ga0265338_10012018 3300028800 Bacteria 9909
76 Ga0265338_10045174 3300028800 Bacteria 4054
77 Ga0265338_10073023 3300028800 Bacteria 2926
78 Ga0265338_10100384 3300028800 Bacteria 2361
79 Ga0265338_10125603 3300028800 Bacteria 2036
80 Ga0265338_10225761 3300028800 Bacteria 1396
81 Ga0265338_10251844 3300028800 Bacteria 1302
82 Ga0265324_10000316 3300029957 Bacteria 35472
83 Ga0265324_10002438 3300029957 Bacteria 9523
84 Ga0265324_10016791 3300029957 Bacteria 2665
85 Ga0265324_10031355 3300029957 Bacteria 1862
86 Ga0265324_10037117 3300029957 Bacteria 1694
87 Ga0265320_10005101 3300031240 Bacteria 8483
88 Ga0265320_10018123 3300031240 Bacteria 3887
89 Ga0265325_10015330 3300031241 Bacteria 4311
90 Ga0265339_10102709 3300031249 Bacteria 1486
91 Ga0265327_10001342 3300031251 Bacteria 31932
92 Ga0265327_10008420 3300031251 Bacteria 7682
93 Ga0265316_10129556 3300031344 Bacteria 1901
94 Ga0265316_10192266 3300031344 Bacteria 1515
95 Ga0265316_10298365 3300031344 Bacteria 1174
96 Ga0307408_100000033 3300031548 Bacteria 212574
97 Ga0265313_10001669 3300031595 Bacteria 20533
98 Ga0265313_10003086 3300031595 Bacteria 13812
99 Ga0265314_10028935 3300031711 Bacteria 4123
100 Ga0265314_10067647 3300031711 Bacteria 2404
101 Ga0265342_10049375 3300031712 Bacteria 2518
102 Ga0265342_10187348 3300031712 Bacteria 1131
103 Ga0316578_10039965 3300031728 Bacteria 2710
104 Ga0307410_10000008 3300031852 Bacteria 93917
105 Ga0307407_10086455 3300031903 Bacteria 1910
106 Ga0307407_10154806 3300031903 Bacteria 1493
107 Ga0307407_10161270 3300031903 Bacteria 1467
108 Ga0307409_100000274 3300031995 Bacteria 20897
109 Ga0373930_0016945 3300034816 Bacteria 1383
110 Ga0373928_0000022 3300035084 Bacteria 27033
111 Ga0373929_0000066 3300035085 Bacteria 17808
112 Ga0373944_0000026 3300035089 Bacteria 25249
113 Ga0373949_0010054 3300035090 Bacteria 2070
114 Ga0373932_0000005 3300035112 Bacteria 259528
115 Ga0373954_0056279 3300035118 Bacteria 1851
116 Ga0373956_0040357 3300035119 Bacteria 2070
117 Ga0373962_0000721 3300035242 Bacteria 7476
118 Ga0373931_0000016 3300035691 Bacteria 217932
119 Ga0373927_0136718 3300035695 Bacteria 1602
120 Ga0373947_0010966 3300035725 Bacteria 5201
121 Ga0373925_0000371 3300037068 Bacteria 46792
122 Ga0373925_0008185 3300037068 Bacteria 7611
123 Ga0436364_1534455 3300037853 Bacteria 1261
124 Ga0400490_46714 3300038726 Bacteria 5955
125 Ga0400483_003009 3300039062 Bacteria 1934
126 Ga0400483_186374 3300039062 Bacteria 1709
127 Ga0400489_11059 3300039093 Unclassified 1621
128 Ga0400489_55143 3300039093 Bacteria 1116
129 Ga0400487_64172 3300039110 Bacteria 1932
130 Ga0436365_1147197 3300039437 Bacteria 51071
131 Ga0436360_0120256 3300039438 Bacteria 6051
132 Ga0436360_0628619 3300039438 Unclassified 1300
133 Ga0436361_0178817 3300039447 Bacteria 2730
134 Ga0436361_0255556 3300039447 Bacteria 2676
135 Ga0436361_0348672 3300039447 Bacteria 3999
136 Ga0436361_0564859 3300039447 Bacteria 1319
137 Ga0436361_0652977 3300039447 Bacteria 1372
138 Ga0436361_0690171 3300039447 Bacteria 5576
139 Ga0436363_1562846 3300039450 Bacteria 8622
140 Ga0436362_0457527 3300039453 Bacteria 1689
141 Ga0436362_0933503 3300039453 Bacteria 2938
142 Ga0451577_0000012 3300042876 Bacteria 575467
143 Ga0451577_0124214 3300042876 Bacteria 2313
144 Ga0466969_0066855 3300044656 Bacteria 1735
145 Ga0453683_0006766 3300044673 Bacteria 7832
146 Ga0466966_0073079 3300044684 Bacteria 2146
147 Ga0453684_0000266 3300044712 Bacteria 225447
148 Ga0453684_0021954 3300044712 Bacteria 9500
149 Ga0453684_0144017 3300044712 Bacteria 2841
150 Ga0453684_0153692 3300044712 Bacteria 2731
151 Ga0453684_0335483 3300044712 Bacteria 1709
152 Ga0451576_0000183 3300045051 Bacteria 157422
153 Ga0451576_0002006 3300045051 Bacteria 32254
154 Ga0451576_0009167 3300045051 Bacteria 11499
155 Ga0451576_0015961 3300045051 Bacteria 8302
156 Ga0451576_0166745 3300045051 Bacteria 2299
157 Ga0451576_0207918 3300045051 Bacteria 2044
158 Ga0451576_0667280 3300045051 Bacteria 1092
159 Ga0495629_0025595 3300046459 Bacteria 4193
160 Ga0495618_0202165 3300046514 Bacteria 1257
161 Ga0495630_0091933 3300046517 Bacteria 2293
162 Ga0495630_0314263 3300046517 Bacteria 1198
163 Ga0495586_0034219 3300046535 Bacteria 2728
164 Ga0495622_0009966 3300046557 Unclassified 4395
165 Ga0495667_0043263 3300046559 Bacteria 2985
166 Ga0495634_0021383 3300046642 Bacteria 4574
167 Ga0495635_0236614 3300046663 Bacteria 1233
168 Ga0495613_0011941 3300046689 Bacteria 6456
169 Ga0495684_0269243 3300047471 Bacteria 1233
170 Ga0501031_0001479 3300049568 Bacteria 14597
171 Ga0501032_0000630 3300049569 Bacteria 28576
172 Ga0501032_0002579 3300049569 Bacteria 14179
173 Ga0501032_0020762 3300049569 Bacteria 4572
174 Ga0501032_0149400 3300049569 Unclassified 1537
175 Ga0501033_0001657 3300049570 Bacteria 19493
176 Ga0501033_0002094 3300049570 Bacteria 17297
177 Ga0501033_0024941 3300049570 Bacteria 4506
178 Ga0501034_0046109 3300049571 Bacteria 4404
179 Ga0501036_0193138 3300049572 Bacteria 1713
180 Ga0501036_0205710 3300049572 Bacteria 1655
181 Ga0501036_0258629 3300049572 Bacteria 1458
182 Ga0501037_0023158 3300049573 Bacteria 4593
183 Ga0501038_0006296 3300049574 Bacteria 10977
184 Ga0501039_0028118 3300049575 Bacteria 4326
185 Ga0501039_0079120 3300049575 Bacteria 2558
186 Ga0501040_0057345 3300049576 Bacteria 2674
187 Ga0501042_0212373 3300049578 Bacteria 1396
188 Ga0501043_0194646 3300049579 Bacteria 1575
189 Ga0501046_0001375 3300049580 Bacteria 23420
190 Ga0501046_0007594 3300049580 Bacteria 9510
191 Ga0501046_0070236 3300049580 Bacteria 2723
192 Ga0501047_0008005 3300049581 Bacteria 9967
193 Ga0501047_0092610 3300049581 Bacteria 2901
194 Ga0501047_0101836 3300049581 Bacteria 2751
195 Ga0501047_0148934 3300049581 Bacteria 2216
196 Ga0501047_0196741 3300049581 Bacteria 1878
197 Ga0501068_0025282 3300049584 Bacteria 3493
198 Ga0501070_0438117 3300049586 Bacteria 1054
199 Ga0501072_0142247 3300049588 Bacteria 1913
200 Ga0501075_0115504 3300049591 Bacteria 2041
201 Ga0501075_0274319 3300049591 Bacteria 1285
202 Ga0501075_0348617 3300049591 Bacteria 1128
203 Ga0501077_0019688 3300049593 Bacteria 4269
204 Ga0501077_0072722 3300049593 Bacteria 2179
205 Ga0501079_0046478 3300049741 Bacteria 3350
206 Ga0501080_0290337 3300049742 Bacteria 1485
207 Ga0501083_0006172 3300049744 Bacteria 8500
208 Ga0501083_0152405 3300049744 Bacteria 1513
209 Ga0501035_0002668 3300049822 Bacteria 17364
210 Ga0501035_0034342 3300049822 Bacteria 4608
211 Ga0501035_0041617 3300049822 Bacteria 4148
212 Ga0501035_0085258 3300049822 Bacteria 2785
213 Ga0501044_0001754 3300049823 Bacteria 25321
214 Ga0501044_0002137 3300049823 Bacteria 22644
215 Ga0501044_0002836 3300049823 Bacteria 19727
216 Ga0501044_0011989 3300049823 Bacteria 9391
217 Ga0501044_0021336 3300049823 Bacteria 6913
218 Ga0501044_0108003 3300049823 Bacteria 2793
219 Ga0501044_0393723 3300049823 Bacteria 1299
220 Ga0501045_0245837 3300049824 Bacteria 1332
221 Ga0501045_0276160 3300049824 Bacteria 1251
222 Ga0501045_0371238 3300049824 Bacteria 1065
223 nmdc:mga06r32_526767_c1 3300050510 Bacteria 1157
224 nmdc:mga08y16_135816_c1 3300050511 Bacteria 2556
225 Ga0500568_0037847 3300053139 Bacteria 1955
226 Ga0501082_0073017 3300060353 Bacteria 2955
227 Ga0530510_0015229 3300061734 Bacteria 5430
228 2788436539 2786546940 Bacteria 6396474
229 2913920087 2913912277 Bacteria 9037797
230 8002747023 8002745576 Bacteria 4840272
231 8007372601 8007371054 Bacteria 4849201
232 Ga0501080_0337933
233 rootH2_10112967
234 Ga0068869_100000593
235 Ga0070689_100023870
236 Ga0070689_100066082
237 Ga0070709_10014236
238 Ga0070714_100013373
239 Ga0070711_100002009
240 Ga0070708_100578707
241 Ga0070681_10070041
242 Ga0070681_10204341
243 Ga0070707_100529637
244 Ga0070679_100067822
245 Ga0068855_100013070
246 Ga0068855_100059893
247 Ga0068855_100355196
248 Ga0068856_100000160
249 Ga0068856_100002151
250 Ga0068856_100011530
251 Ga0068856_100070898
252 Ga0068859_100106711
253 Ga0068862_100625262
254 Ga0075431_100548872
255 Ga0097620_100106706
256 Ga0097620_100606089
257 Ga0105240_10216342
258 Ga0105240_10402329
259 Ga0111539_10164742
260 Ga0105238_10008508
261 Ga0105238_10061991
262 Ga0105238_10177867
263 Ga0157372_10490383
264 Ga0157375_10393112
265 Ga0157380_10199696
266 Ga0213872_10014898
267 Ga0213872_10075339
268 Ga0213872_10078655
269 Ga0213872_10092390
270 Ga0213876_10005415
271 Ga0213871_10025018
272 Ga0207699_10077369
273 Ga0207707_10102189
274 Ga0207695_10035653
275 Ga0207663_10002022
276 Ga0207652_10044796
277 Ga0207694_10045527
278 Ga0207694_10183254
279 Ga0207670_10034900
280 Ga0207670_10112500
281 Ga0207665_10156739
282 Ga0207667_10107480
283 Ga0207667_10248385
284 Ga0207667_10335027
285 Ga0207708_10153637
286 Ga0207702_10000736
287 Ga0207702_10000885
288 Ga0207702_10009506
289 Ga0207641_10032685
290 Ga0207674_10199369
291 Ga0265337_1000255
292 Ga0265337_1010857
293 Ga0265337_1057162
294 Ga0265326_10029918
295 Ga0265319_1000016
296 Ga0265319_1000053
297 Ga0265319_1063284
298 Ga0265334_10023463
299 Ga0265318_10000963
300 Ga0265323_10021065
301 Ga0265336_10010998
302 Ga0265336_10051040
303 Ga0265338_10000220
304 Ga0265338_10001944
305 Ga0265338_10002229
306 Ga0265338_10012018
307 Ga0265338_10045174
308 Ga0265338_10073023
309 Ga0265338_10100384
310 Ga0265338_10125603
311 Ga0265338_10225761
312 Ga0265338_10251844
313 Ga0265324_10000316
314 Ga0265324_10002438
315 Ga0265324_10016791
316 Ga0265324_10031355
317 Ga0265324_10037117
318 Ga0265320_10005101
319 Ga0265320_10018123
320 Ga0265325_10015330
321 Ga0265339_10102709
322 Ga0265327_10001342
323 Ga0265327_10008420
324 Ga0265316_10129556
325 Ga0265316_10192266
326 Ga0265316_10298365
327 Ga0307408_100000033
328 Ga0265313_10001669
329 Ga0265313_10003086
330 Ga0265314_10028935
331 Ga0265314_10067647
332 Ga0265342_10049375
333 Ga0265342_10187348
334 Ga0316578_10039965
335 Ga0307410_10000008
336 Ga0307407_10086455
337 Ga0307407_10154806
338 Ga0307407_10161270
339 Ga0307409_100000274
340 Ga0373930_0016945
341 Ga0373928_0000022
342 Ga0373929_0000066
343 Ga0373944_0000026
344 Ga0373949_0010054
345 Ga0373932_0000005
346 Ga0373954_0056279
347 Ga0373956_0040357
348 Ga0373962_0000721
349 Ga0373931_0000016
350 Ga0373927_0136718
351 Ga0373947_0010966
352 Ga0373925_0000371
353 Ga0373925_0008185
354 Ga0436364_1534455
355 Ga0400490_46714
356 Ga0400483_003009
357 Ga0400483_186374
358 Ga0400489_11059
359 Ga0400489_55143
360 Ga0400487_64172
361 Ga0436365_1147197
362 Ga0436360_0120256
363 Ga0436360_0628619
364 Ga0436361_0178817
365 Ga0436361_0255556
366 Ga0436361_0348672
367 Ga0436361_0564859
368 Ga0436361_0652977
369 Ga0436361_0690171
370 Ga0436363_1562846
371 Ga0436362_0457527
372 Ga0436362_0933503
373 Ga0451577_0000012
374 Ga0451577_0124214
375 Ga0466969_0066855
376 Ga0453683_0006766
377 Ga0466966_0073079
378 Ga0453684_0000266
379 Ga0453684_0021954
380 Ga0453684_0144017
381 Ga0453684_0153692
382 Ga0453684_0335483
383 Ga0451576_0000183
384 Ga0451576_0002006
385 Ga0451576_0009167
386 Ga0451576_0015961
387 Ga0451576_0166745
388 Ga0451576_0207918
389 Ga0451576_0667280
390 Ga0495629_0025595
391 Ga0495618_0202165
392 Ga0495630_0091933
393 Ga0495630_0314263
394 Ga0495586_0034219
395 Ga0495622_0009966
396 Ga0495667_0043263
397 Ga0495634_0021383
398 Ga0495635_0236614
399 Ga0495613_0011941
400 Ga0495684_0269243
401 Ga0501031_0001479
402 Ga0501032_0000630
403 Ga0501032_0002579
404 Ga0501032_0020762
405 Ga0501032_0149400
406 Ga0501033_0001657
407 Ga0501033_0002094
408 Ga0501033_0024941
409 Ga0501034_0046109
410 Ga0501036_0193138
411 Ga0501036_0205710
412 Ga0501036_0258629
413 Ga0501037_0023158
414 Ga0501038_0006296
415 Ga0501039_0028118
416 Ga0501039_0079120
417 Ga0501040_0057345
418 Ga0501042_0212373
419 Ga0501043_0194646
420 Ga0501046_0001375
421 Ga0501046_0007594
422 Ga0501046_0070236
423 Ga0501047_0008005
424 Ga0501047_0092610
425 Ga0501047_0101836
426 Ga0501047_0148934
427 Ga0501047_0196741
428 Ga0501068_0025282
429 Ga0501070_0438117
430 Ga0501072_0142247
431 Ga0501075_0115504
432 Ga0501075_0274319
433 Ga0501075_0348617
434 Ga0501077_0019688
435 Ga0501077_0072722
436 Ga0501079_0046478
437 Ga0501080_0290337
438 Ga0501083_0006172
439 Ga0501083_0152405
440 Ga0501035_0002668
441 Ga0501035_0034342
442 Ga0501035_0041617
443 Ga0501035_0085258
444 Ga0501044_0001754
445 Ga0501044_0002137
446 Ga0501044_0002836
447 Ga0501044_0011989
448 Ga0501044_0021336
449 Ga0501044_0108003
450 Ga0501044_0393723
451 Ga0501045_0245837
452 Ga0501045_0276160
453 Ga0501045_0371238
454 nmdc:mga06r32_526767_c1
455 nmdc:mga08y16_135816_c1
456 Ga0500568_0037847
457 Ga0501082_0073017
458 Ga0530510_0015229
459 2788436539
460 2913920087
461 8002747023
462 8007372601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

42

162

0.98

PF01678

DAP_epimerase

Diaminopimelate epimerase

191

296

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d13-assembly1.cif.gz_A crystal structure of e.coli rpph-dapf complex 0.9011 1 268
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8984 1 265
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.8978 1 273
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.8855 1 273
4ik0-assembly1.cif.gz_A crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli 0.8815 1 268
ID Description Score Start End Superfamily
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9183 152 255 3.10.310.10
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9056 1 112 3.10.310.10
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9051 140 249 3.10.310.10
2otnB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8991 122 255 3.10.310.10
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8826 1 112 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A7C5LLB0-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9781 1 143 GO:0005829
GO:0008837
GO:0009089
AF-A0A7C5LLB0-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9713 1 143 GO:0005829
GO:0008837
GO:0009089
AF-A0A3B9S173-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9682 60 276 GO:0005829
GO:0008837
GO:0009089
AF-A0A2V5WNS9-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9613 1 203 GO:0005829
GO:0008837
GO:0009089
AF-A0A7C4T402-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.961 82 273 GO:0005829
GO:0008837
GO:0009089

Map